#=GF ID   DUF5836
#=GF AC   PF19154.3
#=GF DE   Family of unknown function (DUF5836)
#=GF AU   Finn RD;0000-0001-8626-2148
#=GF AU   Williams LS;0000-0001-5551-8526
#=GF SE   Manual
#=GF GA   25.00 25.00;
#=GF TC   27.80 103.60;
#=GF NC   21.40 19.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF RN   [1]
#=GF RM   11932444
#=GF RT   Characterization of the genetic locus responsible for the
#=GF RT   production of ABP-118,  a novel bacteriocin produced by the
#=GF RT   probiotic bacterium Lactobacillus salivarius  subsp. salivarius
#=GF RT   UCC118.
#=GF RA   Flynn S, van Sinderen D, Thornton GM, Holo H, Nes IF, Collins
#=GF RA   JK;
#=GF RL   Microbiology. 2002;148:973-984.
#=GF RN   [2]
#=GF RM   19591924
#=GF RT   Characterization of salivaricin CRL 1328, a two-peptide
#=GF RT   bacteriocin produced by Lactobacillus salivarius CRL 1328
#=GF RT   isolated from the human vagina.
#=GF RA   Vera Pingitore E, Hebert EM, Nader-Macias ME, Sesma F;
#=GF RL   Res Microbiol. 2009;160:401-408.
#=GF DR   INTERPRO; IPR043896;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family represents the induction peptide AbpIP, which 
#=GF CC   regulates the biosynthesis of the bacteriocin ABP-118 in 
#=GF CC   Lactobacillus salivarius subsp. salivarius UCC118 [1,2].
#=GF SQ   1
#=GS Q1WQY0_LACS1/1-38  AC Q1WQY0.1
Q1WQY0_LACS1/1-38             MKFEVLTEKKLQKIAGGATKKGGFKRWQCIFTFFGVCK
#=GC seq_cons                 MKFEVLTEKKLQKIAGGATKKGGFKRWQCIFTFFGVCK
//