GenomeNet

Database: Pfam
Entry: DUF3963
LinkDB: DUF3963
Original site: DUF3963 
#=GF ID   DUF3963
#=GF AC   PF13124.9
#=GF DE   Protein of unknown function (DUF3963)
#=GF AU   Aldam G;0000-0003-3039-8438
#=GF AU   Mistry J;0000-0003-2479-5322
#=GF SE   Pfam-B_1512 (release 24.0)
#=GF GA   25.00 25.00;
#=GF TC   25.90 102.00;
#=GF NC   24.90 20.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR025011;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family of proteins is functionally uncharacterised. This
#=GF CC   family of proteins is found in bacteria. Proteins in this family
#=GF CC   are typically between 42 and 85 amino acids in length. There is
#=GF CC   a conserved DIQKW sequence motif.
#=GF SQ   3
#=GS A0A6L8PPG6_BACAN/44-83  AC A0A6L8PPG6.1
#=GS Q813B3_BACCR/1-40       AC Q813B3.1
#=GS Q813B2_BACCR/44-83      AC Q813B2.1
A0A6L8PPG6_BACAN/44-83             MLSIYTAFIEKYFHDIQKWIRNITFCFALLVVVLVALWLG
Q813B3_BACCR/1-40                  MLTINAIFIERYFGDIQKWIRNITCCLALFVVVLVALWIG
Q813B2_BACCR/44-83                 MLTINAIFIERYFGDIQKWIRNITCCFALFVVVLVALWIG
#=GC seq_cons                      MLTINAIFIERYFGDIQKWIRNITCCFALFVVVLVALWIG
//
DBGET integrated database retrieval system