GenomeNet

Database: Pfam
Entry: Folate_rec
LinkDB: Folate_rec
Original site: Folate_rec 
#=GF ID   Folate_rec
#=GF AC   PF03024.16
#=GF DE   Folate receptor family
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Pfam-B_1966 (release 6.4)
#=GF GA   29.80 29.80;
#=GF TC   29.80 29.80;
#=GF NC   29.70 29.70;
#=GF BM   hmmbuild --amino HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 57096847 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Folate_receptor
#=GF CL   CL0644
#=GF RN   [1]
#=GF RM   3571203
#=GF RT   Positions of disulfide bonds in riboflavin-binding protein of
#=GF RT   hen egg white. 
#=GF RA   Hamazume Y, Mega T, Ikenaka T; 
#=GF RL   J Biochem (Tokyo) 1987;101:217-223.
#=GF DR   INTERPRO; IPR018143;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This family includes the folate receptor which binds to folate
#=GF CC   and reduced folic acid derivatives and mediates delivery of
#=GF CC   5-methyltetrahydrofolate to the interior of cells. These
#=GF CC   proteins are attached to the membrane by a GPI-anchor. The
#=GF CC   proteins contain 16 conserved cysteines that form eight
#=GF CC   disulphide bridges.
#=GF SQ   2000
#=GS A0A0D9QVZ4_CHLSB/36-211   AC A0A0D9QVZ4.1
#=GS H2PEE7_PONAB/38-171       AC H2PEE7.1
#=GS A0A022RC25_ERYGU/30-193   AC A0A022RC25.1
#=GS G3R6P4_GORGO/30-205       AC G3R6P4.2
#=GS K7EM70_HUMAN/27-177       AC K7EM70.1
#=GS A0BRL9_PARTE/29-183       AC A0BRL9.1
#=GS A0A091HC73_BUCRH/21-188   AC A0A091HC73.1
#=GS A0A094KCD0_ANTCR/1-98     AC A0A094KCD0.1
#=GS A0A3Q7ENE1_SOLLC/41-192   AC A0A3Q7ENE1.1
#=GS A0A3Q2VYP3_HAPBU/23-198   AC A0A3Q2VYP3.1
#=GS A0A1L8F8R7_XENLA/54-213   AC A0A1L8F8R7.1
#=GS A0A2K5Y8K7_MANLE/20-194   AC A0A2K5Y8K7.1
#=GS A0A3P8TBX2_AMPPE/26-207   AC A0A3P8TBX2.1
#=GS A0A3Q7VCQ0_URSAR/27-177   AC A0A3Q7VCQ0.1
#=GS A0A2K5NSK3_CERAT/47-206   AC A0A2K5NSK3.1
#=GS A0A2K6GQH9_PROCO/3-164    AC A0A2K6GQH9.1
#=GS A0A4W2GWX7_BOBOX/30-205   AC A0A4W2GWX7.1
#=GS G3QYN5_GORGO/19-179       AC G3QYN5.2
#=GS V9EAT8_PHYPR/33-184       AC V9EAT8.1
#=GS A0A091HIE9_BUCRH/31-206   AC A0A091HIE9.1
#=GS U3ICJ7_ANAPP/29-190       AC U3ICJ7.2
#=GS A0A2G5DLG5_AQUCA/36-190   AC A0A2G5DLG5.1
#=GS A0A671FGA5_RHIFE/38-220   AC A0A671FGA5.1
#=GS A0A4W6D2B0_LATCA/22-194   AC A0A4W6D2B0.1
#=GS A0A091IU12_EGRGA/31-206   AC A0A091IU12.1
#=GS W5MQI6_LEPOC/34-194       AC W5MQI6.1
#=GS A0A0R3UCR5_9CEST/37-165   AC A0A0R3UCR5.1
#=GS A0A093PLD3_9PASS/3-165    AC A0A093PLD3.1
#=GS A0A1P8BFS7_ARATH/14-174   AC A0A1P8BFS7.1
#=GS F4K5P6_ARATH/57-217       AC F4K5P6.1
#=GS A0A3P8TFB6_AMPPE/26-198   AC A0A3P8TFB6.1
#=GS A0A4W2E4G6_BOBOX/4-164    AC A0A4W2E4G6.1
#=GS A0A3P9BJ31_9CICH/23-198   AC A0A3P9BJ31.1
#=GS A0A0C2N382_THEKT/26-102   AC A0A0C2N382.1
#=GS A0A669E0H7_ORENI/37-209   AC A0A669E0H7.1
#=GS A0A2Y9RL39_TRIMA/30-205   AC A0A2Y9RL39.1
#=GS RTBDN_HUMAN/27-183        AC Q9BSG5.2
#=GS A0A2K5NUV5_CERAT/37-193   AC A0A2K5NUV5.1
#=GS A0A341D9E4_NEOAA/54-210   AC A0A341D9E4.1
#=GS A0A2T7PMZ4_POMCA/48-174   AC A0A2T7PMZ4.1
#=GS A0A1D3D1A4_9EIME/63-234   AC A0A1D3D1A4.1
#=GS A0A1S3HEA3_LINUN/39-216   AC A0A1S3HEA3.1
#=GS A0A2R9BSE7_PANPA/1-108    AC A0A2R9BSE7.1
#=GS A0A3Q1MAD6_BOVIN/42-138   AC A0A3Q1MAD6.1
#=GS A0A6J3RVA1_TURTR/34-209   AC A0A6J3RVA1.1
#=GS A0A212DI86_CEREH/1-106    AC A0A212DI86.1
#=GS G3HSP0_CRIGR/26-186       AC G3HSP0.1
#=GS A0A1D5NYI4_CHICK/27-188   AC A0A1D5NYI4.1
#=GS A0A0P7YL54_SCLFO/38-212   AC A0A0P7YL54.1
#=GS A0A3P9C1U5_9CICH/57-219   AC A0A3P9C1U5.1
#=GS A0A485NL80_LYNPA/14-175   AC A0A485NL80.1
#=GS A0A151NL07_ALLMI/35-221   AC A0A151NL07.1
#=GS A0A093IHD5_FULGA/3-165    AC A0A093IHD5.1
#=GS FOLR1_HUMAN/36-211        AC P15328.3
#=GS FOLR1_HUMAN/36-211        DR PDB; 4LRH H; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 5IZQ G; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 5IZQ D; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 5IZQ H; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 5IZQ E; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 4KM6 A; 36-211;
#=GS FOLR1_HUMAN/36-211        DR PDB; 4LRH F; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 4LRH B; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 4KMX A; 36-211;
#=GS FOLR1_HUMAN/36-211        DR PDB; 4LRH E; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 4LRH D; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 4LRH C; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 4KM7 A; 36-211;
#=GS FOLR1_HUMAN/36-211        DR PDB; 4LRH A; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 4KM7 B; 36-211;
#=GS FOLR1_HUMAN/36-211        DR PDB; 5IZQ C; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 4LRH G; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 5IZQ A; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 5IZQ F; 14-189;
#=GS FOLR1_HUMAN/36-211        DR PDB; 5IZQ B; 14-189;
#=GS A0A2I4B9B7_9TELE/28-206   AC A0A2I4B9B7.1
#=GS A0A226PHQ1_COLVI/21-188   AC A0A226PHQ1.1
#=GS A0A067EM12_CITSI/29-192   AC A0A067EM12.1
#=GS A0A5N5H2P0_9ROSA/26-188   AC A0A5N5H2P0.1
#=GS A0A670IYA0_PODMU/31-172   AC A0A670IYA0.1
#=GS A0A0E0NH62_ORYRU/49-201   AC A0A0E0NH62.1
#=GS A0A093C5Q2_9AVES/3-129    AC A0A093C5Q2.1
#=GS C3Z5S0_BRAFL/64-202       AC C3Z5S0.1
#=GS A0A3Q3WCH9_MOLML/42-208   AC A0A3Q3WCH9.1
#=GS A0A3Q2I4K6_HORSE/36-171   AC A0A3Q2I4K6.1
#=GS A0A093BRP3_CHAPE/31-206   AC A0A093BRP3.1
#=GS A0A5E4CV45_MARMO/104-279  AC A0A5E4CV45.1
#=GS A0A1U7SMZ8_ALLSI/53-228   AC A0A1U7SMZ8.1
#=GS A0A3Q2VVC9_HAPBU/33-194   AC A0A3Q2VVC9.1
#=GS A0A6G1AE76_CROCR/26-208   AC A0A6G1AE76.1
#=GS A0A1V9Z6B1_9STRA/11-177   AC A0A1V9Z6B1.1
#=GS A0A2K6N9T1_RHIRO/36-211   AC A0A2K6N9T1.1
#=GS A0A314KWB8_NICAT/41-192   AC A0A314KWB8.1
#=GS A0A5F4CBX9_CANLF/91-206   AC A0A5F4CBX9.1
#=GS A0A401SFU6_CHIPU/99-260   AC A0A401SFU6.1
#=GS A0A151P3F2_ALLMI/66-228   AC A0A151P3F2.1
#=GS E2R888_CANLF/47-206       AC E2R888.2
#=GS Q94BQ5_ARATH/38-198       AC Q94BQ5.1
#=GS A0A060WNJ3_ONCMY/33-194   AC A0A060WNJ3.1
#=GS A0A3Q3ASB6_KRYMA/46-208   AC A0A3Q3ASB6.1
#=GS W5NI26_LEPOC/18-180       AC W5NI26.1
#=GS A0A401PDQ3_SCYTO/172-236  AC A0A401PDQ3.1
#=GS G1SCR2_RABIT/35-210       AC G1SCR2.1
#=GS H9GSY7_ANOCA/1-64         AC H9GSY7.1
#=GS A0A397Z2E1_BRACM/37-197   AC A0A397Z2E1.1
#=GS H0VJP2_CAVPO/12-187       AC H0VJP2.2
#=GS F7GMA9_CALJA/22-183       AC F7GMA9.2
#=GS A0A4S2LXB7_OPIFE/34-206   AC A0A4S2LXB7.1
#=GS K8EAN2_9CHLO/37-209       AC K8EAN2.1
#=GS A0A093CE29_TAUER/3-129    AC A0A093CE29.1
#=GS A0A3Q1MF97_BOVIN/26-167   AC A0A3Q1MF97.1
#=GS A0A2R9CB09_PANPA/44-206   AC A0A2R9CB09.1
#=GS U3FQI0_CALJA/38-220       AC U3FQI0.1
#=GS A0A2K6GLL1_PROCO/22-183   AC A0A2K6GLL1.1
#=GS A0A4U5Q2I8_POPAL/29-190   AC A0A4U5Q2I8.1
#=GS A0A096MUT0_PAPAN/47-206   AC A0A096MUT0.1
#=GS A0A091RFS2_9GRUI/7-165    AC A0A091RFS2.1
#=GS A0A183TCR0_SCHSO/1-112    AC A0A183TCR0.1
#=GS A0A3R7MUC2_PENVA/16-201   AC A0A3R7MUC2.1
#=GS A0A3Q3BLK1_KRYMA/38-209   AC A0A3Q3BLK1.1
#=GS A0A2P4SLX7_BAMTH/21-123   AC A0A2P4SLX7.1
#=GS A0A3L6QEC6_PANMI/135-286  AC A0A3L6QEC6.1
#=GS H2TG96_TAKRU/121-296      AC H2TG96.2
#=GS A0A674F571_SALTR/44-205   AC A0A674F571.1
#=GS A0A4W2D026_BOBOX/35-210   AC A0A4W2D026.1
#=GS V8N7K0_OPHHA/78-142       AC V8N7K0.1
#=GS A0A091J841_EGRGA/21-188   AC A0A091J841.1
#=GS A0A2K6RRY4_RHIRO/22-183   AC A0A2K6RRY4.1
#=GS A0A1U7QHH8_MESAU/31-206   AC A0A1U7QHH8.1
#=GS L5LKC4_MYODS/27-177       AC L5LKC4.1
#=GS A0A3P8T9E3_AMPPE/37-209   AC A0A3P8T9E3.1
#=GS A0A2Y9DQ33_TRIMA/38-220   AC A0A2Y9DQ33.1
#=GS A0A6J3QW28_TURTR/31-192   AC A0A6J3QW28.1
#=GS A0A210PDV1_MIZYE/48-187   AC A0A210PDV1.1
#=GS A0A091UZ53_NIPNI/1-110    AC A0A091UZ53.1
#=GS A0A3Q2EC14_CYPVA/37-198   AC A0A3Q2EC14.1
#=GS A0A0D9RDG0_CHLSB/24-185   AC A0A0D9RDG0.1
#=GS A0A672JKW0_SALFA/49-221   AC A0A672JKW0.1
#=GS A0A060W5W4_ONCMY/34-195   AC A0A060W5W4.1
#=GS F7DLZ1_XENTR/48-210       AC F7DLZ1.3
#=GS S8CER6_9LAMI/17-162       AC S8CER6.1
#=GS A0A024UI10_9STRA/18-172   AC A0A024UI10.1
#=GS A0A553QUI6_9TELE/54-216   AC A0A553QUI6.1
#=GS A0A674NVP1_TAKRU/29-168   AC A0A674NVP1.1
#=GS A0A1S3AF88_ERIEU/21-196   AC A0A1S3AF88.1
#=GS A0A3Q1GNY2_9TELE/38-210   AC A0A3Q1GNY2.1
#=GS A0A3N0Z0F1_ANAGA/53-215   AC A0A3N0Z0F1.1
#=GS S7MJ59_MYOBR/27-170       AC S7MJ59.1
#=GS A0A3Q1F5K7_9TELE/38-210   AC A0A3Q1F5K7.1
#=GS A0A1V4JUL1_PATFA/1-154    AC A0A1V4JUL1.1
#=GS A0A2Y9L219_ENHLU/31-206   AC A0A2Y9L219.1
#=GS K7FXM7_PELSI/32-199       AC K7FXM7.1
#=GS A0A2K5MME5_CERAT/20-181   AC A0A2K5MME5.1
#=GS A0A5N5MMC4_9ROSI/70-233   AC A0A5N5MMC4.1
#=GS A0A672Z3F5_9TELE/16-188   AC A0A672Z3F5.1
#=GS A0A1U8DXJ0_ALLSI/26-201   AC A0A1U8DXJ0.1
#=GS A0A674HIQ0_TAEGU/30-203   AC A0A674HIQ0.1
#=GS A0A368UHK4_SOYBN/40-203   AC A0A368UHK4.1
#=GS A0A654GI13_9CEST/42-221   AC A0A654GI13.1
#=GS G1U5B1_RABIT/2-160        AC G1U5B1.2
#=GS A0A5F5XUN5_FELCA/46-110   AC A0A5F5XUN5.1
#=GS H2QQ84_PANTR/38-220       AC H2QQ84.1
#=GS A0A2U4BPN7_TURTR/30-205   AC A0A2U4BPN7.1
#=GS A0A3R7D121_CLOSI/65-236   AC A0A3R7D121.1
#=GS A0A5J5CGN2_9PERO/164-326  AC A0A5J5CGN2.1
#=GS M7BFF1_CHEMY/76-239       AC M7BFF1.1
#=GS A0A484CBS7_PERFV/57-219   AC A0A484CBS7.1
#=GS A0A392MDZ5_9FABA/7-119    AC A0A392MDZ5.1
#=GS A0A3Q1G199_9TELE/35-210   AC A0A3Q1G199.1
#=GS A0A672Z516_9TELE/37-210   AC A0A672Z516.1
#=GS A0A3N0Z8E3_ANAGA/311-489  AC A0A3N0Z8E3.1
#=GS A0A1U7SYQ8_CARSF/30-205   AC A0A1U7SYQ8.1
#=GS A0A314YQ87_PRUYE/27-183   AC A0A314YQ87.1
#=GS C3Y1A9_BRAFL/437-606      AC C3Y1A9.1
#=GS I3IVA9_ORENI/44-206       AC I3IVA9.2
#=GS W5KWD9_ASTMX/32-207       AC W5KWD9.2
#=GS A0A4W5KDX8_9TELE/36-207   AC A0A4W5KDX8.1
#=GS F6ZR48_HORSE/72-247       AC F6ZR48.2
#=GS A0A4X2KWJ3_VOMUR/39-222   AC A0A4X2KWJ3.1
#=GS A0A1D5QFI7_MACMU/59-215   AC A0A1D5QFI7.2
#=GS A0A674GAC0_TAEGU/35-217   AC A0A674GAC0.1
#=GS A0A2U3WNY1_ODORO/27-213   AC A0A2U3WNY1.1
#=GS A0A2U3V4B3_TURTR/38-220   AC A0A2U3V4B3.1
#=GS A0A091HGA7_BUCRH/6-165    AC A0A091HGA7.1
#=GS A0A5F5PPM8_HORSE/38-220   AC A0A5F5PPM8.1
#=GS A0A2K5F404_AOTNA/37-193   AC A0A2K5F404.1
#=GS A0A0D2R9S0_GOSRA/43-205   AC A0A0D2R9S0.1
#=GS A0A663ESH4_AQUCH/67-242   AC A0A663ESH4.1
#=GS A0A093IJZ7_FULGA/31-206   AC A0A093IJZ7.1
#=GS A0A446VF45_TRITD/47-198   AC A0A446VF45.1
#=GS A0A2K5TT37_MACFA/37-193   AC A0A2K5TT37.1
#=GS E4XG97_OIKDI/32-253       AC E4XG97.1
#=GS A0A3B5Q412_XIPMA/39-210   AC A0A3B5Q412.1
#=GS A0A1D5R4Y4_MACMU/3-164    AC A0A1D5R4Y4.2
#=GS A0A2C9VFH6_MANES/11-134   AC A0A2C9VFH6.1
#=GS W5NB87_LEPOC/15-167       AC W5NB87.1
#=GS H9GK27_ANOCA/32-193       AC H9GK27.2
#=GS A0A087XCB2_POEFO/40-210   AC A0A087XCB2.2
#=GS A0A2Y9KV80_ENHLU/31-206   AC A0A2Y9KV80.1
#=GS A0A4W2E4I1_BOBOX/201-256  AC A0A4W2E4I1.1
#=GS K1PIY6_CRAGI/27-189       AC K1PIY6.1
#=GS G3NU04_GASAC/28-209       AC G3NU04.1
#=GS A0A5E4CV46_MARMO/26-201   AC A0A5E4CV46.1
#=GS I3M8E2_ICTTR/38-220       AC I3M8E2.2
#=GS A0A498K8T5_MALDO/26-188   AC A0A498K8T5.1
#=GS A0A3Q2W1W4_HAPBU/28-209   AC A0A3Q2W1W4.1
#=GS A0A6I8RR28_XENTR/26-188   AC A0A6I8RR28.1
#=GS A0A4D9E2K4_9SAUR/40-206   AC A0A4D9E2K4.1
#=GS A0A4X2K2Y3_VOMUR/33-194   AC A0A4X2K2Y3.1
#=GS A0A1L8G6J3_XENLA/51-210   AC A0A1L8G6J3.1
#=GS A0A2K5TT28_MACFA/59-215   AC A0A2K5TT28.1
#=GS A0A0Q3PC11_AMAAE/1-154    AC A0A0Q3PC11.1
#=GS A0A2U3YPX7_LEPWE/30-205   AC A0A2U3YPX7.1
#=GS A0A671VG97_SPAAU/23-198   AC A0A671VG97.1
#=GS A0A2K6PQ81_RHIRO/38-220   AC A0A2K6PQ81.1
#=GS A0A059B747_EUCGR/107-259  AC A0A059B747.1
#=GS W1NXD4_AMBTC/33-196       AC W1NXD4.1
#=GS G1P7A4_MYOLU/33-191       AC G1P7A4.1
#=GS G1T5D7_RABIT/56-231       AC G1T5D7.2
#=GS Q0VCN9_BOVIN/30-205       AC Q0VCN9.1
#=GS C3YX09_BRAFL/253-382      AC C3YX09.1
#=GS A0A670HV81_PODMU/64-226   AC A0A670HV81.1
#=GS A0A094KFU9_ANTCR/30-205   AC A0A094KFU9.1
#=GS F1M928_RAT/26-202         AC F1M928.2
#=GS A0A2K5DCI7_AOTNA/22-181   AC A0A2K5DCI7.1
#=GS H2NEZ7_PONAB/28-204       AC H2NEZ7.1
#=GS A0A671FG48_RHIFE/38-220   AC A0A671FG48.1
#=GS A0A0P7VT40_SCLFO/30-191   AC A0A0P7VT40.1
#=GS A0A673SKJ8_SURSU/38-220   AC A0A673SKJ8.1
#=GS A0A3Q3AI29_KRYMA/26-204   AC A0A3Q3AI29.1
#=GS A0A6G0HZL2_LARCR/38-199   AC A0A6G0HZL2.1
#=GS V4AWK8_LOTGI/5-94         AC V4AWK8.1
#=GS A0A2K5D9I4_AOTNA/3-164    AC A0A2K5D9I4.1
#=GS E4XH70_OIKDI/26-129       AC E4XH70.1
#=GS H0ZR53_TAEGU/26-187       AC H0ZR53.2
#=GS A0A3Q1JZL4_ANATE/35-196   AC A0A3Q1JZL4.1
#=GS A0A672HEJ9_SALFA/34-195   AC A0A672HEJ9.1
#=GS A0A0C2I8J2_THEKT/24-101   AC A0A0C2I8J2.1
#=GS G1NTC5_MYOLU/26-201       AC G1NTC5.1
#=GS A0A2B4SLT0_STYPI/10-111   AC A0A2B4SLT0.1
#=GS A0A2K6FMJ5_PROCO/39-221   AC A0A2K6FMJ5.1
#=GS A0A2K5MD48_CERAT/38-220   AC A0A2K5MD48.1
#=GS G3UM80_LOXAF/4-128        AC G3UM80.1
#=GS A0A1U8CQ94_MESAU/24-199   AC A0A1U8CQ94.1
#=GS A0A2P5W0P9_GOSBA/17-179   AC A0A2P5W0P9.1
#=GS E9FW82_DAPPU/43-215       AC E9FW82.1
#=GS A0A402EUL2_9SAUR/62-224   AC A0A402EUL2.1
#=GS A0A340XNT4_LIPVE/30-205   AC A0A340XNT4.1
#=GS A0A2F0BFV1_ESCRO/1-108    AC A0A2F0BFV1.1
#=GS M5WJ83_PRUPE/27-188       AC M5WJ83.1
#=GS A0A3L8RTB7_CHLGU/28-203   AC A0A3L8RTB7.1
#=GS K7F2U2_PELSI/35-210       AC K7F2U2.1
#=GS A0A674BBE5_SALTR/34-195   AC A0A674BBE5.1
#=GS U3K4J0_FICAL/22-189       AC U3K4J0.1
#=GS A0A1S3SQX4_SALSA/34-195   AC A0A1S3SQX4.1
#=GS G3SMM0_LOXAF/11-186       AC G3SMM0.1
#=GS A0A087V3Y1_BALRE/3-129    AC A0A087V3Y1.1
#=GS A0A3P9PH90_POERE/26-201   AC A0A3P9PH90.1
#=GS C5XWG6_SORBI/45-198       AC C5XWG6.1
#=GS A0A4W4E328_ELEEL/13-71    AC A0A4W4E328.1
#=GS A0A2K5LBK7_CERAT/36-211   AC A0A2K5LBK7.1
#=GS A0A654GJ15_9CEST/37-215   AC A0A654GJ15.1
#=GS A0A671F1W8_RHIFE/31-206   AC A0A671F1W8.1
#=GS A0A443RRG9_9ACAR/58-231   AC A0A443RRG9.1
#=GS A0A1U8IUT8_GOSHI/17-179   AC A0A1U8IUT8.1
#=GS T1J4T1_STRMM/43-216       AC T1J4T1.1
#=GS F6UJL7_CALJA/40-212       AC F6UJL7.3
#=GS F7BP54_MACMU/36-211       AC F7BP54.3
#=GS A0A2U9CLX5_SCOMX/34-196   AC A0A2U9CLX5.1
#=GS A0A2K6BUM3_MACNE/37-193   AC A0A2K6BUM3.1
#=GS M7AN26_CHEMY/4-129        AC M7AN26.1
#=GS K7ESG0_HUMAN/59-185       AC K7ESG0.1
#=GS A0A3Q7U7Q6_VULVU/38-220   AC A0A3Q7U7Q6.1
#=GS A0A5F9DQ18_RABIT/35-210   AC A0A5F9DQ18.1
#=GS A0A556VW12_BAGYA/99-144   AC A0A556VW12.1
#=GS A0A0D9QVX7_CHLSB/30-205   AC A0A0D9QVX7.1
#=GS U3JSL4_FICAL/25-156       AC U3JSL4.1
#=GS A0A1D2NCW9_ORCCI/33-207   AC A0A1D2NCW9.1
#=GS A0A2J8RY52_PONAB/27-183   AC A0A2J8RY52.1
#=GS A0A5J5B2C6_9ASTE/39-189   AC A0A5J5B2C6.1
#=GS A0A218UKV1_9PASE/45-220   AC A0A218UKV1.1
#=GS H2Q164_PANTR/44-206       AC H2Q164.1
#=GS E9PXB5_MOUSE/34-103       AC E9PXB5.8
#=GS C5L2Q1_PERM5/40-188       AC C5L2Q1.1
#=GS A0A4W2E2A4_BOBOX/26-201   AC A0A4W2E2A4.1
#=GS A0A667XMM0_9TELE/34-195   AC A0A667XMM0.1
#=GS A0A6G1ACW8_CROCR/1-99     AC A0A6G1ACW8.1
#=GS G3QFT6_GORGO/44-206       AC G3QFT6.2
#=GS G3U4R3_LOXAF/45-206       AC G3U4R3.1
#=GS A0A087RHL9_APTFO/21-188   AC A0A087RHL9.1
#=GS A0A2K5Y8J7_MANLE/32-202   AC A0A2K5Y8J7.1
#=GS H2Y7U9_CIOSA/24-200       AC H2Y7U9.1
#=GS A0A674BB98_SALTR/35-196   AC A0A674BB98.1
#=GS B3RPR5_TRIAD/37-169       AC B3RPR5.1
#=GS A0A022RAA7_ERYGU/30-193   AC A0A022RAA7.1
#=GS A0A3Q0E9K2_CARSF/1-120    AC A0A3Q0E9K2.1
#=GS A0A2B4SW98_STYPI/68-255   AC A0A2B4SW98.1
#=GS F7AWH6_CIOIN/27-202       AC F7AWH6.2
#=GS F7F2B5_MACMU/77-233       AC F7F2B5.3
#=GS A0A091DMG9_FUKDA/34-209   AC A0A091DMG9.1
#=GS H0ZTN3_TAEGU/45-220       AC H0ZTN3.2
#=GS A0A091EID6_CORBR/1-107    AC A0A091EID6.1
#=GS F7D0L5_HORSE/27-200       AC F7D0L5.2
#=GS U3EWX7_CALJA/37-193       AC U3EWX7.1
#=GS A0A493TRT2_ANAPP/96-213   AC A0A493TRT2.1
#=GS Q8BY83_MOUSE/26-162       AC Q8BY83.1
#=GS A0A087QV99_APTFO/3-165    AC A0A087QV99.1
#=GS A0A093PR50_9PASS/21-196   AC A0A093PR50.1
#=GS A0A0G4IP33_PLABS/18-159   AC A0A0G4IP33.1
#=GS A0A074ZFF7_9TREM/40-209   AC A0A074ZFF7.1
#=GS A0A4W2C680_BOBOX/16-173   AC A0A4W2C680.1
#=GS H0WKX3_OTOGA/30-205       AC H0WKX3.1
#=GS A0A565AY75_9BRAS/40-200   AC A0A565AY75.1
#=GS M3X2M1_FELCA/27-188       AC M3X2M1.3
#=GS A0A3P8WSY5_CYNSE/23-198   AC A0A3P8WSY5.1
#=GS A0A4W5Q6H5_9TELE/23-168   AC A0A4W5Q6H5.1
#=GS A0A091LTK2_CARIC/3-165    AC A0A091LTK2.1
#=GS A0A671E9F7_RHIFE/31-192   AC A0A671E9F7.1
#=GS A0A3P8X963_ESOLU/34-195   AC A0A3P8X963.2
#=GS A0A3P9NQM6_POERE/68-230   AC A0A3P9NQM6.1
#=GS A0A2K5QP32_CEBCA/38-220   AC A0A2K5QP32.1
#=GS A0A3B1IPY3_ASTMX/14-189   AC A0A3B1IPY3.1
#=GS A0A125YTP5_TOXGV/134-324  AC A0A125YTP5.1
#=GS A0A4D9E3P2_9SAUR/24-191   AC A0A4D9E3P2.1
#=GS A0A0E0K1U4_ORYPU/51-203   AC A0A0E0K1U4.1
#=GS A0A384DSE0_URSMA/27-177   AC A0A384DSE0.1
#=GS A0A2K6FVT6_PROCO/26-201   AC A0A2K6FVT6.1
#=GS A0A452CAM7_BALAS/30-203   AC A0A452CAM7.1
#=GS A0A3Q7XHC1_URSAR/31-206   AC A0A3Q7XHC1.1
#=GS JUNO_MOUSE/26-202         AC Q9EQF4.1
#=GS JUNO_MOUSE/26-202         DR PDB; 5JYJ A; 26-202;
#=GS JUNO_MOUSE/26-202         DR PDB; 5EJN B; 26-202;
#=GS JUNO_MOUSE/26-202         DR PDB; 5EJN A; 26-202;
#=GS A0A5F8GHM3_MONDO/53-229   AC A0A5F8GHM3.1
#=GS W5P2F1_SHEEP/30-207       AC W5P2F1.1
#=GS A0A2Y9T9A0_PHYMC/33-194   AC A0A2Y9T9A0.1
#=GS G3WJX2_SARHA/110-235      AC G3WJX2.1
#=GS A0A3Q7W815_URSAR/27-213   AC A0A3Q7W815.1
#=GS A0A3P4P3Q8_GULGU/31-206   AC A0A3P4P3Q8.1
#=GS F1RS40_PIG/38-220         AC F1RS40.4
#=GS H9GUQ6_ANOCA/9-102        AC H9GUQ6.2
#=GS W5MF72_LEPOC/23-189       AC W5MF72.1
#=GS F5GXV3_HUMAN/30-167       AC F5GXV3.1
#=GS Q69GM1_XENLA/38-218       AC Q69GM1.1
#=GS A0A1U8DMF6_ALLSI/9-109    AC A0A1U8DMF6.1
#=GS A0A0D3CMJ5_BRAOL/39-190   AC A0A0D3CMJ5.1
#=GS A0A0D3AFH2_BRAOL/43-207   AC A0A0D3AFH2.1
#=GS A0A212DIP5_CEREH/111-156  AC A0A212DIP5.1
#=GS A0A401S518_CHIPU/23-189   AC A0A401S518.1
#=GS A0A1A6FTX1_NEOLE/29-204   AC A0A1A6FTX1.1
#=GS G3HCX1_CRIGR/27-199       AC G3HCX1.1
#=GS A0A3M6UV93_9CNID/50-223   AC A0A3M6UV93.1
#=GS A0A091QQF2_HALAL/1-98     AC A0A091QQF2.1
#=GS S7NL61_MYOBR/26-201       AC S7NL61.1
#=GS A0A437C2F9_ORYJA/58-220   AC A0A437C2F9.1
#=GS W5KD05_ASTMX/27-199       AC W5KD05.2
#=GS K7F2U9_PELSI/27-202       AC K7F2U9.1
#=GS A0A1S3A0V0_ERIEU/31-207   AC A0A1S3A0V0.1
#=GS M4FEA4_BRARP/39-188       AC M4FEA4.1
#=GS A0A094LC38_PODCR/31-206   AC A0A094LC38.1
#=GS A0A673BCP5_9TELE/30-211   AC A0A673BCP5.1
#=GS H2NM84_PONAB/22-183       AC H2NM84.1
#=GS A0A665WE74_ECHNA/36-197   AC A0A665WE74.1
#=GS A0A1U8ACQ3_NELNU/44-200   AC A0A1U8ACQ3.1
#=GS A0A2K6R535_RHIRO/47-206   AC A0A2K6R535.1
#=GS A0A671WUM8_SPAAU/44-206   AC A0A671WUM8.1
#=GS A0A0L8HUS0_OCTBM/23-187   AC A0A0L8HUS0.1
#=GS E4WUE2_OIKDI/17-186       AC E4WUE2.1
#=GS A0A5J5N4V4_MUNRE/27-208   AC A0A5J5N4V4.1
#=GS A0A5F9D225_RABIT/35-210   AC A0A5F9D225.1
#=GS A0A078A8F8_STYLE/36-193   AC A0A078A8F8.1
#=GS A0A340XRU3_LIPVE/38-220   AC A0A340XRU3.1
#=GS F1STK4_PIG/26-201         AC F1STK4.4
#=GS W4H1E2_9STRA/9-169        AC W4H1E2.1
#=GS F7BPH5_CIOIN/32-206       AC F7BPH5.2
#=GS A0A091Q9F4_MERNU/3-129    AC A0A091Q9F4.1
#=GS A0A4W2F2D4_BOBOX/97-163   AC A0A4W2F2D4.1
#=GS A0A2Y9LC22_ENHLU/27-187   AC A0A2Y9LC22.1
#=GS A0A2R9B8B1_PANPA/3-164    AC A0A2R9B8B1.1
#=GS A0A3P8TBQ6_AMPPE/37-209   AC A0A3P8TBQ6.1
#=GS A0A3Q1AU19_AMPOC/35-196   AC A0A3Q1AU19.1
#=GS A0A3Q1M192_BOVIN/30-205   AC A0A3Q1M192.1
#=GS A0A3Q3RZ90_9TELE/28-209   AC A0A3Q3RZ90.1
#=GS H0WGV9_OTOGA/36-211       AC H0WGV9.1
#=GS A0A1V4JW39_PATFA/1-154    AC A0A1V4JW39.1
#=GS A0A3Q1M4M1_BOVIN/26-208   AC A0A3Q1M4M1.1
#=GS A0A093GV59_STRCA/3-165    AC A0A093GV59.1
#=GS A0A2K6RR39_RHIRO/47-110   AC A0A2K6RR39.1
#=GS A0A091LJK1_CATAU/3-129    AC A0A091LJK1.1
#=GS A0A5F9CRB4_RABIT/38-220   AC A0A5F9CRB4.1
#=GS A0A673B7A9_9TELE/28-203   AC A0A673B7A9.1
#=GS A0A444UEV1_ACIRT/63-225   AC A0A444UEV1.1
#=GS A0A2K6A9I0_MANLE/4-146    AC A0A2K6A9I0.1
#=GS A0A1U7SET6_ALLSI/5-167    AC A0A1U7SET6.2
#=GS A0A3Q2H4A7_HORSE/36-211   AC A0A3Q2H4A7.1
#=GS A0A2Y9F958_PHYMC/38-220   AC A0A2Y9F958.1
#=GS A0A5F4CYM6_CANLF/31-206   AC A0A5F4CYM6.1
#=GS A0A2Y9HW32_NEOSC/44-206   AC A0A2Y9HW32.1
#=GS A0A2F0B285_ESCRO/44-203   AC A0A2F0B285.1
#=GS A0A452STK5_URSAM/20-194   AC A0A452STK5.1
#=GS A0A1U7T349_CARSF/38-220   AC A0A1U7T349.1
#=GS K7FXM9_PELSI/22-189       AC K7FXM9.1
#=GS A0A068Y5C3_ECHMU/36-215   AC A0A068Y5C3.1
#=GS G1NQU6_MELGA/30-211       AC G1NQU6.2
#=GS A0A151NL04_ALLMI/35-221   AC A0A151NL04.1
#=GS A0A2K6KH33_RHIBE/22-183   AC A0A2K6KH33.1
#=GS H2ZLB1_CIOSA/30-139       AC H2ZLB1.1
#=GS A0A2I3RAM3_PANTR/3-164    AC A0A2I3RAM3.1
#=GS A0A6G0WZV7_9STRA/17-168   AC A0A6G0WZV7.1
#=GS A0A1S3JE41_LINUN/10-111   AC A0A1S3JE41.1
#=GS A0A6J3R8G1_TURTR/27-177   AC A0A6J3R8G1.1
#=GS A0A6A1Q9Z3_BALPH/19-134   AC A0A6A1Q9Z3.1
#=GS A0A0C2JGK5_THEKT/25-189   AC A0A0C2JGK5.1
#=GS A0A452F775_CAPHI/27-177   AC A0A452F775.1
#=GS A0A250XD00_9CHLO/29-204   AC A0A250XD00.1
#=GS A0A2Y9IFY1_NEOSC/31-206   AC A0A2Y9IFY1.1
#=GS A0A485PAY6_LYNPA/27-159   AC A0A485PAY6.1
#=GS F7C8X8_HORSE/36-211       AC F7C8X8.2
#=GS U3IR18_ANAPP/35-217       AC U3IR18.2
#=GS A0A2Y9EKS1_PHYMC/54-204   AC A0A2Y9EKS1.1
#=GS A0A3Q1NCZ3_BOVIN/84-202   AC A0A3Q1NCZ3.1
#=GS A0A665UJL7_ECHNA/38-210   AC A0A665UJL7.1
#=GS A0A2K6AU51_MACNE/36-211   AC A0A2K6AU51.1
#=GS A0A672UZV8_STRHB/28-203   AC A0A672UZV8.1
#=GS A0A2I3GPA3_NOMLE/47-113   AC A0A2I3GPA3.1
#=GS A0A091F5K7_CORBR/21-188   AC A0A091F5K7.1
#=GS A0A2K5Q8K8_CEBCA/37-193   AC A0A2K5Q8K8.1
#=GS A0A2U1MUM5_ARTAN/54-202   AC A0A2U1MUM5.1
#=GS A0A493T565_ANAPP/35-217   AC A0A493T565.1
#=GS M7BZS7_CHEMY/26-201       AC M7BZS7.1
#=GS A0A096NJQ0_PAPAN/20-181   AC A0A096NJQ0.2
#=GS A0A3P4M4I9_GULGU/27-164   AC A0A3P4M4I9.1
#=GS L5K4Y9_PTEAL/31-165       AC L5K4Y9.1
#=GS A0A4U1FIT9_MONMO/26-201   AC A0A4U1FIT9.1
#=GS A0A485MES2_LYNPA/31-206   AC A0A485MES2.1
#=GS A0A6G1B006_CROCR/33-208   AC A0A6G1B006.1
#=GS A0A1L8HLT8_XENLA/38-218   AC A0A1L8HLT8.1
#=GS A0A2G2XX60_CAPAN/38-189   AC A0A2G2XX60.1
#=GS A0A4U1FLC1_MONMO/31-192   AC A0A4U1FLC1.1
#=GS A0A2K6BLU8_MACNE/56-238   AC A0A2K6BLU8.1
#=GS A0A3Q7XHD9_URSAR/1-120    AC A0A3Q7XHD9.1
#=GS A0A2I2U806_FELCA/26-201   AC A0A2I2U806.2
#=GS A0A6Q2YSL3_ESOLU/34-195   AC A0A6Q2YSL3.1
#=GS A0A444UJL7_ACIRT/29-190   AC A0A444UJL7.1
#=GS H0XSY6_OTOGA/30-205       AC H0XSY6.1
#=GS A0A3Q2VNP5_HAPBU/23-175   AC A0A3Q2VNP5.1
#=GS A0A2Y9ID55_NEOSC/36-211   AC A0A2Y9ID55.1
#=GS F6WFD9_CIOIN/35-207       AC F6WFD9.1
#=GS D7U9Y5_VITVI/37-188       AC D7U9Y5.1
#=GS A0A383WEW0_TETOB/10-182   AC A0A383WEW0.1
#=GS A0A2K5Y2E9_MANLE/37-193   AC A0A2K5Y2E9.1
#=GS M3W6W1_FELCA/36-211       AC M3W6W1.3
#=GS A0A5N3X8E8_MUNRE/31-192   AC A0A5N3X8E8.1
#=GS A0A1W0A3G6_9STRA/3-151    AC A0A1W0A3G6.1
#=GS A0A2B4SL49_STYPI/31-197   AC A0A2B4SL49.1
#=GS C3Y1A9_BRAFL/1018-1187    AC C3Y1A9.1
#=GS A0A6I8QVG0_XENTR/19-181   AC A0A6I8QVG0.1
#=GS A0A2K5VIZ1_MACFA/34-204   AC A0A2K5VIZ1.1
#=GS A0A643CFX6_BALPH/30-205   AC A0A643CFX6.1
#=GS A0A6I8PEH6_ORNAN/27-202   AC A0A6I8PEH6.1
#=GS A0A091HRR1_CALAN/31-206   AC A0A091HRR1.1
#=GS A0A3Q7ST53_VULVU/31-206   AC A0A3Q7ST53.1
#=GS W5PV41_SHEEP/44-193       AC W5PV41.1
#=GS A0A665U4E2_ECHNA/17-192   AC A0A665U4E2.1
#=GS A0A452J254_9SAUR/5-158    AC A0A452J254.1
#=GS A0A2K6M560_RHIBE/36-211   AC A0A2K6M560.1
#=GS G3H9G2_CRIGR/35-217       AC G3H9G2.1
#=GS A0A3M6UQR0_9CNID/23-165   AC A0A3M6UQR0.1
#=GS G5C7E9_HETGA/38-220       AC G5C7E9.1
#=GS A0A5A7PJ56_STRAF/40-188   AC A0A5A7PJ56.1
#=GS A0A2K5U044_MACFA/47-110   AC A0A2K5U044.1
#=GS A0A337S480_FELCA/38-220   AC A0A337S480.2
#=GS A7RFR7_NEMVE/32-212       AC A7RFR7.1
#=GS A0A0A0LIV4_CUCSA/61-218   AC A0A0A0LIV4.1
#=GS A0A2K6AU68_MACNE/42-105   AC A0A2K6AU68.1
#=GS A0A091RJ07_9GRUI/21-188   AC A0A091RJ07.1
#=GS A0A1U7U5A7_CARSF/1-120    AC A0A1U7U5A7.2
#=GS A0A671EZ04_RHIFE/3-164    AC A0A671EZ04.1
#=GS A0A2K6FL00_PROCO/44-200   AC A0A2K6FL00.1
#=GS A0A4D8YN41_SALSN/47-195   AC A0A4D8YN41.1
#=GS A0A3P8SEP0_AMPPE/35-196   AC A0A3P8SEP0.1
#=GS A0A0R0EQG0_SOYBN/26-187   AC A0A0R0EQG0.1
#=GS A0A6I8NRH3_ORNAN/22-189   AC A0A6I8NRH3.1
#=GS A0A2R8ZNL9_PANPA/59-197   AC A0A2R8ZNL9.1
#=GS L8GFZ8_ACACA/30-205       AC L8GFZ8.1
#=GS A0A392N8U3_9FABA/1-121    AC A0A392N8U3.1
#=GS A0A2Y9GB37_NEOSC/38-220   AC A0A2Y9GB37.1
#=GS A0A445D0E6_ARAHY/64-227   AC A0A445D0E6.1
#=GS FOLR3_HUMAN/36-211        AC P41439.2
#=GS G3WEP7_SARHA/38-221       AC G3WEP7.1
#=GS A0A0J8CL77_BETVU/39-188   AC A0A0J8CL77.1
#=GS A0A5G2R9U0_PIG/28-189     AC A0A5G2R9U0.1
#=GS A0A091SR61_PELCR/3-129    AC A0A091SR61.1
#=GS M3WR11_FELCA/79-254       AC M3WR11.2
#=GS A0A5D2U2D7_GOSMU/43-194   AC A0A5D2U2D7.1
#=GS A0A2K5HJX9_COLAP/3-164    AC A0A2K5HJX9.1
#=GS A0A6A4KDL5_APOLU/9-171    AC A0A6A4KDL5.1
#=GS A0A2R2MMB2_LINUN/30-196   AC A0A2R2MMB2.1
#=GS A0A673UEP0_SURSU/50-186   AC A0A673UEP0.1
#=GS A0A1S4E7H0_DIACI/30-203   AC A0A1S4E7H0.1
#=GS F7CGN2_XENTR/68-243       AC F7CGN2.3
#=GS A0A5A7U399_CUCME/8-165    AC A0A5A7U399.1
#=GS A0A091VTR1_NIPNI/3-165    AC A0A091VTR1.1
#=GS A0A493TNU4_ANAPP/26-142   AC A0A493TNU4.1
#=GS A0A663DRU7_AQUCH/29-190   AC A0A663DRU7.1
#=GS A0A4S2LXB9_OPIFE/95-265   AC A0A4S2LXB9.1
#=GS A0A287BLX2_PIG/123-298    AC A0A287BLX2.1
#=GS A0A2Y9EA12_TRIMA/27-167   AC A0A2Y9EA12.1
#=GS A0A3N7FTV4_POPTR/97-260   AC A0A3N7FTV4.1
#=GS E9PXB4_MOUSE/3-172        AC E9PXB4.1
#=GS A0A3P9PHL6_POERE/26-201   AC A0A3P9PHL6.1
#=GS A0A1S4CM70_TOBAC/41-192   AC A0A1S4CM70.1
#=GS A0A0E0K1U5_ORYPU/51-203   AC A0A0E0K1U5.1
#=GS A0A096N631_PAPAN/38-220   AC A0A096N631.2
#=GS A0A504YI37_FASGI/1-136    AC A0A504YI37.1
#=GS A0A067EYB3_CITSI/29-191   AC A0A067EYB3.1
#=GS A0A5F8GQW3_MONDO/29-205   AC A0A5F8GQW3.1
#=GS A0A2K5JC57_COLAP/26-208   AC A0A2K5JC57.1
#=GS F1N9X0_CHICK/32-207       AC F1N9X0.1
#=GS S4RV82_PETMA/14-175       AC S4RV82.1
#=GS A0A667YFE1_9TELE/20-182   AC A0A667YFE1.1
#=GS A0A341AA89_NEOAA/34-134   AC A0A341AA89.1
#=GS C3Y0S5_BRAFL/9-176        AC C3Y0S5.1
#=GS A0A662YLC5_9STRA/28-163   AC A0A662YLC5.1
#=GS A0A671G8K6_RHIFE/27-186   AC A0A671G8K6.1
#=GS A0A3Q1M7F5_BOVIN/1-167    AC A0A3Q1M7F5.1
#=GS A0A267FFW1_9PLAT/45-230   AC A0A267FFW1.1
#=GS A0A0R3VYB7_TAEAS/36-176   AC A0A0R3VYB7.1
#=GS A0A093C9R5_9AVES/3-165    AC A0A093C9R5.1
#=GS A0A2R5G9A8_9STRA/95-248   AC A0A2R5G9A8.1
#=GS A0A0E0DQT1_9ORYZ/69-169   AC A0A0E0DQT1.1
#=GS A0A484GSX4_SOUCH/169-344  AC A0A484GSX4.1
#=GS D3ZWD2_RAT/27-208         AC D3ZWD2.1
#=GS C3Z5S2_BRAFL/245-319      AC C3Z5S2.1
#=GS A0A2K5U025_MACFA/36-211   AC A0A2K5U025.1
#=GS A0A673BKX6_9TELE/28-209   AC A0A673BKX6.1
#=GS A0A328E3Y7_9ASTE/36-187   AC A0A328E3Y7.1
#=GS A0A1I8HSL7_9PLAT/30-182   AC A0A1I8HSL7.1
#=GS A0A2K6BUN2_MACNE/59-198   AC A0A2K6BUN2.1
#=GS A0A2K5MD83_CERAT/38-220   AC A0A2K5MD83.1
#=GS A0A2Y9NAF4_DELLE/31-192   AC A0A2Y9NAF4.1
#=GS A0A5N5P693_PANHP/30-191   AC A0A5N5P693.1
#=GS A0A2I3GFZ2_NOMLE/22-183   AC A0A2I3GFZ2.1
#=GS A0A5A9NR22_9TELE/48-212   AC A0A5A9NR22.1
#=GS A0A3Q1AZX0_AMPOC/26-207   AC A0A3Q1AZX0.1
#=GS A0A5F8GLA1_MONDO/29-205   AC A0A5F8GLA1.1
#=GS A0A091MV43_9PASS/1-139    AC A0A091MV43.1
#=GS A0A5D6Y0E7_9STRA/31-182   AC A0A5D6Y0E7.1
#=GS A0A3Q2X1N8_HAPBU/46-208   AC A0A3Q2X1N8.1
#=GS T1HFT3_RHOPR/43-223       AC T1HFT3.1
#=GS A0A0M0K6C0_9EUKA/52-218   AC A0A0M0K6C0.1
#=GS A0A2K5J707_COLAP/36-211   AC A0A2K5J707.1
#=GS I7MLY4_TETTS/44-200       AC I7MLY4.2
#=GS D4A700_RAT/43-205         AC D4A700.1
#=GS A0A369RYD5_9METZ/32-204   AC A0A369RYD5.1
#=GS A0A1E5WI79_9POAL/16-169   AC A0A1E5WI79.1
#=GS M7B581_CHEMY/175-231      AC M7B581.1
#=GS A0A6I8RL10_XENTR/5-139    AC A0A6I8RL10.1
#=GS A0A226P2F6_COLVI/61-236   AC A0A226P2F6.1
#=GS A0A4W2CG31_BOBOX/30-205   AC A0A4W2CG31.1
#=GS A0A151PFV0_ALLMI/250-413  AC A0A151PFV0.1
#=GS A0A433SXA2_ELYCH/50-186   AC A0A433SXA2.1
#=GS A0A1L8GMA4_XENLA/21-187   AC A0A1L8GMA4.1
#=GS A0A2K6V1S4_SAIBB/2-158    AC A0A2K6V1S4.1
#=GS A0A5E4AP06_MARMO/30-191   AC A0A5E4AP06.1
#=GS A0A091M6T4_CARIC/31-206   AC A0A091M6T4.1
#=GS E4WTN8_OIKDI/39-242       AC E4WTN8.1
#=GS A0A2I3G994_NOMLE/47-159   AC A0A2I3G994.1
#=GS A0A444SGI4_ARMVU/28-213   AC A0A444SGI4.1
#=GS A0A2I4B6U9_9TELE/23-198   AC A0A2I4B6U9.1
#=GS A0A2I0MGT7_COLLI/32-165   AC A0A2I0MGT7.1
#=GS A0A093P1V9_PYGAD/34-216   AC A0A093P1V9.1
#=GS A0A0C2MP69_THEKT/16-194   AC A0A0C2MP69.1
#=GS A0A1Z5K2Q1_FISSO/84-223   AC A0A1Z5K2Q1.1
#=GS F6TAH8_HORSE/47-209       AC F6TAH8.2
#=GS A0A4S4CYA7_CAMSI/146-297  AC A0A4S4CYA7.1
#=GS A0A5A9NA98_9TELE/27-196   AC A0A5A9NA98.1
#=GS A0A4U5VGQ2_COLLU/38-199   AC A0A4U5VGQ2.1
#=GS A0A093ICM0_DRYPU/34-213   AC A0A093ICM0.1
#=GS A0A087WYI3_HUMAN/36-178   AC A0A087WYI3.1
#=GS A0A3Q1HYP2_ANATE/38-208   AC A0A3Q1HYP2.1
#=GS A0A401PDQ3_SCYTO/118-173  AC A0A401PDQ3.1
#=GS T1F9I2_HELRO/85-230       AC T1F9I2.1
#=GS A0A673WG94_SALTR/29-207   AC A0A673WG94.1
#=GS L9JAA1_TUPCH/41-180       AC L9JAA1.1
#=GS A0A078G1F5_BRANA/41-174   AC A0A078G1F5.1
#=GS A0A4W4FYV8_ELEEL/26-188   AC A0A4W4FYV8.1
#=GS A0A287DAZ0_ICTTR/26-163   AC A0A287DAZ0.1
#=GS A0A0C2MMB1_THEKT/25-202   AC A0A0C2MMB1.1
#=GS A0A402FJS7_9SAUR/51-226   AC A0A402FJS7.1
#=GS G3GRC1_CRIGR/155-317      AC G3GRC1.1
#=GS A0A226NM25_CALSU/21-80    AC A0A226NM25.1
#=GS A0A094KZT5_PODCR/6-165    AC A0A094KZT5.1
#=GS A0A2R6Q6Z9_ACTCC/41-189   AC A0A2R6Q6Z9.1
#=GS A0A0W8DQ05_PHYNI/33-184   AC A0A0W8DQ05.1
#=GS A0A2I3GJ26_NOMLE/36-182   AC A0A2I3GJ26.1
#=GS A0A663EJZ9_AQUCH/21-188   AC A0A663EJZ9.1
#=GS A0A5E4EAZ1_PRUDU/27-188   AC A0A5E4EAZ1.1
#=GS A0A553NMB8_9TELE/105-266  AC A0A553NMB8.1
#=GS A0A674F4Z3_SALTR/34-195   AC A0A674F4Z3.1
#=GS A0A3Q7UL67_VULVU/38-220   AC A0A3Q7UL67.1
#=GS A0A433T103_ELYCH/56-152   AC A0A433T103.1
#=GS A0A0D9QVZ8_CHLSB/36-211   AC A0A0D9QVZ8.1
#=GS A0A091MM92_9PASS/3-129    AC A0A091MM92.1
#=GS A0A2Y9DWW6_TRIMA/35-210   AC A0A2Y9DWW6.1
#=GS A0A2G9IAB8_9LAMI/30-190   AC A0A2G9IAB8.1
#=GS H2Y7Z2_CIOSA/28-200       AC H2Y7Z2.1
#=GS A0A4U5VGG8_COLLU/57-219   AC A0A4U5VGG8.1
#=GS K7F9U1_PELSI/34-216       AC K7F9U1.1
#=GS A0A484CFE8_PERFV/28-214   AC A0A484CFE8.1
#=GS A0A452R4D9_URSAM/2-160    AC A0A452R4D9.1
#=GS A0A1S3JEC0_LINUN/32-206   AC A0A1S3JEC0.1
#=GS A0A3Q1IZL8_ANATE/4-165    AC A0A3Q1IZL8.1
#=GS A0A673TB19_SURSU/38-200   AC A0A673TB19.1
#=GS A0A3B1ILS7_ASTMX/7-179    AC A0A3B1ILS7.1
#=GS A0A2K5NV62_CERAT/59-198   AC A0A2K5NV62.1
#=GS M3XXW1_MUSPF/44-206       AC M3XXW1.1
#=GS A0A452DRC1_CAPHI/39-221   AC A0A452DRC1.1
#=GS A0A2Y9KGJ5_ENHLU/38-220   AC A0A2Y9KGJ5.1
#=GS A0A4W5NXQ7_9TELE/33-194   AC A0A4W5NXQ7.1
#=GS A0A3Q0GJ09_ALLSI/26-189   AC A0A3Q0GJ09.1
#=GS A0A2K5XL08_MANLE/3-164    AC A0A2K5XL08.1
#=GS C0PIQ9_MAIZE/45-197       AC C0PIQ9.1
#=GS C3XUF6_BRAFL/6-176        AC C3XUF6.1
#=GS I3JBR0_ORENI/37-208       AC I3JBR0.1
#=GS A0A3P8Y484_ESOLU/29-207   AC A0A3P8Y484.1
#=GS G3VZT1_SARHA/24-186       AC G3VZT1.1
#=GS M3WCE9_FELCA/27-177       AC M3WCE9.4
#=GS A0A4S8J3I9_MUSBA/44-195   AC A0A4S8J3I9.1
#=GS P79388_PIG/30-205         AC P79388.1
#=GS A0A485MHM4_LYNPA/48-223   AC A0A485MHM4.1
#=GS A0A166I3N8_DAUCS/42-190   AC A0A166I3N8.1
#=GS A0A1Z5KKE7_FISSO/84-234   AC A0A1Z5KKE7.1
#=GS A0A672Z5J9_9TELE/37-210   AC A0A672Z5J9.1
#=GS A0A674BA40_SALTR/17-178   AC A0A674BA40.1
#=GS F6VRR1_CALJA/3-164        AC F6VRR1.2
#=GS A0A6A5DXL6_PERFL/36-198   AC A0A6A5DXL6.1
#=GS A0A091FGB2_9AVES/29-204   AC A0A091FGB2.1
#=GS A0A2U3WRC2_ODORO/38-220   AC A0A2U3WRC2.1
#=GS A0A2Y9MH67_DELLE/34-209   AC A0A2Y9MH67.1
#=GS A0A4W4HCU6_ELEEL/57-220   AC A0A4W4HCU6.1
#=GS C1EEA4_MICCC/25-217       AC C1EEA4.1
#=GS U6N218_9EIME/24-185       AC U6N218.1
#=GS L5LPC5_MYODS/26-201       AC L5LPC5.1
#=GS A0A484GSX4_SOUCH/34-143   AC A0A484GSX4.1
#=GS F1MI35_BOVIN/31-192       AC F1MI35.2
#=GS A0A5F8G8G3_MONDO/39-222   AC A0A5F8G8G3.1
#=GS A0A2R5G9L0_9STRA/50-184   AC A0A2R5G9L0.1
#=GS D3YZI1_MOUSE/26-143       AC D3YZI1.1
#=GS A0A665TXP7_ECHNA/28-209   AC A0A665TXP7.1
#=GS A0A452STC7_URSAM/31-206   AC A0A452STC7.1
#=GS A0A218VFA8_9PASE/21-188   AC A0A218VFA8.1
#=GS A0A2K6LAI1_RHIBE/38-220   AC A0A2K6LAI1.1
#=GS A0A1B0GSV4_MOUSE/29-177   AC A0A1B0GSV4.1
#=GS A0A091CNP1_FUKDA/38-220   AC A0A091CNP1.1
#=GS M7AZZ7_CHEMY/7-169        AC M7AZZ7.1
#=GS A0A672YCX8_9TELE/32-193   AC A0A672YCX8.1
#=GS A0A4W3I551_CALMI/57-223   AC A0A4W3I551.1
#=GS E2QXC4_CANLF/31-206       AC E2QXC4.2
#=GS A0A673BA80_9TELE/30-205   AC A0A673BA80.1
#=GS G3V8M6_RAT/34-209         AC G3V8M6.1
#=GS A0A2K6BUN5_MACNE/27-183   AC A0A2K6BUN5.1
#=GS U3IEN3_ANAPP/21-188       AC U3IEN3.2
#=GS A0A093IHJ4_FULGA/3-129    AC A0A093IHJ4.1
#=GS C3Y1A9_BRAFL/1229-1397    AC C3Y1A9.1
#=GS G1LZN7_AILME/31-206       AC G1LZN7.1
#=GS A0A452DRC4_CAPHI/39-221   AC A0A452DRC4.1
#=GS A0A3M0KHC3_HIRRU/30-205   AC A0A3M0KHC3.1
#=GS A0A4U1ES09_MONMO/123-210  AC A0A4U1ES09.1
#=GS A0A4W2EDW7_BOBOX/44-206   AC A0A4W2EDW7.1
#=GS A0A455C822_PHYMC/44-219   AC A0A455C822.1
#=GS A0A2K6UFM4_SAIBB/38-220   AC A0A2K6UFM4.1
#=GS A0A5E4BQJ4_MARMO/29-204   AC A0A5E4BQJ4.1
#=GS A0A452QBA6_URSAM/27-202   AC A0A452QBA6.1
#=GS A0A091KUQ7_9GRUI/3-160    AC A0A091KUQ7.1
#=GS A0A452HYW3_9SAUR/63-225   AC A0A452HYW3.1
#=GS W4YAJ7_STRPU/312-484      AC W4YAJ7.1
#=GS C3YZN7_BRAFL/18-189       AC C3YZN7.1
#=GS A0A287D157_ICTTR/26-201   AC A0A287D157.1
#=GS I3MG93_ICTTR/34-209       AC I3MG93.1
#=GS F5GZ45_HUMAN/41-180       AC F5GZ45.8
#=GS A0A673UCW9_SURSU/28-109   AC A0A673UCW9.1
#=GS G3NYD9_GASAC/25-200       AC G3NYD9.1
#=GS K7EN64_HUMAN/27-130       AC K7EN64.1
#=GS R0JTG2_ANAPL/1-98         AC R0JTG2.1
#=GS A0A2G5DM75_AQUCA/36-190   AC A0A2G5DM75.1
#=GS A0A2K6M558_RHIBE/36-211   AC A0A2K6M558.1
#=GS A0A5N3XAW0_MUNRE/38-220   AC A0A5N3XAW0.1
#=GS C1EAB4_MICCC/27-183       AC C1EAB4.1
#=GS G3Q9P9_GASAC/34-195       AC G3Q9P9.1
#=GS K7G8A6_PELSI/63-225       AC K7G8A6.1
#=GS A0A3Q4GF04_NEOBR/57-219   AC A0A3Q4GF04.1
#=GS A0A267EHC0_9PLAT/23-164   AC A0A267EHC0.1
#=GS A0A2K6ALM9_MACNE/47-206   AC A0A2K6ALM9.1
#=GS K7F9T5_PELSI/35-217       AC K7F9T5.1
#=GS A0A3B1J8J3_ASTMX/36-197   AC A0A3B1J8J3.1
#=GS A0A672V872_STRHB/43-205   AC A0A672V872.1
#=GS A0A3P9CAW3_9CICH/36-208   AC A0A3P9CAW3.1
#=GS A0A485KW75_9STRA/21-173   AC A0A485KW75.1
#=GS A0A6I8QCV6_XENTR/20-182   AC A0A6I8QCV6.1
#=GS F5H5L8_HUMAN/76-148       AC F5H5L8.1
#=GS A0A673ULW5_SURSU/31-206   AC A0A673ULW5.1
#=GS A0A3M7R1L6_BRAPC/55-197   AC A0A3M7R1L6.1
#=GS A0A4E0S105_FASHE/77-247   AC A0A4E0S105.1
#=GS A0A3Q4GHF8_NEOBR/11-184   AC A0A3Q4GHF8.1
#=GS A0A0E0CMR2_9ORYZ/49-201   AC A0A0E0CMR2.1
#=GS A0A452GGX8_9SAUR/41-195   AC A0A452GGX8.1
#=GS A0A0L8HL22_OCTBM/38-170   AC A0A0L8HL22.1
#=GS A0A091VRV6_OPIHO/31-206   AC A0A091VRV6.1
#=GS A0A1A6GQV6_NEOLE/38-138   AC A0A1A6GQV6.1
#=GS A0A0L9TY98_PHAAN/26-186   AC A0A0L9TY98.1
#=GS A0A4W4H6D4_ELEEL/54-200   AC A0A4W4H6D4.1
#=GS A0A1V4KC84_PATFA/8-144    AC A0A1V4KC84.1
#=GS A0A444GDW3_ENSVE/23-188   AC A0A444GDW3.1
#=GS A0A3S1A5C9_ELYCH/35-126   AC A0A3S1A5C9.1
#=GS A0A093CVN4_9AVES/1-98     AC A0A093CVN4.1
#=GS A0A3Q3FZF7_9LABR/27-200   AC A0A3Q3FZF7.1
#=GS A0A402EZX3_9SAUR/41-202   AC A0A402EZX3.1
#=GS FOLR2_MOUSE/29-203        AC Q05685.1
#=GS K7F2T8_PELSI/26-195       AC K7F2T8.1
#=GS D7L3W2_ARALL/34-192       AC D7L3W2.1
#=GS A0A672FTW5_SALFA/23-192   AC A0A672FTW5.1
#=GS A0A091M764_CARIC/3-129    AC A0A091M764.1
#=GS A0A1W0XAM9_HYPDU/75-213   AC A0A1W0XAM9.1
#=GS A0A452FHW0_CAPHI/30-205   AC A0A452FHW0.1
#=GS A0A0A0AII1_CHAVO/31-206   AC A0A0A0AII1.1
#=GS A0A091IPD0_EGRGA/3-165    AC A0A091IPD0.1
#=GS A0A1S3JNN2_LINUN/79-248   AC A0A1S3JNN2.1
#=GS A0A1D1UEU9_RAMVA/47-164   AC A0A1D1UEU9.1
#=GS A0A3Q3RTD1_9TELE/33-207   AC A0A3Q3RTD1.1
#=GS M3YEQ8_MUSPF/43-111       AC M3YEQ8.1
#=GS A0A5P1FJZ1_ASPOF/843-993  AC A0A5P1FJZ1.1
#=GS A0A3Q7R261_VULVU/27-177   AC A0A3Q7R261.1
#=GS A0A5E4EQ94_PRUDU/40-197   AC A0A5E4EQ94.1
#=GS F4K5P7_ARATH/38-198       AC F4K5P7.1
#=GS A0A1S4CHA6_TOBAC/41-192   AC A0A1S4CHA6.1
#=GS A0A669EHM8_ORENI/29-201   AC A0A669EHM8.1
#=GS G1PPC4_MYOLU/31-206       AC G1PPC4.1
#=GS G5AVT7_HETGA/132-307      AC G5AVT7.1
#=GS A0A4U1EI22_MONMO/38-213   AC A0A4U1EI22.1
#=GS A0A087WWY2_HUMAN/47-129   AC A0A087WWY2.1
#=GS A0A671ETX5_RHIFE/30-205   AC A0A671ETX5.1
#=GS F7AHC3_MONDO/30-205       AC F7AHC3.3
#=GS A0A1U8CEV7_MESAU/38-220   AC A0A1U8CEV7.1
#=GS A0A5J5CTA8_9PERO/28-221   AC A0A5J5CTA8.1
#=GS A0A452DRI5_CAPHI/39-221   AC A0A452DRI5.1
#=GS A0A341AAB3_NEOAA/30-205   AC A0A341AAB3.1
#=GS A0A401RF46_CHIPU/9-170    AC A0A401RF46.1
#=GS A0A2K5RKE5_CEBCA/36-211   AC A0A2K5RKE5.1
#=GS C3Y1A9_BRAFL/34-203       AC C3Y1A9.1
#=GS M7B581_CHEMY/56-153       AC M7B581.1
#=GS V4KLW5_EUTSA/37-198       AC V4KLW5.1
#=GS A0A674F4Y9_SALTR/30-191   AC A0A674F4Y9.1
#=GS J3KR13_HUMAN/3-164        AC J3KR13.1
#=GS A0A4X2KWF0_VOMUR/23-198   AC A0A4X2KWF0.1
#=GS A0A091IFN5_CALAN/21-188   AC A0A091IFN5.1
#=GS A0A2R8ZPX1_PANPA/37-193   AC A0A2R8ZPX1.1
#=GS A0A1U7UUD1_CARSF/44-206   AC A0A1U7UUD1.1
#=GS K8EY55_9CHLO/29-238       AC K8EY55.1
#=GS A0A2I3LU31_PAPAN/26-208   AC A0A2I3LU31.1
#=GS A7SH49_NEMVE/214-341      AC A7SH49.1
#=GS F2U311_SALR5/18-154       AC F2U311.1
#=GS E2QXF0_CANLF/3-164        AC E2QXF0.2
#=GS A0A3M0KM39_HIRRU/35-226   AC A0A3M0KM39.1
#=GS A0A3Q3FCG3_9LABR/28-170   AC A0A3Q3FCG3.1
#=GS A0A5F8ADQ8_MACMU/38-220   AC A0A5F8ADQ8.1
#=GS E9PXL5_MOUSE/34-160       AC E9PXL5.1
#=GS A0A4E0RH52_FASHE/63-233   AC A0A4E0RH52.1
#=GS A0A091G6J4_9AVES/21-188   AC A0A091G6J4.1
#=GS A0A674F6Y5_SALTR/23-184   AC A0A674F6Y5.1
#=GS A0A060WNV0_ONCMY/1-143    AC A0A060WNV0.1
#=GS A0C2I4_PARTE/29-192       AC A0C2I4.1
#=GS A0A2C9VH51_MANES/29-193   AC A0A2C9VH51.1
#=GS A0A2K6UFL6_SAIBB/38-220   AC A0A2K6UFL6.1
#=GS A0A672HFF0_SALFA/20-181   AC A0A672HFF0.1
#=GS A0A1S3WI24_ERIEU/4-133    AC A0A1S3WI24.1
#=GS A0A2Y9QCS1_DELLE/38-220   AC A0A2Y9QCS1.1
#=GS A0A2K6LAH7_RHIBE/38-220   AC A0A2K6LAH7.1
#=GS A0A1S3W8Y0_ERIEU/35-149   AC A0A1S3W8Y0.1
#=GS A0A5N4DN67_CAMDR/30-205   AC A0A5N4DN67.1
#=GS A0A2P6R7B4_ROSCH/26-188   AC A0A2P6R7B4.1
#=GS A0A402F1K4_9SAUR/20-181   AC A0A402F1K4.1
#=GS A0A2U3VBB8_ODORO/31-206   AC A0A2U3VBB8.1
#=GS A0A674PBF1_TAKRU/32-191   AC A0A674PBF1.1
#=GS A0A445IMT1_GLYSO/40-203   AC A0A445IMT1.1
#=GS A0A672UF50_STRHB/25-186   AC A0A672UF50.1
#=GS A0A4S2M3S8_OPIFE/1-147    AC A0A4S2M3S8.1
#=GS S4REP9_PETMA/28-195       AC S4REP9.1
#=GS Q7ZWL5_XENLA/38-218       AC Q7ZWL5.1
#=GS A0A2K5RJT0_CEBCA/3-164    AC A0A2K5RJT0.1
#=GS A0A398AQG5_BRACM/10-157   AC A0A398AQG5.1
#=GS A0A3L8RUH4_CHLGU/28-185   AC A0A3L8RUH4.1
#=GS A0A383ZAD1_BALAS/27-177   AC A0A383ZAD1.1
#=GS A0A665U4T8_ECHNA/32-207   AC A0A665U4T8.1
#=GS L8Y6R5_TUPCH/159-321      AC L8Y6R5.1
#=GS A0A099YTJ8_TINGU/21-188   AC A0A099YTJ8.1
#=GS F6TB36_CIOIN/101-235      AC F6TB36.1
#=GS A0A384DKN2_URSMA/2-161    AC A0A384DKN2.1
#=GS A0A452GAF9_CAPHI/26-201   AC A0A452GAF9.1
#=GS R0LWV5_ANAPL/5-131        AC R0LWV5.1
#=GS A0A2U9B5E4_SCOMX/23-198   AC A0A2U9B5E4.1
#=GS A0A096MER3_POEFO/51-213   AC A0A096MER3.1
#=GS A0A2Y9M7R2_DELLE/26-201   AC A0A2Y9M7R2.1
#=GS W5P256_SHEEP/30-205       AC W5P256.1
#=GS A0A0L0DUQ8_THETB/85-215   AC A0A0L0DUQ8.1
#=GS A0A673Y458_SALTR/33-194   AC A0A673Y458.1
#=GS A0A673UM86_SURSU/32-103   AC A0A673UM86.1
#=GS A0A498MI10_LABRO/33-194   AC A0A498MI10.1
#=GS A0A3Q7WLE2_URSAR/30-205   AC A0A3Q7WLE2.1
#=GS A0A2Y9T990_PHYMC/26-210   AC A0A2Y9T990.1
#=GS J3LEC8_ORYBR/50-202       AC J3LEC8.1
#=GS A0A1S2XY02_CICAR/50-210   AC A0A1S2XY02.1
#=GS A0A059B6W0_EUCGR/107-259  AC A0A059B6W0.1
#=GS A0A1S3JEV8_LINUN/34-211   AC A0A1S3JEV8.1
#=GS G3T5H0_LOXAF/38-220       AC G3T5H0.1
#=GS A0A090N3T5_OSTTA/66-215   AC A0A090N3T5.1
#=GS M3W3V7_FELCA/43-194       AC M3W3V7.3
#=GS HHIP_HUMAN/38-220         AC Q96QV1.3
#=GS HHIP_HUMAN/38-220         DR PDB; 3HO5 A; 214-220;
#=GS HHIP_HUMAN/38-220         DR PDB; 2WG3 D; 215-220;
#=GS HHIP_HUMAN/38-220         DR PDB; 3HO3 A; 214-220;
#=GS HHIP_HUMAN/38-220         DR PDB; 2WFT A; 214-220;
#=GS HHIP_HUMAN/38-220         DR PDB; 2WFX B; 215-220;
#=GS HHIP_HUMAN/38-220         DR PDB; 3HO4 A; 214-220;
#=GS HHIP_HUMAN/38-220         DR PDB; 3HO5 B; 214-220;
#=GS HHIP_HUMAN/38-220         DR PDB; 3HO4 B; 214-220;
#=GS HHIP_HUMAN/38-220         DR PDB; 2WG3 C; 215-220;
#=GS HHIP_HUMAN/38-220         DR PDB; 2WG4 B; 215-220;
#=GS HHIP_HUMAN/38-220         DR PDB; 2WFT B; 214-220;
#=GS A0A3P8UW36_CYNSE/30-191   AC A0A3P8UW36.1
#=GS A0A673W9H9_SALTR/33-194   AC A0A673W9H9.1
#=GS M3XV43_MUSPF/2-158        AC M3XV43.1
#=GS A0A6J3QVW0_TURTR/31-192   AC A0A6J3QVW0.1
#=GS A0A3Q3KT30_9TELE/57-219   AC A0A3Q3KT30.1
#=GS A0A1U8BVG3_MESAU/28-189   AC A0A1U8BVG3.2
#=GS A0A2I2YAE8_GORGO/47-123   AC A0A2I2YAE8.1
#=GS L8IR26_9CETA/35-210       AC L8IR26.1
#=GS A0A091QH79_LEPDC/21-188   AC A0A091QH79.1
#=GS A0A1U7SJ35_ALLSI/26-201   AC A0A1U7SJ35.1
#=GS A0A2K5U042_MACFA/3-164    AC A0A2K5U042.1
#=GS A0A3Q0FMJ2_ALLSI/1-118    AC A0A3Q0FMJ2.1
#=GS A0A0P7UWH9_SCLFO/36-215   AC A0A0P7UWH9.1
#=GS A0A2I0LYY8_COLLI/21-188   AC A0A2I0LYY8.1
#=GS A0A4W2CG07_BOBOX/35-210   AC A0A4W2CG07.1
#=GS A0A212D153_CEREH/27-147   AC A0A212D153.1
#=GS A0A0G4E8A7_VITBC/54-214   AC A0A0G4E8A7.1
#=GS F0VK40_NEOCL/2-90         AC F0VK40.1
#=GS A0A3P8TN64_AMPPE/23-198   AC A0A3P8TN64.1
#=GS A0A2K5J2T1_COLAP/37-193   AC A0A2K5J2T1.1
#=GS A0A4W2C248_BOBOX/39-221   AC A0A4W2C248.1
#=GS V4TAS2_9ROSI/29-191       AC V4TAS2.1
#=GS A0A0D3AFH3_BRAOL/41-180   AC A0A0D3AFH3.1
#=GS U3DHV8_CALJA/30-205       AC U3DHV8.1
#=GS D2H3P9_AILME/38-220       AC D2H3P9.1
#=GS A0A2Y9KWZ6_ENHLU/36-216   AC A0A2Y9KWZ6.1
#=GS S7MV48_MYOBR/254-429      AC S7MV48.1
#=GS A0A673CFT2_9TELE/48-210   AC A0A673CFT2.1
#=GS A0A2I0LJU9_COLLI/25-165   AC A0A2I0LJU9.1
#=GS A0A0P1A6E2_PLAHL/31-166   AC A0A0P1A6E2.1
#=GS A0A2I3SDD1_PANTR/59-197   AC A0A2I3SDD1.1
#=GS A0A484GFR9_SOUCH/28-205   AC A0A484GFR9.1
#=GS A0A0E0CMR1_9ORYZ/49-201   AC A0A0E0CMR1.1
#=GS A0A091WNI0_OPIHO/3-129    AC A0A091WNI0.1
#=GS A0A5N6PRC6_9ASTR/46-195   AC A0A5N6PRC6.1
#=GS A0A1U7RC80_MESAU/26-200   AC A0A1U7RC80.1
#=GS A0A1D1UWU8_RAMVA/1-120    AC A0A1D1UWU8.1
#=GS A0A2K5PVM9_CEBCA/26-208   AC A0A2K5PVM9.1
#=GS A0A3Q4MBA7_NEOBR/4-188    AC A0A3Q4MBA7.1
#=GS A0A2K6RR38_RHIRO/3-164    AC A0A2K6RR38.1
#=GS A0A3Q2I4K6_HORSE/199-264  AC A0A3Q2I4K6.1
#=GS D4A4S5_RAT/29-204         AC D4A4S5.1
#=GS A0A452ST55_URSAM/1-159    AC A0A452ST55.1
#=GS A0A5N6QSW7_9ROSI/26-189   AC A0A5N6QSW7.1
#=GS A0A452HZQ9_9SAUR/33-208   AC A0A452HZQ9.1
#=GS S7PK32_MYOBR/1-120        AC S7PK32.1
#=GS G3TSN2_LOXAF/26-201       AC G3TSN2.1
#=GS F7CR90_MACMU/47-222       AC F7CR90.2
#=GS A0A6G0IVW5_LARCR/32-204   AC A0A6G0IVW5.1
#=GS A0A1Z5K2D2_FISSO/85-236   AC A0A1Z5K2D2.1
#=GS H2QFH1_PANTR/59-215       AC H2QFH1.1
#=GS F5H4Z6_HUMAN/30-171       AC F5H4Z6.1
#=GS H2Q4K3_PANTR/26-208       AC H2Q4K3.2
#=GS A0A383ZAP8_BALAS/44-203   AC A0A383ZAP8.1
#=GS A0A2K5WWK8_MACFA/22-183   AC A0A2K5WWK8.1
#=GS H3CCK2_TETNG/24-200       AC H3CCK2.1
#=GS A0A445BKX0_ARAHY/45-206   AC A0A445BKX0.1
#=GS A0A667ZF80_9TELE/28-203   AC A0A667ZF80.1
#=GS V3YZA4_LOTGI/28-191       AC V3YZA4.1
#=GS A0A5E4BQB7_MARMO/34-209   AC A0A5E4BQB7.1
#=GS G1KAA7_ANOCA/44-206       AC G1KAA7.1
#=GS A0A3B3HVB9_ORYLA/28-206   AC A0A3B3HVB9.1
#=GS A0A340XV58_LIPVE/38-220   AC A0A340XV58.1
#=GS A0A1S3JE46_LINUN/5-93     AC A0A1S3JE46.1
#=GS A0A3S1A7A7_ELYCH/1-138    AC A0A3S1A7A7.1
#=GS C6T7F8_SOYBN/40-203       AC C6T7F8.1
#=GS A0A2K5QH49_CEBCA/34-199   AC A0A2K5QH49.1
#=GS A0A340Y7G3_LIPVE/27-183   AC A0A340Y7G3.1
#=GS A0A2K5WWK3_MACFA/22-183   AC A0A2K5WWK3.1
#=GS A0A315VA51_GAMAF/86-261   AC A0A315VA51.1
#=GS A0A3B3IIT4_ORYLA/37-218   AC A0A3B3IIT4.1
#=GS A0A2Y9KUE2_ENHLU/13-188   AC A0A2Y9KUE2.1
#=GS A0A093IH44_EURHL/3-165    AC A0A093IH44.1
#=GS A0A2K6KIA1_RHIBE/47-110   AC A0A2K6KIA1.1
#=GS A0A091N6X8_9PASS/21-188   AC A0A091N6X8.1
#=GS A0A2K6MFR4_RHIBE/47-206   AC A0A2K6MFR4.1
#=GS A0A2K6UA21_SAIBB/30-205   AC A0A2K6UA21.1
#=GS A0A3Q1M762_BOVIN/201-256  AC A0A3Q1M762.1
#=GS A0A1S3JE36_LINUN/50-146   AC A0A1S3JE36.1
#=GS A0A1E7FJP8_9STRA/94-255   AC A0A1E7FJP8.1
#=GS A0A2R9ABR9_PANPA/36-211   AC A0A2R9ABR9.1
#=GS A0A5N4DN97_CAMDR/30-205   AC A0A5N4DN97.1
#=GS A0A2I3RVZ9_PANTR/47-201   AC A0A2I3RVZ9.1
#=GS M4FHF9_BRARP/205-369      AC M4FHF9.1
#=GS A0A2R6RGD4_ACTCC/41-190   AC A0A2R6RGD4.1
#=GS A0A4D9DVA7_9SAUR/26-226   AC A0A4D9DVA7.1
#=GS A0A091TGX1_PELCR/31-206   AC A0A091TGX1.1
#=GS L5M231_MYODS/9-162        AC L5M231.1
#=GS A0A2I3MYB7_PAPAN/38-220   AC A0A2I3MYB7.1
#=GS A0A671WWN0_SPAAU/29-191   AC A0A671WWN0.1
#=GS A0A2K6NI78_RHIRO/26-208   AC A0A2K6NI78.1
#=GS A0A1W0X217_HYPDU/53-186   AC A0A1W0X217.1
#=GS A0A1V4J5R4_PATFA/108-283  AC A0A1V4J5R4.1
#=GS A0A4W6F149_LATCA/28-192   AC A0A4W6F149.1
#=GS A0A3N6QTL4_BRACR/194-335  AC A0A3N6QTL4.1
#=GS A0A1A6FXD0_NEOLE/1-103    AC A0A1A6FXD0.1
#=GS A0A2I3LNK9_PAPAN/59-198   AC A0A2I3LNK9.1
#=GS A0A212DIP5_CEREH/30-117   AC A0A212DIP5.1
#=GS A0A5N5H4K2_9ROSA/26-188   AC A0A5N5H4K2.1
#=GS L9LDL7_TUPCH/163-317      AC L9LDL7.1
#=GS A0A341CG66_NEOAA/98-259   AC A0A341CG66.1
#=GS A0A2I0VYK1_9ASPA/46-197   AC A0A2I0VYK1.1
#=GS A0A091JJM0_EGRGA/3-129    AC A0A091JJM0.1
#=GS A0A0R3UJB2_9CEST/36-228   AC A0A0R3UJB2.1
#=GS C3YF31_BRAFL/56-188       AC C3YF31.1
#=GS A0A5E4D1D3_MARMO/38-220   AC A0A5E4D1D3.1
#=GS A0A1S3KCF9_LINUN/33-205   AC A0A1S3KCF9.1
#=GS A0A1V4JX64_PATFA/158-325  AC A0A1V4JX64.1
#=GS H2M6E9_ORYLA/23-198       AC H2M6E9.2
#=GS A0A087XS24_POEFO/23-198   AC A0A087XS24.2
#=GS A0A091CNE7_FUKDA/43-193   AC A0A091CNE7.1
#=GS A0A674HPM4_TAEGU/21-188   AC A0A674HPM4.1
#=GS L8GFZ8_ACACA/320-468      AC L8GFZ8.1
#=GS A0A2I0TEI5_LIMLA/1-85     AC A0A2I0TEI5.1
#=GS A0A093F6M3_TYTAL/1-156    AC A0A093F6M3.1
#=GS U3JIW3_FICAL/7-168        AC U3JIW3.1
#=GS A0A1S3BYL2_CUCME/33-190   AC A0A1S3BYL2.1
#=GS A0A3Q1MRP4_BOVIN/30-205   AC A0A3Q1MRP4.1
#=GS G1LGF8_AILME/44-124       AC G1LGF8.1
#=GS A0A1R3JTK2_COCAP/42-205   AC A0A1R3JTK2.1
#=GS G1LY46_AILME/1-102        AC G1LY46.1
#=GS H3CIM9_TETNG/5-160        AC H3CIM9.1
#=GS A0A674NCW4_TAKRU/30-189   AC A0A674NCW4.1
#=GS A0A4X2M5F2_VOMUR/29-204   AC A0A4X2M5F2.1
#=GS A0A2K6AU50_MACNE/42-217   AC A0A2K6AU50.1
#=GS A0A2F0B8W2_ESCRO/27-116   AC A0A2F0B8W2.1
#=GS A0A124SAH4_CYNCS/279-427  AC A0A124SAH4.1
#=GS A0A674F6Z0_SALTR/34-195   AC A0A674F6Z0.1
#=GS A0A2Y9E1U1_TRIMA/26-201   AC A0A2Y9E1U1.1
#=GS A0A4W5PNF9_9TELE/29-207   AC A0A4W5PNF9.1
#=GS A0A3Q2CIF1_CYPVA/60-221   AC A0A3Q2CIF1.1
#=GS A0A2K5D9K7_AOTNA/47-201   AC A0A2K5D9K7.1
#=GS A0A2I0J249_PUNGR/24-199   AC A0A2I0J249.1
#=GS A0A6A5EXE8_PERFL/28-213   AC A0A6A5EXE8.1
#=GS A0A672GWR8_SALFA/7-146    AC A0A672GWR8.1
#=GS F7DUE2_ORNAN/38-221       AC F7DUE2.3
#=GS G3Q9Q0_GASAC/1-143        AC G3Q9Q0.1
#=GS A0A671XGR2_SPAAU/35-196   AC A0A671XGR2.1
#=GS G3WWL1_SARHA/29-194       AC G3WWL1.1
#=GS A0A383ZEX0_BALAS/30-205   AC A0A383ZEX0.1
#=GS A0A099YZJ2_TINGU/4-129    AC A0A099YZJ2.1
#=GS A0A4S2M3L0_OPIFE/34-204   AC A0A4S2M3L0.1
#=GS W5NUZ8_SHEEP/20-195       AC W5NUZ8.1
#=GS A0A1S3F111_DIPOR/29-204   AC A0A1S3F111.1
#=GS A0A2Y9F7K9_PHYMC/38-220   AC A0A2Y9F7K9.1
#=GS A0A0B0MQQ7_GOSAR/43-205   AC A0A0B0MQQ7.1
#=GS A0A401PDB6_SCYTO/37-133   AC A0A401PDB6.1
#=GS A0A2K6U9X6_SAIBB/1-174    AC A0A2K6U9X6.1
#=GS U6KH51_9EIME/1-99         AC U6KH51.1
#=GS A0A0V0QLV3_PSEPJ/47-208   AC A0A0V0QLV3.1
#=GS A0A665U4V8_ECHNA/27-195   AC A0A665U4V8.1
#=GS A0A3P9Q3Q5_POERE/23-198   AC A0A3P9Q3Q5.1
#=GS A0A5B6VI32_9ROSI/17-179   AC A0A5B6VI32.1
#=GS A0A329S9C2_9STRA/33-184   AC A0A329S9C2.1
#=GS A0A0D9VHR3_9ORYZ/41-193   AC A0A0D9VHR3.1
#=GS A0A3N0XWP8_ANAGA/1-143    AC A0A3N0XWP8.1
#=GS A0A446WCW3_TRITD/54-207   AC A0A446WCW3.1
#=GS A0A2K6Q6I5_RHIRO/59-198   AC A0A2K6Q6I5.1
#=GS A0A093Q978_9PASS/1-139    AC A0A093Q978.1
#=GS A0A1S3JP76_LINUN/35-178   AC A0A1S3JP76.1
#=GS W5P1W2_SHEEP/35-210       AC W5P1W2.1
#=GS A0A226MGQ3_CALSU/59-234   AC A0A226MGQ3.1
#=GS A0A2K6GD42_PROCO/36-211   AC A0A2K6GD42.1
#=GS A0A5F8HFA9_MONDO/60-186   AC A0A5F8HFA9.1
#=GS A0A4U5QS39_POPAL/90-253   AC A0A4U5QS39.1
#=GS A0A2U9CRZ8_SCOMX/28-203   AC A0A2U9CRZ8.1
#=GS A0A2T7F8G7_9POAL/45-196   AC A0A2T7F8G7.1
#=GS H3ASX4_LATCH/39-187       AC H3ASX4.1
#=GS A0A340XVA8_LIPVE/30-205   AC A0A340XVA8.1
#=GS A0A078GMG4_BRANA/3-101    AC A0A078GMG4.1
#=GS A0A3P8X980_ESOLU/34-195   AC A0A3P8X980.2
#=GS A0A2I0TKU5_LIMLA/9-109    AC A0A2I0TKU5.1
#=GS A0A226MRY7_COLVI/2-92     AC A0A226MRY7.1
#=GS A0A0K9PKS2_ZOSMR/44-193   AC A0A0K9PKS2.1
#=GS A0A2U3VKW6_ODORO/27-188   AC A0A2U3VKW6.1
#=GS A0A452HZT4_9SAUR/26-208   AC A0A452HZT4.1
#=GS A0A2K6GLL0_PROCO/22-183   AC A0A2K6GLL0.1
#=GS A0A061F3A3_THECC/42-205   AC A0A061F3A3.1
#=GS R4GC40_ANOCA/31-192       AC R4GC40.1
#=GS A0A4X2M5D9_VOMUR/33-172   AC A0A4X2M5D9.1
#=GS A0A286Y3Q3_CAVPO/38-220   AC A0A286Y3Q3.1
#=GS A0A446VF58_TRITD/47-198   AC A0A446VF58.1
#=GS A0A397XQY0_BRACM/38-198   AC A0A397XQY0.1
#=GS A4S053_OSTLU/1-131        AC A4S053.1
#=GS A0A1S3F1E4_DIPOR/45-206   AC A0A1S3F1E4.1
#=GS A0A384BWL5_URSMA/27-202   AC A0A384BWL5.1
#=GS A0A094K8L7_ANTCR/21-188   AC A0A094K8L7.1
#=GS A0A1E5W2X3_9POAL/37-197   AC A0A1E5W2X3.1
#=GS A0A2R9CTI8_PANPA/37-208   AC A0A2R9CTI8.1
#=GS A0A2K5RGP9_CEBCA/20-181   AC A0A2K5RGP9.1
#=GS A0A200PWQ4_9MAGN/26-189   AC A0A200PWQ4.1
#=GS A0A096MMB1_PAPAN/36-211   AC A0A096MMB1.1
#=GS S7PD58_MYOBR/36-211       AC S7PD58.1
#=GS M1CAU9_SOLTU/41-192       AC M1CAU9.1
#=GS A0A667ZX62_9TELE/20-179   AC A0A667ZX62.1
#=GS A0A4Z2DXW4_SCHJA/40-184   AC A0A4Z2DXW4.1
#=GS A0A2R6WMZ3_MARPO/42-206   AC A0A2R6WMZ3.1
#=GS A0A0L0FZI6_9EUKA/26-177   AC A0A0L0FZI6.1
#=GS F7IF74_CALJA/59-215       AC F7IF74.1
#=GS C0HAY9_SALSA/29-207       AC C0HAY9.1
#=GS A0A3B6QER5_WHEAT/44-197   AC A0A3B6QER5.1
#=GS A0A5K1VB92_PIG/4-164      AC A0A5K1VB92.1
#=GS A0A2K5LBG7_CERAT/36-211   AC A0A2K5LBG7.1
#=GS A0A3Q2WVY0_HAPBU/36-208   AC A0A3Q2WVY0.1
#=GS K3YUK0_SETIT/45-198       AC K3YUK0.1
#=GS A0A2Y9K9W1_ENHLU/27-201   AC A0A2Y9K9W1.1
#=GS A0A4W2FC54_BOBOX/39-221   AC A0A4W2FC54.1
#=GS A0A2K6AU36_MACNE/36-211   AC A0A2K6AU36.1
#=GS G3TYX8_LOXAF/28-189       AC G3TYX8.1
#=GS A0A6G1B0V7_CROCR/30-203   AC A0A6G1B0V7.1
#=GS Q5CX08_CRYPI/39-218       AC Q5CX08.1
#=GS A0A2U3XGN1_LEPWE/27-177   AC A0A2U3XGN1.1
#=GS A0A671FX69_RHIFE/26-208   AC A0A671FX69.1
#=GS A0A5A9PKT8_9TELE/36-212   AC A0A5A9PKT8.1
#=GS A0A2U3VBC3_ODORO/30-205   AC A0A2U3VBC3.1
#=GS A0A1A6FW57_NEOLE/34-218   AC A0A1A6FW57.1
#=GS W2YHK5_PHYPR/33-184       AC W2YHK5.1
#=GS A0A4W3HYK1_CALMI/25-191   AC A0A4W3HYK1.1
#=GS A0A4W5P190_9TELE/33-194   AC A0A4W5P190.1
#=GS A0A5N4CII2_CAMDR/47-206   AC A0A5N4CII2.1
#=GS A0A444U9V3_ACIRT/21-186   AC A0A444U9V3.1
#=GS A0A1U8D644_ALLSI/22-189   AC A0A1U8D644.1
#=GS A0A1S3JMU8_LINUN/25-193   AC A0A1S3JMU8.1
#=GS A0A5D2YDN9_GOSMU/43-205   AC A0A5D2YDN9.1
#=GS A0A2K5U027_MACFA/47-222   AC A0A2K5U027.1
#=GS I3LDJ1_PIG/192-248        AC I3LDJ1.1
#=GS A0A2K5LBK9_CERAT/47-110   AC A0A2K5LBK9.1
#=GS A0A087G9F8_ARAAL/33-194   AC A0A087G9F8.1
#=GS C3XSA1_BRAFL/90-235       AC C3XSA1.1
#=GS G1M0Y2_AILME/27-208       AC G1M0Y2.1
#=GS A0A2K5UR81_MACFA/26-208   AC A0A2K5UR81.1
#=GS A0A6Q2Z0F9_ESOLU/30-180   AC A0A6Q2Z0F9.1
#=GS A7T9S3_NEMVE/40-169       AC A7T9S3.1
#=GS G3WEP6_SARHA/39-222       AC G3WEP6.1
#=GS A0A3B6NQI2_WHEAT/47-198   AC A0A3B6NQI2.1
#=GS A0A093PCA7_9PASS/3-129    AC A0A093PCA7.1
#=GS A0A2K5D9H1_AOTNA/30-205   AC A0A2K5D9H1.1
#=GS A0A2K6ESG4_PROCO/44-206   AC A0A2K6ESG4.1
#=GS A0A2Z7AWH8_9LAMI/33-193   AC A0A2Z7AWH8.1
#=GS G1RQQ9_NOMLE/17-170       AC G1RQQ9.2
#=GS A0A3Q4HYE0_NEOBR/5-166    AC A0A3Q4HYE0.1
#=GS A0A5N3XBI4_MUNRE/35-210   AC A0A5N3XBI4.1
#=GS A0A087R786_APTFO/31-206   AC A0A087R786.1
#=GS A0A0E0NH61_ORYRU/49-201   AC A0A0E0NH61.1
#=GS A0A2I4BP03_9TELE/38-210   AC A0A2I4BP03.1
#=GS G3QHP1_GORGO/59-215       AC G3QHP1.1
#=GS A0A384AQ25_BALAS/38-220   AC A0A384AQ25.1
#=GS A0A2K6A9J8_MANLE/34-196   AC A0A2K6A9J8.1
#=GS H2QZT5_PANTR/22-183       AC H2QZT5.2
#=GS A0A340X670_LIPVE/23-112   AC A0A340X670.1
#=GS A0A5J9V1V7_9POAL/46-199   AC A0A5J9V1V7.1
#=GS A0A2H5PYP7_CITUN/19-195   AC A0A2H5PYP7.1
#=GS A0A2P6NF93_9EUKA/60-205   AC A0A2P6NF93.1
#=GS A0A096MUB4_PAPAN/36-211   AC A0A096MUB4.2
#=GS A0A3Q3MUQ5_9TELE/35-196   AC A0A3Q3MUQ5.1
#=GS A0A6A1QAN0_BALPH/114-197  AC A0A6A1QAN0.1
#=GS A0A2Y9DVM5_TRIMA/36-211   AC A0A2Y9DVM5.1
#=GS A0A556V3U1_BAGYA/30-191   AC A0A556V3U1.1
#=GS A0A3Q1C9Y7_AMPOC/26-199   AC A0A3Q1C9Y7.1
#=GS A0A2Y9JXW6_ENHLU/44-206   AC A0A2Y9JXW6.1
#=GS A0A553MY15_9TELE/3-164    AC A0A553MY15.1
#=GS S7MV48_MYOBR/31-206       AC S7MV48.1
#=GS L5LF69_MYODS/124-301      AC L5LF69.1
#=GS RTBDN_CANLF/27-177        AC Q4TUC0.1
#=GS A0A2G3AXK6_CAPCH/39-189   AC A0A2G3AXK6.1
#=GS H2RXT6_TAKRU/19-188       AC H2RXT6.3
#=GS A0A267GXH9_9PLAT/30-181   AC A0A267GXH9.1
#=GS A0A402E919_9SAUR/36-218   AC A0A402E919.1
#=GS A0A6H5FV41_9HEMI/2-75     AC A0A6H5FV41.1
#=GS A0A493SVL6_ANAPP/26-124   AC A0A493SVL6.1
#=GS A0A6I8R932_XENTR/24-181   AC A0A6I8R932.1
#=GS A0A384BNF0_URSMA/38-220   AC A0A384BNF0.1
#=GS A0A2Y9MWE7_DELLE/30-205   AC A0A2Y9MWE7.1
#=GS A0A6A5EXL5_PERFL/50-225   AC A0A6A5EXL5.1
#=GS A0A3B5QDK3_XIPMA/26-201   AC A0A3B5QDK3.1
#=GS A0A4D9F027_9SAUR/35-217   AC A0A4D9F027.1
#=GS A0A3M6V221_9CNID/29-195   AC A0A3M6V221.1
#=GS G1PPC7_MYOLU/2-153        AC G1PPC7.1
#=GS A0A671G275_RHIFE/48-206   AC A0A671G275.1
#=GS A0A1S3JFL1_LINUN/32-204   AC A0A1S3JFL1.1
#=GS A0A672V311_STRHB/26-201   AC A0A672V311.1
#=GS A0A0D9R2L1_CHLSB/1-120    AC A0A0D9R2L1.1
#=GS A0A485P7N9_LYNPA/2-164    AC A0A485P7N9.1
#=GS A0A2K6SEV9_SAIBB/48-206   AC A0A2K6SEV9.1
#=GS A0A3Q4MBB3_NEOBR/34-195   AC A0A3Q4MBB3.1
#=GS U3JUU5_FICAL/47-222       AC U3JUU5.1
#=GS I3M7G9_ICTTR/27-208       AC I3M7G9.1
#=GS A0A078G0I8_BRANA/33-173   AC A0A078G0I8.1
#=GS A0A673TNZ0_SURSU/26-201   AC A0A673TNZ0.1
#=GS U6MBN1_EIMMA/1-87         AC U6MBN1.1
#=GS A0A0Q3UR77_AMAAE/25-186   AC A0A0Q3UR77.1
#=GS H3AU75_LATCH/19-181       AC H3AU75.1
#=GS A0A3Q1GX10_9TELE/23-198   AC A0A3Q1GX10.1
#=GS A0A3Q7X8Q3_URSAR/4-176    AC A0A3Q7X8Q3.1
#=GS A5PJW9_BOVIN/38-220       AC A5PJW9.1
#=GS A0A067EMB2_CITSI/29-192   AC A0A067EMB2.1
#=GS A0A668A834_9TELE/38-203   AC A0A668A834.1
#=GS A0A2R9C5Y0_PANPA/26-208   AC A0A2R9C5Y0.1
#=GS A0A2K5DCK6_AOTNA/22-181   AC A0A2K5DCK6.1
#=GS A0A1S3HE47_LINUN/1-143    AC A0A1S3HE47.1
#=GS A0A3Q3B8W9_KRYMA/38-209   AC A0A3Q3B8W9.1
#=GS A0A671WTR5_SPAAU/54-216   AC A0A671WTR5.1
#=GS L8Y219_TUPCH/38-220       AC L8Y219.1
#=GS A0A2B4SH32_STYPI/41-152   AC A0A2B4SH32.1
#=GS K7EVL7_PONAB/47-222       AC K7EVL7.1
#=GS L5K8G1_PTEAL/30-205       AC L5K8G1.1
#=GS A0A2K6GQF4_PROCO/30-205   AC A0A2K6GQF4.1
#=GS A0A446VF53_TRITD/57-208   AC A0A446VF53.1
#=GS A0A2K1K7J2_PHYPA/29-181   AC A0A2K1K7J2.1
#=GS A0A667ZQB9_9TELE/23-198   AC A0A667ZQB9.1
#=GS C3Z7R5_BRAFL/50-177       AC C3Z7R5.1
#=GS V4A3I8_LOTGI/9-180        AC V4A3I8.1
#=GS A0A5N3XBH7_MUNRE/30-205   AC A0A5N3XBH7.1
#=GS A0A1A6FW57_NEOLE/213-297  AC A0A1A6FW57.1
#=GS A0A670IQY9_PODMU/22-189   AC A0A670IQY9.1
#=GS A0A4Z2F325_9TELE/17-179   AC A0A4Z2F325.1
#=GS A0A096M9D8_POEFO/15-184   AC A0A096M9D8.1
#=GS A0A1X7U4F1_AMPQE/33-210   AC A0A1X7U4F1.1
#=GS A0A091WBS1_OPIHO/3-165    AC A0A091WBS1.1
#=GS FOLR1_BOVIN/35-210        AC P02702.3
#=GS A0A3S2LZH0_ORYJA/23-193   AC A0A3S2LZH0.1
#=GS A0A2I3GV70_NOMLE/30-187   AC A0A2I3GV70.1
#=GS A0A0P7U0S1_SCLFO/29-212   AC A0A0P7U0S1.1
#=GS A0A218V2Q1_9PASE/26-187   AC A0A218V2Q1.1
#=GS A0A5N3XAW7_MUNRE/26-208   AC A0A5N3XAW7.1
#=GS A0A087GDP1_ARAAL/28-181   AC A0A087GDP1.1
#=GS A0A6I8PNF8_XENTR/37-198   AC A0A6I8PNF8.1
#=GS A0A078HDM7_BRANA/1-131    AC A0A078HDM7.1
#=GS A0A6G1ADC7_CROCR/38-200   AC A0A6G1ADC7.1
#=GS A0A3Q1CNW7_AMPOC/23-198   AC A0A3Q1CNW7.1
#=GS A0A091U2T7_PHORB/31-206   AC A0A091U2T7.1
#=GS A0A5N3XU34_MUNRE/44-206   AC A0A5N3XU34.1
#=GS A0A091JXS0_COLST/31-202   AC A0A091JXS0.1
#=GS A0A6G0HUW1_LARCR/28-206   AC A0A6G0HUW1.1
#=GS A0A2K5Q8J6_CEBCA/27-183   AC A0A2K5Q8J6.1
#=GS A0A484C3K8_PERFV/35-196   AC A0A484C3K8.1
#=GS A0A2K5EWG4_AOTNA/36-211   AC A0A2K5EWG4.1
#=GS A0A1V4JJ80_PATFA/11-171   AC A0A1V4JJ80.1
#=GS A0A3Q0D977_MESAU/26-134   AC A0A3Q0D977.1
#=GS A0A2K5NV54_CERAT/59-215   AC A0A2K5NV54.1
#=GS A0A2U3YPW0_LEPWE/31-206   AC A0A2U3YPW0.1
#=GS C3Z5S2_BRAFL/82-229       AC C3Z5S2.1
#=GS A0A4W5R152_9TELE/34-195   AC A0A4W5R152.1
#=GS A0A226NA06_CALSU/27-188   AC A0A226NA06.1
#=GS A0A0R3SDA3_HYMDI/36-214   AC A0A0R3SDA3.1
#=GS A0A2K5MMC2_CERAT/20-181   AC A0A2K5MMC2.1
#=GS A0A452GGV2_9SAUR/35-210   AC A0A452GGV2.1
#=GS A0A0R4IY94_DANRE/29-201   AC A0A0R4IY94.1
#=GS K3WYW0_GLOUD/25-185       AC K3WYW0.1
#=GS A0A2K6FL04_PROCO/41-168   AC A0A2K6FL04.1
#=GS E7EU04_HUMAN/43-210       AC E7EU04.2
#=GS A0A5F9DDF8_RABIT/35-210   AC A0A5F9DDF8.1
#=GS A0A2K3LBL3_TRIPR/24-185   AC A0A2K3LBL3.1
#=GS A0A3P8WQC7_CYNSE/33-206   AC A0A3P8WQC7.1
#=GS V8PDU7_OPHHA/22-189       AC V8PDU7.1
#=GS A0A2G9G2W0_9LAMI/30-190   AC A0A2G9G2W0.1
#=GS A0A091RYF6_9GRUI/3-165    AC A0A091RYF6.1
#=GS A0A0D9S170_CHLSB/38-220   AC A0A0D9S170.1
#=GS A0A3L8SQR4_CHLGU/21-188   AC A0A3L8SQR4.1
#=GS H3HEC3_PHYRM/33-184       AC H3HEC3.1
#=GS A0A091G927_9AVES/3-129    AC A0A091G927.1
#=GS A0A251PAD7_PRUPE/14-166   AC A0A251PAD7.1
#=GS A0A0N8K116_SCLFO/23-198   AC A0A0N8K116.1
#=GS A0A4X2KMW6_VOMUR/39-222   AC A0A4X2KMW6.1
#=GS A0A078FZH1_BRANA/153-313  AC A0A078FZH1.1
#=GS A0A3Q7RZ30_VULVU/45-206   AC A0A3Q7RZ30.1
#=GS M4FHF8_BRARP/34-173       AC M4FHF8.1
#=GS A0A1U7SPX6_CARSF/27-183   AC A0A1U7SPX6.1
#=GS A0A1S3GN12_DIPOR/27-173   AC A0A1S3GN12.1
#=GS A0A3Q7RSV4_VULVU/26-182   AC A0A3Q7RSV4.1
#=GS A0A384BN01_URSMA/38-220   AC A0A384BN01.1
#=GS A0A398AT13_BRACM/1-125    AC A0A398AT13.1
#=GS A0A674GDH4_TAEGU/30-203   AC A0A674GDH4.1
#=GS A0A2K5WE79_MACFA/38-220   AC A0A2K5WE79.1
#=GS A0A670IXM2_PODMU/30-211   AC A0A670IXM2.1
#=GS A0A669DJM7_ORENI/37-208   AC A0A669DJM7.1
#=GS G3SXL0_LOXAF/35-210       AC G3SXL0.1
#=GS A0A1S3JMB2_LINUN/29-196   AC A0A1S3JMB2.1
#=GS A0A2P5AD84_PARAD/27-185   AC A0A2P5AD84.1
#=GS A0A3P9DJM5_9CICH/33-194   AC A0A3P9DJM5.1
#=GS U6ITH9_ECHGR/36-215       AC U6ITH9.1
#=GS A0A087V3F6_BALRE/3-165    AC A0A087V3F6.1
#=GS A0A2I2ZUF7_GORGO/37-193   AC A0A2I2ZUF7.1
#=GS G3WWL0_SARHA/29-194       AC G3WWL0.1
#=GS A0A2I2UXU2_FELCA/38-220   AC A0A2I2UXU2.2
#=GS A0A452EP42_CAPHI/44-206   AC A0A452EP42.1
#=GS A0A093CYM0_TAUER/31-206   AC A0A093CYM0.1
#=GS A0A453NZF6_AEGTS/36-189   AC A0A453NZF6.1
#=GS A0A4W6F4E9_LATCA/23-198   AC A0A4W6F4E9.1
#=GS A0A3B5KKC2_TAKRU/27-196   AC A0A3B5KKC2.1
#=GS A0A2U3V495_TURTR/38-220   AC A0A2U3V495.1
#=GS A0A2I2Z774_GORGO/36-206   AC A0A2I2Z774.1
#=GS A0A078G1E7_BRANA/37-201   AC A0A078G1E7.1
#=GS A0A397Z1Q3_BRACM/37-197   AC A0A397Z1Q3.1
#=GS A0A1S3JFL3_LINUN/34-209   AC A0A1S3JFL3.1
#=GS A0A287BJS7_PIG/82-257     AC A0A287BJS7.1
#=GS A0A3P9DIJ7_9CICH/33-194   AC A0A3P9DIJ7.1
#=GS A0A673CHN1_9TELE/28-190   AC A0A673CHN1.1
#=GS A0A498LKF0_LABRO/1-143    AC A0A498LKF0.1
#=GS H2Q8W9_PANTR/22-183       AC H2Q8W9.2
#=GS F6SQN2_HORSE/31-192       AC F6SQN2.2
#=GS A0A6A5FKF9_PERFL/31-204   AC A0A6A5FKF9.1
#=GS A0A0D2U8N0_CAPO3/45-225   AC A0A0D2U8N0.1
#=GS A0A673C9A7_9TELE/19-181   AC A0A673C9A7.1
#=GS FOLR1_MOUSE/34-209        AC P35846.2
#=GS A0A452Q700_HUMAN/34-104   AC A0A452Q700.1
#=GS A0A670HR88_PODMU/26-201   AC A0A670HR88.1
#=GS K7EKV3_HUMAN/27-183       AC K7EKV3.1
#=GS F6PEI8_DANRE/34-195       AC F6PEI8.1
#=GS A0A1R3K877_9ROSI/29-193   AC A0A1R3K877.1
#=GS S7NLK6_MYOBR/1-174        AC S7NLK6.1
#=GS A0A315UWT1_GAMAF/144-319  AC A0A315UWT1.1
#=GS A0A674BBD6_SALTR/34-195   AC A0A674BBD6.1
#=GS A0A0D9S1B0_CHLSB/26-201   AC A0A0D9S1B0.1
#=GS H9GJK4_ANOCA/31-192       AC H9GJK4.2
#=GS A0A1S3NQ50_SALSA/33-194   AC A0A1S3NQ50.1
#=GS M3VY61_FELCA/41-200       AC M3VY61.2
#=GS A0A2K5P851_CERAT/36-211   AC A0A2K5P851.1
#=GS A0A3Q3AF00_KRYMA/92-253   AC A0A3Q3AF00.1
#=GS A0A2K6Q6I7_RHIRO/37-193   AC A0A2K6Q6I7.1
#=GS A0A2F0AW75_ESCRO/62-237   AC A0A2F0AW75.1
#=GS A0A5A9NYT3_9TELE/65-226   AC A0A5A9NYT3.1
#=GS A0A3M0K652_HIRRU/21-188   AC A0A3M0K652.1
#=GS D3Z631_MOUSE/26-172       AC D3Z631.1
#=GS A0A2Y9F773_PHYMC/38-220   AC A0A2Y9F773.1
#=GS A0A1L8F099_XENLA/22-183   AC A0A1L8F099.1
#=GS A0A672Z3F7_9TELE/23-195   AC A0A672Z3F7.1
#=GS A0A452GH52_9SAUR/6-159    AC A0A452GH52.1
#=GS A0A2K6KI95_RHIBE/3-164    AC A0A2K6KI95.1
#=GS A0A3Q2ECL3_CYPVA/38-210   AC A0A3Q2ECL3.1
#=GS A0A067JV92_JATCU/29-192   AC A0A067JV92.1
#=GS H2Q4C3_PANTR/36-211       AC H2Q4C3.2
#=GS A0A1Z5K225_FISSO/84-225   AC A0A1Z5K225.1
#=GS A0A3S3R303_9MAGN/40-191   AC A0A3S3R303.1
#=GS H3B327_LATCH/36-213       AC H3B327.1
#=GS A0A1U7R1V5_MESAU/38-220   AC A0A1U7R1V5.1
#=GS A0A674NA43_TAKRU/61-220   AC A0A674NA43.1
#=GS A0A384DFQ4_URSMA/1-168    AC A0A384DFQ4.1
#=GS A0A226PHG7_COLVI/27-188   AC A0A226PHG7.1
#=GS A0A1V4L0L5_PATFA/141-276  AC A0A1V4L0L5.1
#=GS A0A093IZS2_EURHL/3-129    AC A0A093IZS2.1
#=GS A0A1S3K2Z7_LINUN/34-177   AC A0A1S3K2Z7.1
#=GS A0A485MMK9_LYNPA/31-206   AC A0A485MMK9.1
#=GS A0A6G0IV69_LARCR/65-240   AC A0A6G0IV69.1
#=GS F1Q4J6_CANLF/38-220       AC F1Q4J6.2
#=GS H2N3N0_PONAB/47-205       AC H2N3N0.1
#=GS A0A665UJN7_ECHNA/48-221   AC A0A665UJN7.1
#=GS F1S9I3_PIG/147-306        AC F1S9I3.3
#=GS A0A4S2LY33_OPIFE/95-237   AC A0A4S2LY33.1
#=GS A0A3N0Z353_ANAGA/25-186   AC A0A3N0Z353.1
#=GS A0A2Y9M9H7_DELLE/27-177   AC A0A2Y9M9H7.1
#=GS A0A2K6L4W1_RHIBE/59-198   AC A0A2K6L4W1.1
#=GS A0A3B5KMZ9_TAKRU/46-215   AC A0A3B5KMZ9.2
#=GS A0A673ZDL0_SALTR/29-207   AC A0A673ZDL0.1
#=GS A0A093QTR6_PYGAD/3-165    AC A0A093QTR6.1
#=GS G5E8D3_MOUSE/26-170       AC G5E8D3.1
#=GS U3I6W0_ANAPP/48-153       AC U3I6W0.2
#=GS R0JWY8_ANAPL/31-206       AC R0JWY8.1
#=GS A0A5F8H9K8_MONDO/33-194   AC A0A5F8H9K8.1
#=GS G1R071_NOMLE/38-220       AC G1R071.1
#=GS G1QJ55_NOMLE/22-183       AC G1QJ55.2
#=GS A0A6I8PWX7_XENTR/25-186   AC A0A6I8PWX7.1
#=GS A0A093NQN6_PYGAD/31-206   AC A0A093NQN6.1
#=GS A0A2K6N9T0_RHIRO/36-211   AC A0A2K6N9T0.1
#=GS A0A1Q9DPC2_SYMMI/287-454  AC A0A1Q9DPC2.1
#=GS A0A3Q2HIS8_HORSE/26-201   AC A0A3Q2HIS8.2
#=GS A0A3Q2DXE5_CYPVA/26-204   AC A0A3Q2DXE5.1
#=GS A0A2K5R2D8_CEBCA/48-206   AC A0A2K5R2D8.1
#=GS C3Y0S4_BRAFL/3-162        AC C3Y0S4.1
#=GS A0A341ARR8_NEOAA/38-220   AC A0A341ARR8.1
#=GS A0A2K6RR53_RHIRO/47-222   AC A0A2K6RR53.1
#=GS F7CKM1_MONDO/37-213       AC F7CKM1.3
#=GS G1NDJ8_MELGA/23-190       AC G1NDJ8.2
#=GS A0A3M6V5B8_9CNID/42-193   AC A0A3M6V5B8.1
#=GS A0A4U1ECT0_MONMO/30-205   AC A0A4U1ECT0.1
#=GS A0A3Q0FNI2_ALLSI/26-201   AC A0A3Q0FNI2.1
#=GS A0A1S3G802_DIPOR/228-357  AC A0A1S3G802.1
#=GS A0A384APX0_BALAS/38-220   AC A0A384APX0.1
#=GS A0A4W5LT33_9TELE/29-207   AC A0A4W5LT33.1
#=GS A0A2I4H1H5_JUGRE/32-195   AC A0A2I4H1H5.1
#=GS A0A5N5KFU0_9ROSI/13-175   AC A0A5N5KFU0.1
#=GS M3YLD8_MUSPF/27-201       AC M3YLD8.1
#=GS H9GQT5_ANOCA/10-102       AC H9GQT5.2
#=GS A0A2Y9F2Q7_PHYMC/34-209   AC A0A2Y9F2Q7.1
#=GS A0A3Q7SWQ2_VULVU/56-197   AC A0A3Q7SWQ2.1
#=GS A0A2K5RGK0_CEBCA/20-181   AC A0A2K5RGK0.1
#=GS S4RHD7_PETMA/30-210       AC S4RHD7.1
#=GS A0A0A0MVH3_PAPAN/59-215   AC A0A0A0MVH3.1
#=GS A0A452SU57_URSAM/30-205   AC A0A452SU57.1
#=GS A0A2K6T2M9_SAIBB/59-215   AC A0A2K6T2M9.1
#=GS A0A6Q2YLR5_ESOLU/36-214   AC A0A6Q2YLR5.1
#=GS A0A1W0X2G5_HYPDU/2-166    AC A0A1W0X2G5.1
#=GS W4XKK9_STRPU/19-164       AC W4XKK9.1
#=GS A0A2K6C7H9_MACNE/22-183   AC A0A2K6C7H9.1
#=GS A0A0P7ZE86_SCLFO/55-199   AC A0A0P7ZE86.1
#=GS L5MEG2_MYODS/38-220       AC L5MEG2.1
#=GS A0A094L2Q6_PODCR/21-161   AC A0A094L2Q6.1
#=GS A0A4W6F247_LATCA/28-192   AC A0A4W6F247.1
#=GS A0A3P9B4E6_9CICH/28-209   AC A0A3P9B4E6.1
#=GS G1KRJ2_ANOCA/23-190       AC G1KRJ2.2
#=GS M7BJ70_CHEMY/12-178       AC M7BJ70.1
#=GS G3U6S7_LOXAF/49-130       AC G3U6S7.1
#=GS A0A3P9C2F5_9CICH/21-183   AC A0A3P9C2F5.1
#=GS A0A091UKA2_PHORB/3-165    AC A0A091UKA2.1
#=GS A0A6A3B4X7_HIBSY/42-205   AC A0A6A3B4X7.1
#=GS U3K058_FICAL/31-207       AC U3K058.1
#=GS A0A1U8I9H5_GOSHI/43-205   AC A0A1U8I9H5.1
#=GS F5H3Z4_HUMAN/45-198       AC F5H3Z4.1
#=GS U6HA89_9EIME/13-154       AC U6HA89.1
#=GS A0A1S3ABQ2_ERIEU/54-180   AC A0A1S3ABQ2.1
#=GS F7GMI4_CALJA/22-183       AC F7GMI4.2
#=GS A0A5N5I3P1_9ROSA/37-199   AC A0A5N5I3P1.1
#=GS A0A093QB07_9PASS/21-188   AC A0A093QB07.1
#=GS A0A2K5HJW8_COLAP/42-217   AC A0A2K5HJW8.1
#=GS A0A287U6R1_HORVV/44-197   AC A0A287U6R1.1
#=GS B9RFD1_RICCO/36-198       AC B9RFD1.1
#=GS A0A2K6AU43_MACNE/36-211   AC A0A2K6AU43.1
#=GS A0A2Y9F811_PHYMC/38-220   AC A0A2Y9F811.1
#=GS A0A2R2MQE2_LINUN/5-177    AC A0A2R2MQE2.1
#=GS A0A3Q0D6Q1_MESAU/43-204   AC A0A3Q0D6Q1.1
#=GS A0A0Q3U3A0_AMAAE/333-508  AC A0A0Q3U3A0.1
#=GS A0A067QXU6_ZOONE/110-207  AC A0A067QXU6.1
#=GS A0A1Q3DEW2_CEPFO/27-190   AC A0A1Q3DEW2.1
#=GS A0A2Y9IIB0_NEOSC/27-177   AC A0A2Y9IIB0.1
#=GS A0A060ZA98_ONCMY/1-169    AC A0A060ZA98.1
#=GS H3AJ36_LATCH/1-106        AC H3AJ36.1
#=GS A0A2K6UMR7_SAIBB/36-211   AC A0A2K6UMR7.1
#=GS A0A484DKJ2_PERFV/55-230   AC A0A484DKJ2.1
#=GS G3TAX8_LOXAF/39-200       AC G3TAX8.1
#=GS A0A671FCC6_RHIFE/38-220   AC A0A671FCC6.1
#=GS A0A2K1XZF1_POPTR/29-191   AC A0A2K1XZF1.1
#=GS A0A2Y9G6W6_NEOSC/27-202   AC A0A2Y9G6W6.1
#=GS A0A504Z9T6_FASGI/46-216   AC A0A504Z9T6.1
#=GS A0A287BP62_PIG/29-204     AC A0A287BP62.1
#=GS A0A6A6KJH7_HEVBR/22-185   AC A0A6A6KJH7.1
#=GS A0A1S3JNS0_LINUN/23-192   AC A0A1S3JNS0.1
#=GS A0A341A8S1_NEOAA/26-201   AC A0A341A8S1.1
#=GS FOLR2_HUMAN/30-205        AC P14207.4
#=GS FOLR2_HUMAN/30-205        DR PDB; 4KN0 A; 30-205;
#=GS FOLR2_HUMAN/30-205        DR PDB; 4KMY A; 30-205;
#=GS FOLR2_HUMAN/30-205        DR PDB; 4KN2 C; 30-205;
#=GS FOLR2_HUMAN/30-205        DR PDB; 4KN2 B; 30-205;
#=GS FOLR2_HUMAN/30-205        DR PDB; 4KN2 A; 30-205;
#=GS FOLR2_HUMAN/30-205        DR PDB; 4KMZ A; 30-205;
#=GS FOLR2_HUMAN/30-205        DR PDB; 4KN1 A; 30-205;
#=GS A0A340XP17_LIPVE/34-209   AC A0A340XP17.1
#=GS A0A6A3KZB3_9STRA/33-184   AC A0A6A3KZB3.1
#=GS A0A267GZF5_9PLAT/45-230   AC A0A267GZF5.1
#=GS A0A2P4X1P8_9STRA/28-179   AC A0A2P4X1P8.1
#=GS A0A2K6T2H0_SAIBB/37-193   AC A0A2K6T2H0.1
#=GS A0A1Z5JHC0_FISSO/84-223   AC A0A1Z5JHC0.1
#=GS K7EIS2_HUMAN/27-183       AC K7EIS2.1
#=GS A0A212DHQ0_CEREH/30-129   AC A0A212DHQ0.1
#=GS A0A091SW45_NESNO/3-129    AC A0A091SW45.1
#=GS A0A251TBJ9_HELAN/46-194   AC A0A251TBJ9.1
#=GS A0A674BA54_SALTR/41-202   AC A0A674BA54.1
#=GS A0A2I3TNA5_PANTR/37-193   AC A0A2I3TNA5.1
#=GS R7VC87_CAPTE/22-180       AC R7VC87.1
#=GS K7EQL9_HUMAN/27-183       AC K7EQL9.9
#=GS A0A2K5ZD61_MANLE/36-211   AC A0A2K5ZD61.1
#=GS A0A4U5V1Y9_COLLU/23-198   AC A0A4U5V1Y9.1
#=GS A0A0E0G967_ORYNI/49-201   AC A0A0E0G967.1
#=GS W5KAU7_ASTMX/41-203       AC W5KAU7.2
#=GS A0A287BB49_PIG/38-220     AC A0A287BB49.1
#=GS A0A4W5PEU6_9TELE/14-175   AC A0A4W5PEU6.1
#=GS A0A2K6KI91_RHIBE/47-222   AC A0A2K6KI91.1
#=GS G1LWD6_AILME/34-202       AC G1LWD6.1
#=GS A0A6A1Q9X1_BALPH/1-98     AC A0A6A1Q9X1.1
#=GS A0A4W4E4W0_ELEEL/26-84    AC A0A4W4E4W0.1
#=GS A0A287AG84_PIG/27-206     AC A0A287AG84.1
#=GS A0A4W2G270_BOBOX/31-192   AC A0A4W2G270.1
#=GS A0A286ZQ37_PIG/38-220     AC A0A286ZQ37.2
#=GS A0A540N296_MALBA/26-188   AC A0A540N296.1
#=GS M3XH66_LATCH/42-190       AC M3XH66.1
#=GS A0A5F9DHK4_RABIT/35-210   AC A0A5F9DHK4.1
#=GS A0A091LQJ6_CARIC/1-98     AC A0A091LQJ6.1
#=GS A0A665U4R1_ECHNA/19-194   AC A0A665U4R1.1
#=GS A0A672Z3E8_9TELE/38-210   AC A0A672Z3E8.1
#=GS A0A2J7QBQ4_9NEOP/1-132    AC A0A2J7QBQ4.1
#=GS A0A484DHJ7_PERFV/31-204   AC A0A484DHJ7.1
#=GS A0A5C6NY39_9TELE/63-222   AC A0A5C6NY39.1
#=GS A0A3Q1EF35_9TELE/26-207   AC A0A3Q1EF35.1
#=GS E9PYD9_MOUSE/34-137       AC E9PYD9.1
#=GS A0A1L8H304_XENLA/26-180   AC A0A1L8H304.1
#=GS A0A3Q3F7P7_9LABR/29-190   AC A0A3Q3F7P7.1
#=GS A0A6G1AT09_CROCR/40-206   AC A0A6G1AT09.1
#=GS A0A2K5JMS7_COLAP/38-220   AC A0A2K5JMS7.1
#=GS A0A665WE88_ECHNA/39-200   AC A0A665WE88.1
#=GS A0A0R3WW82_HYDTA/36-215   AC A0A0R3WW82.1
#=GS A0A0C2MFT1_THEKT/1-145    AC A0A0C2MFT1.1
#=GS A0A1U7XLM8_NICSY/41-192   AC A0A1U7XLM8.1
#=GS A0A4X2LYV8_VOMUR/31-206   AC A0A4X2LYV8.1
#=GS A0A2K5DR67_AOTNA/38-220   AC A0A2K5DR67.1
#=GS A0A663E2H3_AQUCH/34-216   AC A0A663E2H3.1
#=GS G1PDG2_MYOLU/38-220       AC G1PDG2.1
#=GS A0A4W3HFC4_CALMI/98-273   AC A0A4W3HFC4.1
#=GS W2QZC1_PHYPN/33-184       AC W2QZC1.1
#=GS I3LDJ1_PIG/29-169         AC I3LDJ1.1
#=GS A0A498M645_LABRO/27-199   AC A0A498M645.1
#=GS H0UUP4_CAVPO/27-198       AC H0UUP4.2
#=GS A0A3Q0FY17_ALLSI/57-232   AC A0A3Q0FY17.1
#=GS A0A2U3ZAQ4_ODORO/34-209   AC A0A2U3ZAQ4.1
#=GS A0A5F9DHS5_RABIT/38-220   AC A0A5F9DHS5.1
#=GS G3VZ16_SARHA/6-166        AC G3VZ16.1
#=GS RTBDN_ICTTR/27-208        AC Q5DRQ5.1
#=GS A0A091QNU9_LEPDC/31-206   AC A0A091QNU9.1
#=GS G3RFV1_GORGO/26-208       AC G3RFV1.2
#=GS A0A2U9CIJ6_SCOMX/57-218   AC A0A2U9CIJ6.1
#=GS A0A4X2K0N4_VOMUR/33-194   AC A0A4X2K0N4.1
#=GS A0A1S3CUH7_DIACI/30-204   AC A0A1S3CUH7.1
#=GS A0A151MKL1_ALLMI/26-189   AC A0A151MKL1.1
#=GS K1PDZ2_CRAGI/29-160       AC K1PDZ2.1
#=GS A0A2R9BIN5_PANPA/1-108    AC A0A2R9BIN5.1
#=GS H2NEK1_PONAB/36-211       AC H2NEK1.1
#=GS A0A4W6D235_LATCA/37-210   AC A0A4W6D235.1
#=GS A0A5J5DKQ4_9PERO/56-157   AC A0A5J5DKQ4.1
#=GS A0A3P8ZWH6_ESOLU/23-198   AC A0A3P8ZWH6.1
#=GS A0A176W7V7_MARPO/192-317  AC A0A176W7V7.1
#=GS A0A091TJH7_PHALP/21-188   AC A0A091TJH7.1
#=GS A0A0R4IXN7_DANRE/28-203   AC A0A0R4IXN7.1
#=GS A0A2R9B8A1_PANPA/30-205   AC A0A2R9B8A1.1
#=GS A0A067EQR5_CITSI/29-192   AC A0A067EQR5.1
#=GS A0A2T7PMZ6_POMCA/44-145   AC A0A2T7PMZ6.1
#=GS A0A068V9B7_COFCA/53-201   AC A0A068V9B7.1
#=GS A0A5J5DKQ4_9PERO/147-209  AC A0A5J5DKQ4.1
#=GS A0A444UDU9_ACIRT/21-186   AC A0A444UDU9.1
#=GS G1SDN5_RABIT/44-205       AC G1SDN5.3
#=GS L8I9M5_9CETA/27-208       AC L8I9M5.1
#=GS A0A672TVE2_STRHB/21-188   AC A0A672TVE2.1
#=GS A0A4W2E4I1_BOBOX/35-169   AC A0A4W2E4I1.1
#=GS A0A556VW12_BAGYA/34-101   AC A0A556VW12.1
#=GS A0A2K5YE35_MANLE/47-206   AC A0A2K5YE35.1
#=GS A0A673ST91_SURSU/38-220   AC A0A673ST91.1
#=GS A0A484GGG7_SOUCH/38-220   AC A0A484GGG7.1
#=GS A0A5N4CLU7_CAMDR/167-242  AC A0A5N4CLU7.1
#=GS E1BGX8_BOVIN/44-206       AC E1BGX8.2
#=GS A0A1D5Q8N0_MACMU/26-208   AC A0A1D5Q8N0.1
#=GS A0A0S3SQM8_PHAAN/36-196   AC A0A0S3SQM8.1
#=GS A0A2I2YC44_GORGO/47-201   AC A0A2I2YC44.1
#=GS A0A2K6F2B6_PROCO/36-211   AC A0A2K6F2B6.1
#=GS A0A5F9DTI0_RABIT/38-220   AC A0A5F9DTI0.1
#=GS A0A087X2K1_POEFO/53-214   AC A0A087X2K1.1
#=GS A0A3Q3LHK4_9TELE/33-208   AC A0A3Q3LHK4.1
#=GS A0A2K5HJY9_COLAP/33-208   AC A0A2K5HJY9.1
#=GS H0VLN7_CAVPO/34-160       AC H0VLN7.2
#=GS A0A1B0GQW7_MOUSE/29-87    AC A0A1B0GQW7.1
#=GS A0A0D3E146_BRAOL/221-381  AC A0A0D3E146.1
#=GS A0A674NS56_TAKRU/28-194   AC A0A674NS56.1
#=GS A0A444TX39_ACIRT/15-127   AC A0A444TX39.1
#=GS A7RPJ5_NEMVE/32-187       AC A7RPJ5.1
#=GS F7BP69_MACMU/1-174        AC F7BP69.3
#=GS A0A4D9B3N1_SALSN/50-198   AC A0A4D9B3N1.1
#=GS I1IB47_BRADI/46-199       AC I1IB47.1
#=GS A0A3Q7WXT0_URSAR/38-220   AC A0A3Q7WXT0.1
#=GS A0A1S3V654_VIGRR/38-198   AC A0A1S3V654.1
#=GS A0A5E4AAD3_MARMO/52-119   AC A0A5E4AAD3.1
#=GS E1BJL8_BOVIN/30-205       AC E1BJL8.2
#=GS A0A3Q2LEL7_HORSE/30-205   AC A0A3Q2LEL7.1
#=GS F6UZU3_CALJA/38-220       AC F6UZU3.3
#=GS A0A6Q2XZK8_ESOLU/29-178   AC A0A6Q2XZK8.1
#=GS A0A453NZ04_AEGTS/34-187   AC A0A453NZ04.1
#=GS A0A2K5LBN5_CERAT/3-164    AC A0A2K5LBN5.1
#=GS A0A091VAP1_NIPNI/31-206   AC A0A091VAP1.1
#=GS A0A315VA90_GAMAF/87-257   AC A0A315VA90.1
#=GS HIPL1_HUMAN/22-183        AC Q96JK4.2
#=GS A0A4X2KLC4_VOMUR/42-204   AC A0A4X2KLC4.1
#=GS A0A091UUT4_PHORB/3-129    AC A0A091UUT4.1
#=GS A0A3Q0FUI1_ALLSI/129-304  AC A0A3Q0FUI1.1
#=GS A0A671XGL2_SPAAU/36-197   AC A0A671XGL2.1
#=GS A0A2K6V1Q0_SAIBB/2-158    AC A0A2K6V1Q0.1
#=GS A0A093IA02_STRCA/3-129    AC A0A093IA02.1
#=GS L5M1T1_MYODS/36-211       AC L5M1T1.1
#=GS A0A2K6L4U9_RHIBE/37-193   AC A0A2K6L4U9.1
#=GS L5L0C6_PTEAL/26-177       AC L5L0C6.1
#=GS W5PJZ5_SHEEP/39-221       AC W5PJZ5.1
#=GS A0A2K5U066_MACFA/36-211   AC A0A2K5U066.1
#=GS M3YFP6_MUSPF/31-206       AC M3YFP6.1
#=GS RTBDN_MOUSE/27-203        AC Q8QZY4.1
#=GS A0A0D9QVZ6_CHLSB/1-148    AC A0A0D9QVZ6.1
#=GS E1BK45_BOVIN/27-177       AC E1BK45.3
#=GS A0A3Q0FTQ0_ALLSI/36-211   AC A0A3Q0FTQ0.1
#=GS E2RTK1_CANLF/26-171       AC E2RTK1.2
#=GS A0A5F8GQE5_MONDO/37-213   AC A0A5F8GQE5.1
#=GS A0A6J3RUV6_TURTR/30-205   AC A0A6J3RUV6.1
#=GS A0A093GNC2_DRYPU/21-188   AC A0A093GNC2.1
#=GS A0A3Q4I5G8_NEOBR/5-166    AC A0A3Q4I5G8.1
#=GS A0A2R9CP43_PANPA/36-211   AC A0A2R9CP43.1
#=GS A0A2Y9G8Q4_NEOSC/27-188   AC A0A2Y9G8Q4.1
#=GS B7PRB5_IXOSC/1-110        AC B7PRB5.1
#=GS A0A452DS15_CAPHI/31-192   AC A0A452DS15.1
#=GS A0A672FVK0_SALFA/23-201   AC A0A672FVK0.1
#=GS A0A2A9MBR2_9APIC/75-244   AC A0A2A9MBR2.1
#=GS A0A1S3HG53_LINUN/34-210   AC A0A1S3HG53.1
#=GS W5PLT6_SHEEP/47-204       AC W5PLT6.1
#=GS A0A452EP48_CAPHI/44-206   AC A0A452EP48.1
#=GS F7AZK3_MACMU/47-206       AC F7AZK3.2
#=GS A0A3M6VV48_9STRA/5-113    AC A0A3M6VV48.1
#=GS A0A2K5Y4M3_MANLE/38-220   AC A0A2K5Y4M3.1
#=GS L8H8F4_ACACA/30-211       AC L8H8F4.1
#=GS A0A162DD41_9CRUS/41-214   AC A0A162DD41.1
#=GS A0A3Q1CDN9_AMPOC/47-209   AC A0A3Q1CDN9.1
#=GS A0A4X2LYN8_VOMUR/53-141   AC A0A4X2LYN8.1
#=GS A0A4D9EL97_9SAUR/63-225   AC A0A4D9EL97.1
#=GS I3JZH8_ORENI/33-194       AC I3JZH8.2
#=GS A0A0D3F724_9ORYZ/49-201   AC A0A0D3F724.1
#=GS A0A672YCX5_9TELE/32-193   AC A0A672YCX5.1
#=GS H0X6F3_OTOGA/27-208       AC H0X6F3.1
#=GS F7A0H6_HORSE/30-205       AC F7A0H6.1
#=GS A0A2K6FMI0_PROCO/39-221   AC A0A2K6FMI0.1
#=GS A0A1Y1HPQ5_KLENI/12-158   AC A0A1Y1HPQ5.1
#=GS L9LAB8_TUPCH/30-205       AC L9LAB8.1
#=GS A0A0A0AHT2_CHAVO/21-188   AC A0A0A0AHT2.1
#=GS A0A6J3RT23_TURTR/77-252   AC A0A6J3RT23.1
#=GS B6AIB9_CRYMR/25-190       AC B6AIB9.1
#=GS E4XH70_OIKDI/137-250      AC E4XH70.1
#=GS A0A2K6R864_RHIRO/36-211   AC A0A2K6R864.1
#=GS A0A6A4V0R3_AMPAM/49-221   AC A0A6A4V0R3.1
#=GS A0A218UGW8_9PASE/82-257   AC A0A218UGW8.1
#=GS A0A5B8MJJ5_9CHLO/50-213   AC A0A5B8MJJ5.1
#=GS A0A5N5JS21_PANHP/110-276  AC A0A5N5JS21.1
#=GS A0A099ZIV6_TINGU/3-165    AC A0A099ZIV6.1
#=GS A0A2I3SSW9_PANTR/36-206   AC A0A2I3SSW9.1
#=GS HIPL2_ARATH/27-181        AC Q94F08.2
#=GS A0A665WJZ7_ECHNA/34-196   AC A0A665WJZ7.1
#=GS G1SMW7_RABIT/38-220       AC G1SMW7.2
#=GS A0A3Q2W5I8_HAPBU/33-194   AC A0A3Q2W5I8.1
#=GS A0A1S3EVX4_DIPOR/4-107    AC A0A1S3EVX4.1
#=GS A0A341ACH2_NEOAA/30-205   AC A0A341ACH2.1
#=GS A0A3Q1EN57_9TELE/38-199   AC A0A3Q1EN57.1
#=GS A0A091TII6_PELCR/21-188   AC A0A091TII6.1
#=GS A0A2Y9QIY5_DELLE/38-220   AC A0A2Y9QIY5.1
#=GS A0A5C6PGF8_9TELE/23-160   AC A0A5C6PGF8.1
#=GS A0A443SE65_9ACAR/1-154    AC A0A443SE65.1
#=GS F5H2G8_HUMAN/34-74        AC F5H2G8.1
#=GS A0A2K5RQN5_CEBCA/34-104   AC A0A2K5RQN5.1
#=GS A0A3Q7V2L7_VULVU/38-220   AC A0A3Q7V2L7.1
#=GS A0A4W3H3K3_CALMI/23-188   AC A0A4W3H3K3.1
#=GS G5C3X2_HETGA/50-179       AC G5C3X2.1
#=GS A0A4W6D1Q6_LATCA/14-191   AC A0A4W6D1Q6.1
#=GS G3TGC7_LOXAF/59-204       AC G3TGC7.1
#=GS H2ZRN0_LATCH/30-204       AC H2ZRN0.1
#=GS F7DI80_HORSE/31-206       AC F7DI80.3
#=GS A0A093NVU4_PYGAD/21-188   AC A0A093NVU4.1
#=GS A0A4D8Z232_SALSN/47-195   AC A0A4D8Z232.1
#=GS A0A2K5LBK1_CERAT/36-211   AC A0A2K5LBK1.1
#=GS A0A4W5K782_9TELE/33-194   AC A0A4W5K782.1
#=GS A0A5D2U1J6_GOSMU/43-205   AC A0A5D2U1J6.1
#=GS A0A369RWN8_9METZ/21-149   AC A0A369RWN8.1
#=GS H0WLX7_OTOGA/33-195       AC H0WLX7.1
#=GS A0A485NCM7_LYNPA/38-220   AC A0A485NCM7.1
#=GS A0A2Y9F0R6_PHYMC/30-205   AC A0A2Y9F0R6.1
#=GS A0A3N0XJ60_ANAGA/67-236   AC A0A3N0XJ60.1
#=GS H0YWX7_TAEGU/35-217       AC H0YWX7.2
#=GS G5BYW7_HETGA/29-211       AC G5BYW7.1
#=GS A0A446WCW4_TRITD/44-197   AC A0A446WCW4.1
#=GS K7F2U8_PELSI/26-201       AC K7F2U8.1
#=GS A0A1L8G145_XENLA/52-210   AC A0A1L8G145.1
#=GS A0A2Y9Q8H2_DELLE/38-220   AC A0A2Y9Q8H2.1
#=GS A0A452CM71_BALAS/38-220   AC A0A452CM71.1
#=GS A0A093DZM9_TAUER/7-165    AC A0A093DZM9.1
#=GS A0A093PXJ0_PHACA/3-129    AC A0A093PXJ0.1
#=GS F6TQQ8_MONDO/48-210       AC F6TQQ8.2
#=GS A0A0P7VCE9_SCLFO/34-194   AC A0A0P7VCE9.1
#=GS A0A2K6PQ69_RHIRO/38-220   AC A0A2K6PQ69.1
#=GS RBP_CHICK/21-188          AC P02752.2
#=GS RBP_CHICK/21-188          DR PDB; 6HCE A; 21-188;
#=GS E0VVL1_PEDHC/33-206       AC E0VVL1.1
#=GS L8IP67_9CETA/1-102        AC L8IP67.1
#=GS A0A1S3HG59_LINUN/1-143    AC A0A1S3HG59.1
#=GS A0A5F8GC71_MONDO/29-205   AC A0A5F8GC71.1
#=GS A0A2U3WI08_ODORO/44-206   AC A0A2U3WI08.1
#=GS A8MS02_ARATH/40-200       AC A8MS02.2
#=GS HIPL1_MOUSE/28-189        AC Q14DK5.1
#=GS A0A5E4CXK5_MARMO/66-227   AC A0A5E4CXK5.1
#=GS R0FGV8_9BRAS/37-198       AC R0FGV8.1
#=GS A0A401NPK4_SCYTO/49-197   AC A0A401NPK4.1
#=GS A0A1A6G263_NEOLE/38-213   AC A0A1A6G263.1
#=GS A0A4W2EJA8_BOBOX/44-206   AC A0A4W2EJA8.1
#=GS A0A3Q1HKH9_ANATE/23-198   AC A0A3Q1HKH9.1
#=GS A0A401PCQ3_SCYTO/23-189   AC A0A401PCQ3.1
#=GS A0A093DHM7_TAUER/21-187   AC A0A093DHM7.1
#=GS M3Y5G6_MUSPF/38-220       AC M3Y5G6.1
#=GS A0A3M6T9Y8_9CNID/26-192   AC A0A3M6T9Y8.1
#=GS A0A6A6M4H8_HEVBR/97-260   AC A0A6A6M4H8.1
#=GS A0A3Q2D842_CYPVA/23-198   AC A0A3Q2D842.1
#=GS A0A0L8HYB6_OCTBM/30-200   AC A0A0L8HYB6.1
#=GS A0A212DIL2_CEREH/35-210   AC A0A212DIL2.1
#=GS A0A340X6T2_LIPVE/31-192   AC A0A340X6T2.1
#=GS Q69L70_ORYSJ/49-201       AC Q69L70.1
#=GS G1S5Y4_NOMLE/36-211       AC G1S5Y4.2
#=GS A0A2K5DWK8_AOTNA/26-208   AC A0A2K5DWK8.1
#=GS A0A4W2CFZ7_BOBOX/35-210   AC A0A4W2CFZ7.1
#=GS A0A2K5DRF2_AOTNA/38-220   AC A0A2K5DRF2.1
#=GS A0A669CZU7_ORENI/30-201   AC A0A669CZU7.1
#=GS A0A2K5YTW5_MANLE/26-208   AC A0A2K5YTW5.1
#=GS A0A3Q1EN42_9TELE/38-199   AC A0A3Q1EN42.1
#=GS HIPL2_HUMAN/44-206        AC Q6UWX4.1
#=GS K7FZF8_PELSI/19-156       AC K7FZF8.1
#=GS H0WV59_OTOGA/38-220       AC H0WV59.1
#=GS A0A1S3EZ02_DIPOR/35-210   AC A0A1S3EZ02.1
#=GS G3NYE5_GASAC/30-205       AC G3NYE5.1
#=GS A0A2I4BN34_9TELE/30-191   AC A0A2I4BN34.1
#=GS A0A384DET5_URSMA/31-206   AC A0A384DET5.1
#=GS A0A287U713_HORVV/41-194   AC A0A287U713.1
#=GS A0A093G981_DRYPU/31-160   AC A0A093G981.1
#=GS A0A3R7NL63_9STRA/48-199   AC A0A3R7NL63.1
#=GS R4GDF8_ANOCA/7-121        AC R4GDF8.1
#=GS A0A210R2X3_MIZYE/34-171   AC A0A210R2X3.1
#=GS A0A3S2LM63_ORYJA/140-300  AC A0A3S2LM63.1
#=GS A0A2K5YHP2_MANLE/20-181   AC A0A2K5YHP2.1
#=GS A0A667YJL6_9TELE/35-197   AC A0A667YJL6.1
#=GS A0A2K5C4C4_AOTNA/48-206   AC A0A2K5C4C4.1
#=GS W5MM21_LEPOC/28-203       AC W5MM21.1
#=GS A0A4W4G2J0_ELEEL/61-222   AC A0A4W4G2J0.1
#=GS A0A3M7S946_BRAPC/46-193   AC A0A3M7S946.1
#=GS A0A673ZDI2_SALTR/23-198   AC A0A673ZDI2.1
#=GS A0A662YWF7_ACIRT/36-238   AC A0A662YWF7.1
#=GS A0A1Z5JHA3_FISSO/84-222   AC A0A1Z5JHA3.1
#=GS A0A3M0KY50_HIRRU/30-149   AC A0A3M0KY50.1
#=GS F1NGW6_CHICK/35-217       AC F1NGW6.3
#=GS M4A9K7_XIPMA/23-198       AC M4A9K7.1
#=GS A0A671WTW8_SPAAU/25-187   AC A0A671WTW8.1
#=GS A0A199VWI2_ANACO/42-190   AC A0A199VWI2.1
#=GS A0A091MPS6_CARIC/21-188   AC A0A091MPS6.1
#=GS A0A445IMQ3_GLYSO/40-203   AC A0A445IMQ3.1
#=GS G3P081_GASAC/7-132        AC G3P081.1
#=GS A0A5N4DNM4_CAMDR/34-209   AC A0A5N4DNM4.1
#=GS A0A4D9DXW4_9SAUR/26-201   AC A0A4D9DXW4.1
#=GS A0A140T8H8_CHICK/21-188   AC A0A140T8H8.1
#=GS A0A5F9DVS8_RABIT/30-205   AC A0A5F9DVS8.1
#=GS A0A1S3JEC5_LINUN/34-210   AC A0A1S3JEC5.1
#=GS A0A0D2MI20_9CHLO/46-214   AC A0A0D2MI20.1
#=GS M4E4P6_BRARP/40-187       AC M4E4P6.1
#=GS A0A662WDS6_9STRA/6-111    AC A0A662WDS6.1
#=GS A0A2K5TT47_MACFA/59-198   AC A0A2K5TT47.1
#=GS I3M4T2_ICTTR/29-204       AC I3M4T2.1
#=GS F7CL75_MONDO/29-205       AC F7CL75.2
#=GS A0A0K9PSK5_ZOSMR/20-185   AC A0A0K9PSK5.1
#=GS A0A484GSV4_SOUCH/30-205   AC A0A484GSV4.1
#=GS G7I8R3_MEDTR/42-203       AC G7I8R3.2
#=GS A0A3M6T6G4_9CNID/32-211   AC A0A3M6T6G4.1
#=GS A0A2K5W2J6_MACFA/47-206   AC A0A2K5W2J6.1
#=GS A0A4Z2GYD1_9TELE/4-162    AC A0A4Z2GYD1.1
#=GS A0A485N996_LYNPA/26-166   AC A0A485N996.1
#=GS A0A6A5DYY2_PERFL/35-196   AC A0A6A5DYY2.1
#=GS H2Q4C5_PANTR/30-205       AC H2Q4C5.1
#=GS A0A6A5BHR1_NAEFO/46-156   AC A0A6A5BHR1.1
#=GS A0A1Y3BTT4_EURMA/1-171    AC A0A1Y3BTT4.1
#=GS A0A2I0TRV6_LIMLA/21-80    AC A0A2I0TRV6.1
#=GS A0A3M0JCQ9_HIRRU/26-187   AC A0A3M0JCQ9.1
#=GS A0A3P9PHY5_POERE/26-201   AC A0A3P9PHY5.1
#=GS A0A4W6DKM2_LATCA/22-184   AC A0A4W6DKM2.1
#=GS A0A2Y9QJG0_DELLE/38-220   AC A0A2Y9QJG0.1
#=GS Q9XSH1_PIG/28-203         AC Q9XSH1.1
#=GS A0A3Q3LNQ8_9TELE/28-201   AC A0A3Q3LNQ8.1
#=GS C3Y181_BRAFL/80-227       AC C3Y181.1
#=GS K7ENA4_HUMAN/27-174       AC K7ENA4.1
#=GS A0A2K5Y2E7_MANLE/59-198   AC A0A2K5Y2E7.1
#=GS A0A3B6PLG0_WHEAT/54-207   AC A0A3B6PLG0.1
#=GS A0A2K5F410_AOTNA/59-215   AC A0A2K5F410.1
#=GS A0A6D2HJ04_9BRAS/38-176   AC A0A6D2HJ04.1
#=GS A0A553R0H6_9TELE/38-91    AC A0A553R0H6.1
#=GS A0A671XUR4_SPAAU/29-201   AC A0A671XUR4.1
#=GS G3QS30_GORGO/36-211       AC G3QS30.1
#=GS A0A2U9CK68_SCOMX/34-196   AC A0A2U9CK68.1
#=GS M3XZP6_MUSPF/27-177       AC M3XZP6.1
#=GS A0A093BMD9_9AVES/26-201   AC A0A093BMD9.1
#=GS B3RXI9_TRIAD/32-204       AC B3RXI9.1
#=GS G1NKP2_MELGA/1-102        AC G1NKP2.1
#=GS A0A5F9DGR9_RABIT/47-157   AC A0A5F9DGR9.1
#=GS A0A671XWY8_SPAAU/29-201   AC A0A671XWY8.1
#=GS A0A2J6KPQ2_LACSA/72-220   AC A0A2J6KPQ2.1
#=GS F7FPZ6_MONDO/33-194       AC F7FPZ6.3
#=GS A0A1S3HHT0_LINUN/34-210   AC A0A1S3HHT0.1
#=GS A0A444XKH3_ARAHY/1-94     AC A0A444XKH3.1
#=GS A0A673UL86_SURSU/31-206   AC A0A673UL86.1
#=GS D3ZGL3_RAT/38-220         AC D3ZGL3.1
#=GS T0PZY6_SAPDV/6-156        AC T0PZY6.1
#=GS A0A3Q3NPD7_9LABR/23-198   AC A0A3Q3NPD7.1
#=GS A0A2K6BUM7_MACNE/59-215   AC A0A2K6BUM7.1
#=GS A0A1D1UKL7_RAMVA/25-165   AC A0A1D1UKL7.1
#=GS S9WKJ6_CAMFR/38-220       AC S9WKJ6.1
#=GS A7RN66_NEMVE/1-169        AC A7RN66.1
#=GS A0A091KSW8_9GRUI/3-129    AC A0A091KSW8.1
#=GS F6R036_CALJA/26-208       AC F6R036.2
#=GS V3ZYM9_LOTGI/31-204       AC V3ZYM9.1
#=GS A0A3Q0H7L2_ALLSI/429-591  AC A0A3Q0H7L2.1
#=GS I3M939_ICTTR/43-205       AC I3M939.2
#=GS A0A2K6RRY9_RHIRO/22-183   AC A0A2K6RRY9.1
#=GS A0A2P4SGP5_BAMTH/32-207   AC A0A2P4SGP5.1
#=GS A0A2K5J324_COLAP/59-198   AC A0A2K5J324.1
#=GS A0A4U5VVN7_COLLU/28-210   AC A0A4U5VVN7.1
#=GS C1MHV6_MICPC/49-171       AC C1MHV6.1
#=GS A0A0R3T8X3_RODNA/1-179    AC A0A0R3T8X3.1
#=GS A0A2B4SCE1_STYPI/23-165   AC A0A2B4SCE1.1
#=GS A0A2K6T2N3_SAIBB/59-195   AC A0A2K6T2N3.1
#=GS K7E4M5_MONDO/139-265      AC K7E4M5.1
#=GS W9RZ38_9ROSA/53-202       AC W9RZ38.1
#=GS A0A3B3II88_ORYLA/35-195   AC A0A3B3II88.1
#=GS A0A2K6KI84_RHIBE/47-261   AC A0A2K6KI84.1
#=GS A0A433TG37_ELYCH/50-178   AC A0A433TG37.1
#=GS A0A4U6WBC4_SETVI/45-198   AC A0A4U6WBC4.1
#=GS B5XAT1_SALSA/23-198       AC B5XAT1.1
#=GS A0A2I4C0I7_9TELE/50-212   AC A0A2I4C0I7.1
#=GS A0A3Q4H3Z1_NEOBR/28-129   AC A0A3Q4H3Z1.1
#=GS A0A5N4DP06_CAMDR/64-245   AC A0A5N4DP06.1
#=GS A0A3Q1M762_BOVIN/35-169   AC A0A3Q1M762.1
#=GS A0A091VAB3_NIPNI/21-188   AC A0A091VAB3.1
#=GS A0A674HW14_TAEGU/35-217   AC A0A674HW14.1
#=GS A0A5F4W1C1_CALJA/24-197   AC A0A5F4W1C1.1
#=GS A0A0P7TVM8_SCLFO/49-211   AC A0A0P7TVM8.1
#=GS A0A267DD81_9PLAT/45-189   AC A0A267DD81.1
#=GS A0A3S2P8D6_ORYJA/74-250   AC A0A3S2P8D6.1
#=GS D0NJK0_PHYIT/1-136        AC D0NJK0.1
#=GS T0NSP3_CAMFR/258-416      AC T0NSP3.1
#=GS A0A1S3JP30_LINUN/19-188   AC A0A1S3JP30.1
#=GS G3QMX1_GORGO/36-211       AC G3QMX1.2
#=GS A0A151PJC7_ALLMI/26-201   AC A0A151PJC7.1
#=GS A0A2K6MAB0_RHIBE/36-211   AC A0A2K6MAB0.1
#=GS M0RS22_MUSAM/44-195       AC M0RS22.1
#=GS A0A6A3CZQ0_HIBSY/42-205   AC A0A6A3CZQ0.1
#=GS A0A3Q7WCW2_URSAR/27-188   AC A0A3Q7WCW2.1
#=GS A0A2I0AFQ7_9ASPA/44-195   AC A0A2I0AFQ7.1
#=GS A0A445F9J6_GLYSO/74-235   AC A0A445F9J6.1
#=GS V7BGJ2_PHAVU/38-199       AC V7BGJ2.1
#=GS A0A2K6BV46_MACNE/38-220   AC A0A2K6BV46.1
#=GS G3TWH6_LOXAF/35-210       AC G3TWH6.1
#=GS C3YX07_BRAFL/83-216       AC C3YX07.1
#=GS A0A669BX27_ORENI/25-186   AC A0A669BX27.1
#=GS A0A2K5Q8K1_CEBCA/59-215   AC A0A2K5Q8K1.1
#=GS A0A2G8KPA3_STIJA/48-220   AC A0A2G8KPA3.1
#=GS A0A4W4HDL1_ELEEL/34-179   AC A0A4W4HDL1.1
#=GS A0A1S3SZ67_SALSA/33-194   AC A0A1S3SZ67.1
#=GS A0A452HZX8_9SAUR/3-161    AC A0A452HZX8.1
#=GS A0A5N5SPB3_9CRUS/39-224   AC A0A5N5SPB3.1
#=GS S9WE90_CAMFR/153-365      AC S9WE90.1
#=GS I3JN61_ORENI/28-209       AC I3JN61.1
#=GS A0A087XRZ0_POEFO/26-204   AC A0A087XRZ0.2
#=GS A0A384DES7_URSMA/30-205   AC A0A384DES7.1
#=GS A0A091P1X1_HALAL/31-206   AC A0A091P1X1.1
#=GS A0A3Q2D8Y1_CYPVA/29-204   AC A0A3Q2D8Y1.1
#=GS A0A1S3S497_SALSA/29-207   AC A0A1S3S497.1
#=GS A0A151PFV0_ALLMI/507-682  AC A0A151PFV0.1
#=GS H2NEK0_PONAB/36-211       AC H2NEK0.2
#=GS A0A091DG56_FUKDA/12-187   AC A0A091DG56.1
#=GS A0A672YFJ7_9TELE/35-196   AC A0A672YFJ7.1
#=GS A0A199VVS9_ANACO/42-190   AC A0A199VVS9.1
#=GS A0A2K5LBM4_CERAT/47-222   AC A0A2K5LBM4.1
#=GS A0A2I2ZAL4_GORGO/3-164    AC A0A2I2ZAL4.1
#=GS A0A3P9NEK5_POERE/35-196   AC A0A3P9NEK5.1
#=GS F7H8H0_MACMU/22-183       AC F7H8H0.3
#=GS A0A3P8WD03_CYNSE/28-209   AC A0A3P8WD03.1
#=GS A0A3Q1BQR2_AMPOC/37-210   AC A0A3Q1BQR2.1
#=GS F6U317_XENTR/38-218       AC F6U317.3
#=GS A0A2K5HD22_COLAP/36-211   AC A0A2K5HD22.1
#=GS A0A2K5XKY8_MANLE/30-205   AC A0A2K5XKY8.1
#=GS A0A401Q2K9_SCYTO/37-207   AC A0A401Q2K9.1
#=GS A0A3Q1DFP0_AMPOC/37-210   AC A0A3Q1DFP0.1
#=GS A0A3Q7TM33_VULVU/30-205   AC A0A3Q7TM33.1
#=GS A0A087V3X1_BALRE/29-204   AC A0A087V3X1.1
#=GS G1R639_NOMLE/26-208       AC G1R639.2
#=GS A0A4W5P166_9TELE/26-187   AC A0A4W5P166.1
#=GS A0A093FXR0_DRYPU/29-178   AC A0A093FXR0.1
#=GS M4F6A3_BRARP/38-198       AC M4F6A3.1
#=GS A0A4W4E880_ELEEL/33-208   AC A0A4W4E880.1
#=GS F6V730_CALJA/36-211       AC F6V730.1
#=GS A0A672FTB2_SALFA/23-189   AC A0A672FTB2.1
#=GS A0A671YMI8_SPAAU/28-209   AC A0A671YMI8.1
#=GS A0A3Q2DAP0_CYPVA/38-210   AC A0A3Q2DAP0.1
#=GS J9ITT8_9SPIT/57-224       AC J9ITT8.1
#=GS A0A2K5CPZ0_AOTNA/34-104   AC A0A2K5CPZ0.1
#=GS A0A3B6PKA1_WHEAT/44-197   AC A0A3B6PKA1.1
#=GS A0A5G2RMJ1_PIG/29-204     AC A0A5G2RMJ1.1
#=GS A0A674P3H1_TAKRU/99-274   AC A0A674P3H1.1
#=GS A7REX3_NEMVE/16-184       AC A7REX3.1
#=GS A0A091LR10_9GRUI/31-206   AC A0A091LR10.1
#=GS B7PZS9_IXOSC/69-157       AC B7PZS9.1
#=GS A0A2T7PWW2_POMCA/308-444  AC A0A2T7PWW2.1
#=GS B3RPR0_TRIAD/63-205       AC B3RPR0.1
#=GS A0A2U3VUE8_ODORO/27-183   AC A0A2U3VUE8.1
#=GS K7F2T6_PELSI/31-206       AC K7F2T6.1
#=GS JUNO_HUMAN/26-208         AC A6ND01.3
#=GS JUNO_HUMAN/26-208         DR PDB; 5F4Q D; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5JKB A; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5JKA A; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5JKB B; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5JKC B; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5F4Q C; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5JKA B; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5F4Q A; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5F4E B; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5JKE B; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5JKD B; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5JKE D; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5JKB D; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5F4Q B; 26-208;
#=GS JUNO_HUMAN/26-208         DR PDB; 5JKB C; 26-208;
#=GS D7M5H4_ARALL/37-198       AC D7M5H4.1
#=GS A0A5F4C041_CANLF/38-213   AC A0A5F4C041.1
#=GS A0A2G2W863_CAPBA/38-189   AC A0A2G2W863.1
#=GS A0A067EZ42_CITSI/29-149   AC A0A067EZ42.1
#=GS H2ML72_ORYLA/28-204       AC H2ML72.2
#=GS A0A151U4S3_CAJCA/26-187   AC A0A151U4S3.1
#=GS A0A4W6F0T6_LATCA/37-192   AC A0A4W6F0T6.1
#=GS A0A665U4T6_ECHNA/23-198   AC A0A665U4T6.1
#=GS A0A2K5DR85_AOTNA/38-220   AC A0A2K5DR85.1
#=GS L9LDL7_TUPCH/33-165       AC L9LDL7.1
#=GS A0A663ET56_AQUCH/26-201   AC A0A663ET56.1
#=GS A0A369SFE9_9METZ/63-205   AC A0A369SFE9.1
#=GS A0A2Y9M495_DELLE/54-204   AC A0A2Y9M495.1
#=GS L5K5G6_PTEAL/61-206       AC L5K5G6.1
#=GS A0A5J9WKI9_9POAL/74-258   AC A0A5J9WKI9.1
#=GS A0A2P6N040_9EUKA/20-164   AC A0A2P6N040.1
#=GS A0A0D9YUD5_9ORYZ/49-201   AC A0A0D9YUD5.1
#=GS A0A3L8SF87_CHLGU/3-123    AC A0A3L8SF87.1
#=GS A0A3P8WT43_CYNSE/20-192   AC A0A3P8WT43.1
#=GS A0A1V4JXD0_PATFA/88-255   AC A0A1V4JXD0.1
#=GS A0A1S3JE31_LINUN/91-267   AC A0A1S3JE31.1
#=GS A0A2I3N2D9_PAPAN/20-181   AC A0A2I3N2D9.1
#=GS A0A2I3RMJ5_PANTR/38-220   AC A0A2I3RMJ5.1
#=GS A0A665U4N3_ECHNA/23-198   AC A0A665U4N3.1
#=GS A0A6I8QKJ4_XENTR/39-214   AC A0A6I8QKJ4.1
#=GS A0A673U5S6_SURSU/27-194   AC A0A673U5S6.1
#=GS A0A2K5RJR2_CEBCA/29-204   AC A0A2K5RJR2.1
#=GS A0A453NZU6_AEGTS/44-197   AC A0A453NZU6.1
#=GS A0A1S3XZ96_TOBAC/41-192   AC A0A1S3XZ96.1
#=GS A0A2K5UR19_MACFA/36-211   AC A0A2K5UR19.1
#=GS A0A091QWX7_MERNU/21-188   AC A0A091QWX7.1
#=GS A0A3P8VNG7_CYNSE/51-213   AC A0A3P8VNG7.1
#=GS A0A2K6BC26_MACNE/36-211   AC A0A2K6BC26.1
#=GS A0A093G5D5_DRYPU/3-164    AC A0A093G5D5.1
#=GS A0A4W2DTQ4_BOBOX/38-220   AC A0A4W2DTQ4.1
#=GS U6KVH5_EIMTE/24-185       AC U6KVH5.1
#=GS Q1LVK0_DANRE/3-164        AC Q1LVK0.3
#=GS A0A2R8MPG7_CALJA/34-209   AC A0A2R8MPG7.2
#=GS A0A2K5XKZ3_MANLE/47-110   AC A0A2K5XKZ3.1
#=GS J3KQP4_HUMAN/47-201       AC J3KQP4.1
#=GS A0A091SJ60_PELCR/3-165    AC A0A091SJ60.1
#=GS A0A6I8QB13_XENTR/48-210   AC A0A6I8QB13.1
#=GS A0A445IMV4_GLYSO/40-203   AC A0A445IMV4.1
#=GS A0A498L7K2_LABRO/30-205   AC A0A498L7K2.1
#=GS A0A3P9QB93_POERE/40-210   AC A0A3P9QB93.1
#=GS G1PPC1_MYOLU/31-206       AC G1PPC1.1
#=GS A0A093ESU2_GAVST/31-206   AC A0A093ESU2.1
#=GS A0A6A3KTU1_9STRA/33-184   AC A0A6A3KTU1.1
#=GS Q5DDB9_SCHJA/40-212       AC Q5DDB9.1
#=GS A0A3P8Y848_ESOLU/32-181   AC A0A3P8Y848.2
#=GS A0A4X2M6Z2_VOMUR/33-171   AC A0A4X2M6Z2.1
#=GS A0A368UKD6_SOYBN/40-203   AC A0A368UKD6.1
#=GS A0A4W5PEY0_9TELE/34-195   AC A0A4W5PEY0.1
#=GS A0A397ZMW1_BRACM/38-169   AC A0A397ZMW1.1
#=GS A0A672V0H1_STRHB/35-217   AC A0A672V0H1.1
#=GS A0A493T8D8_ANAPP/24-129   AC A0A493T8D8.1
#=GS G3II15_CRIGR/30-205       AC G3II15.1
#=GS A0A452CMJ6_BALAS/26-210   AC A0A452CMJ6.1
#=GS L5M2F3_MYODS/41-211       AC L5M2F3.1
#=GS A0A398ATP3_BRACM/35-199   AC A0A398ATP3.1
#=GS M7YXN7_TRIUA/45-198       AC M7YXN7.1
#=GS A0A2P6RT00_ROSCH/1-77     AC A0A2P6RT00.1
#=GS A0A2J8PZV0_PANTR/36-211   AC A0A2J8PZV0.1
#=GS A0A4Y7IYR9_PAPSO/87-250   AC A0A4Y7IYR9.1
#=GS A0A6I8N579_ORNAN/38-221   AC A0A6I8N579.1
#=GS A0A1D1UEM0_RAMVA/28-206   AC A0A1D1UEM0.1
#=GS A0A392MVM9_9FABA/5-117    AC A0A392MVM9.1
#=GS A0A067CKG8_SAPPC/6-156    AC A0A067CKG8.1
#=GS A0A3Q0FT35_ALLSI/1-118    AC A0A3Q0FT35.1
#=GS A0A3M0IMC5_HIRRU/35-210   AC A0A3M0IMC5.1
#=GS A0A445BKP2_ARAHY/96-257   AC A0A445BKP2.1
#=GS I0YWR8_COCSC/31-183       AC I0YWR8.1
#=GS A0A672V2F5_STRHB/52-227   AC A0A672V2F5.1
#=GS L8I229_9CETA/44-206       AC L8I229.1
#=GS A0A2I3REZ6_PANTR/32-207   AC A0A2I3REZ6.1
#=GS F7HQP4_MACMU/38-220       AC F7HQP4.1
#=GS A0A669BYC2_ORENI/23-192   AC A0A669BYC2.1
#=GS A0A151PG94_ALLMI/1-151    AC A0A151PG94.1
#=GS A0A2K2AAM1_POPTR/102-265  AC A0A2K2AAM1.1
#=GS A0A4W5P7R3_9TELE/87-248   AC A0A4W5P7R3.1
#=GS I3JBR1_ORENI/20-191       AC I3JBR1.2
#=GS A0A452G9E6_CAPHI/35-210   AC A0A452G9E6.1
#=GS A0A3S3P226_9ACAR/1-116    AC A0A3S3P226.1
#=GS A0A6A4KGN1_APOLU/1-162    AC A0A6A4KGN1.1
#=GS F4K5P9_ARATH/51-169       AC F4K5P9.1
#=GS A0A5F4CJI0_CANLF/30-205   AC A0A5F4CJI0.1
#=GS G4YYY1_PHYSP/5-140        AC G4YYY1.1
#=GS G1RTU4_NOMLE/47-206       AC G1RTU4.1
#=GS A0A6G1B6Y1_CROCR/38-220   AC A0A6G1B6Y1.1
#=GS G3SE03_GORGO/22-183       AC G3SE03.2
#=GS A0A4W6D2C1_LATCA/38-210   AC A0A4W6D2C1.1
#=GS A0A2R2MQN6_LINUN/3-176    AC A0A2R2MQN6.1
#=GS F6YV89_HORSE/38-220       AC F6YV89.3
#=GS H9H222_MELGA/1-49         AC H9H222.1
#=GS A0A0A0AVC0_CHAVO/3-129    AC A0A0A0AVC0.1
#=GS A0A1S3IUU4_LINUN/3-83     AC A0A1S3IUU4.1
#=GS C3Y1A9_BRAFL/232-410      AC C3Y1A9.1
#=GS A0A671XWZ3_SPAAU/29-199   AC A0A671XWZ3.1
#=GS A0A2K6LCX2_RHIBE/26-208   AC A0A2K6LCX2.1
#=GS A0A6D2I937_9BRAS/13-174   AC A0A6D2I937.1
#=GS D8SI08_SELML/50-197       AC D8SI08.1
#=GS V8P115_OPHHA/61-223       AC V8P115.1
#=GS I3NFY1_ICTTR/30-191       AC I3NFY1.1
#=GS A0A4Z2EV19_9TELE/24-135   AC A0A4Z2EV19.1
#=GS A0A2Y9MH62_DELLE/30-205   AC A0A2Y9MH62.1
#=GS E7FH52_DANRE/111-273      AC E7FH52.1
#=GS A0A401RK23_CHIPU/42-217   AC A0A401RK23.1
#=GS A0A369SH13_9METZ/47-179   AC A0A369SH13.1
#=GS A0A2Y9F0Y7_PHYMC/30-205   AC A0A2Y9F0Y7.1
#=GS A7RXK6_NEMVE/1-170        AC A7RXK6.1
#=GS G3RC18_GORGO/38-220       AC G3RC18.1
#=GS A0A3Q2LMS3_HORSE/2-163    AC A0A3Q2LMS3.2
#=GS A0A2P6N8E5_9EUKA/2-136    AC A0A2P6N8E5.1
#=GS J9IRC0_9SPIT/10-158       AC J9IRC0.1
#=GS F6X5A6_XENTR/21-187       AC F6X5A6.3
#=GS A0A218V333_9PASE/35-217   AC A0A218V333.1
#=GS A0A4W5QBX3_9TELE/23-198   AC A0A4W5QBX3.1
#=GS A0A091EW28_CORBR/30-205   AC A0A091EW28.1
#=GS A0A6I8MY78_ORNAN/28-198   AC A0A6I8MY78.1
#=GS A0A671XJ75_SPAAU/50-211   AC A0A671XJ75.1
#=GS D4A9N1_RAT/28-189         AC D4A9N1.1
#=GS A0A452R2G0_URSAM/27-177   AC A0A452R2G0.1
#=GS D8R3C0_SELML/21-178       AC D8R3C0.1
#=GS A0A5N3XG83_MUNRE/30-205   AC A0A5N3XG83.1
#=GS S7MU76_MYOBR/38-220       AC S7MU76.1
#=GS F6UT79_MONDO/39-222       AC F6UT79.2
#=GS A0A151PJ91_ALLMI/26-201   AC A0A151PJ91.1
#=GS A0A452EDH0_CAPHI/30-205   AC A0A452EDH0.1
#=GS A0A1L8HJG5_XENLA/22-162   AC A0A1L8HJG5.1
#=GS A0A2I0M519_COLLI/65-227   AC A0A2I0M519.1
#=GS A0A2R9APD6_PANPA/38-220   AC A0A2R9APD6.1
#=GS A0A2I3LGL6_PAPAN/37-193   AC A0A2I3LGL6.1
#=GS A0A091NI44_APAVI/31-206   AC A0A091NI44.1
#=GS L8HY00_9CETA/26-201       AC L8HY00.1
#=GS A0A2C9VD44_MANES/28-191   AC A0A2C9VD44.1
#=GS A0A315W4H1_GAMAF/36-213   AC A0A315W4H1.1
#=GS A0A2I0MP14_COLLI/3-133    AC A0A2I0MP14.1
#=GS B8AEQ3_ORYSI/49-201       AC B8AEQ3.1
#=GS A0A402EQF8_9SAUR/22-189   AC A0A402EQF8.1
#=GS A0A2K5JM99_COLAP/47-206   AC A0A2K5JM99.1
#=GS A0A3Q2ZU36_KRYMA/23-198   AC A0A3Q2ZU36.1
#=GS A0A1A6H606_NEOLE/62-198   AC A0A1A6H606.1
#=GS A0A452HUE8_9SAUR/29-195   AC A0A452HUE8.1
#=GS A0A6A5N5D1_LUPAL/87-247   AC A0A6A5N5D1.1
#=GS F7F3D9_MACMU/36-204       AC F7F3D9.3
#=GS A7RJ26_NEMVE/6-179        AC A7RJ26.1
#=GS A0A673UEJ1_SURSU/27-186   AC A0A673UEJ1.1
#=GS A0A5G2QLX9_PIG/96-271     AC A0A5G2QLX9.1
#=GS A0A3Q3RTD1_9TELE/211-274  AC A0A3Q3RTD1.1
#=GS G1KBS8_ANOCA/4-128        AC G1KBS8.1
#=GS A0A2Y9IG00_NEOSC/30-205   AC A0A2Y9IG00.1
#=GS A0A1U7UG53_CARSF/36-211   AC A0A1U7UG53.1
#=GS A0A2Y9JT75_ENHLU/27-188   AC A0A2Y9JT75.1
#=GS A0A024GLH2_9STRA/27-180   AC A0A024GLH2.1
#=GS HHIP_MOUSE/38-220         AC Q7TN16.2
#=GS A0A091VE79_NIPNI/69-200   AC A0A091VE79.1
#=GS A0A226N4I9_CALSU/23-198   AC A0A226N4I9.1
#=GS A0A087G9F7_ARAAL/33-194   AC A0A087G9F7.1
#=GS A0A2B4SQG0_STYPI/33-169   AC A0A2B4SQG0.1
#=GS A0A091LNM7_CATAU/31-206   AC A0A091LNM7.1
#=GS A0A2U3YJZ3_LEPWE/38-220   AC A0A2U3YJZ3.1
#=GS A0A2K5CPX8_AOTNA/36-211   AC A0A2K5CPX8.1
#=GS A0A672Z4P4_9TELE/37-210   AC A0A672Z4P4.1
#=GS A0A340Y9Q8_LIPVE/27-177   AC A0A340Y9Q8.1
#=GS A0A2I2Z2K8_GORGO/59-197   AC A0A2I2Z2K8.1
#=GS A0A444Z2S9_ARAHY/65-227   AC A0A444Z2S9.1
#=GS H0WIF9_OTOGA/22-183       AC H0WIF9.1
#=GS A0A672FU12_SALFA/36-176   AC A0A672FU12.1
#=GS A0A671X0M5_SPAAU/32-194   AC A0A671X0M5.1
#=GS G3Q9P7_GASAC/15-127       AC G3Q9P7.1
#=GS A0A388KRW8_CHABU/68-227   AC A0A388KRW8.1
#=GS A0A2Y9NR48_DELLE/31-192   AC A0A2Y9NR48.1
#=GS A0A3L6RQR9_PANMI/45-196   AC A0A3L6RQR9.1
#=GS A0A2R9AW72_PANPA/38-220   AC A0A2R9AW72.1
#=GS A0A340WLY7_LIPVE/26-209   AC A0A340WLY7.1
#=GS A0A2K6SRE9_SAIBB/26-208   AC A0A2K6SRE9.1
#=GS M3YFP1_MUSPF/30-205       AC M3YFP1.1
#=GS A0A337SLR6_FELCA/31-188   AC A0A337SLR6.2
#=GS F6YEV1_HORSE/34-104       AC F6YEV1.2
#=GS A0A226EVC4_FOLCA/40-214   AC A0A226EVC4.1
#=GS A0A091FUI9_CORBR/3-129    AC A0A091FUI9.1
#=GS V4T0R8_9ROSI/29-192       AC V4T0R8.1
#=GS A0A2P5BTL3_TREOI/27-185   AC A0A2P5BTL3.1
#=GS A0A3B6PNH3_WHEAT/44-197   AC A0A3B6PNH3.1
#=GS A0A2I0LPJ3_COLLI/26-201   AC A0A2I0LPJ3.1
#=GS A0A2K6U9Z4_SAIBB/2-164    AC A0A2K6U9Z4.1
#=GS A0A1S3G7N1_DIPOR/26-201   AC A0A1S3G7N1.1
#=GS A0A0D2S538_GOSRA/43-205   AC A0A0D2S538.1
#=GS A0A1S3JLL6_LINUN/25-193   AC A0A1S3JLL6.1
#=GS A0A5F8GBR4_MONDO/37-213   AC A0A5F8GBR4.1
#=GS A0A5N5N5G0_PANHP/23-184   AC A0A5N5N5G0.1
#=GS A0A3Q3FVR4_9LABR/27-200   AC A0A3Q3FVR4.1
#=GS A0A1U7SWL9_ALLSI/32-207   AC A0A1U7SWL9.1
#=GS A0A4D9E0R2_9SAUR/27-194   AC A0A4D9E0R2.1
#=GS A0A4W4E3P9_ELEEL/27-85    AC A0A4W4E3P9.1
#=GS A0A383ZF57_BALAS/59-234   AC A0A383ZF57.1
#=GS V4T5J6_9ROSI/29-192       AC V4T5J6.1
#=GS I3LHD8_PIG/28-189         AC I3LHD8.2
#=GS U6LL00_9EIME/6-170        AC U6LL00.1
#=GS A0A2R8PJJ1_CALJA/47-201   AC A0A2R8PJJ1.1
#=GS W5MMF9_LEPOC/29-202       AC W5MMF9.1
#=GS G1PL64_MYOLU/27-201       AC G1PL64.1
#=GS H2RXM2_TAKRU/28-187       AC H2RXM2.3
#=GS A0A452HZX5_9SAUR/30-205   AC A0A452HZX5.1
#=GS A0A2U3VUI7_ODORO/27-177   AC A0A2U3VUI7.1
#=GS A0A5F4VW16_CALJA/38-220   AC A0A5F4VW16.1
#=GS H3AUG3_LATCH/21-187       AC H3AUG3.1
#=GS C0H9Y7_SALSA/34-195       AC C0H9Y7.1
#=GS A0A0K9RED2_SPIOL/30-187   AC A0A0K9RED2.1
#=GS A0A3Q3WG09_MOLML/30-214   AC A0A3Q3WG09.1
#=GS A0A093CME2_TAUER/1-98     AC A0A093CME2.1
#=GS E9Q543_MOUSE/34-156       AC E9Q543.8
#=GS A0A091RT50_NESNO/28-203   AC A0A091RT50.1
#=GS A0A5F4D4W2_CANLF/26-168   AC A0A5F4D4W2.1
#=GS A0A5J4NA33_9TREM/13-147   AC A0A5J4NA33.1
#=GS A0A3Q0H308_ALLSI/415-577  AC A0A3Q0H308.1
#=GS H0VX48_CAVPO/38-220       AC H0VX48.2
#=GS A0A3Q1IJW5_ANATE/16-176   AC A0A3Q1IJW5.1
#=GS A0A2K6TR25_SAIBB/1-90     AC A0A2K6TR25.1
#=GS A0A669DKK5_ORENI/23-198   AC A0A669DKK5.1
#=GS A0A444U782_ACIRT/36-238   AC A0A444U782.1
#=GS A0A287U6M0_HORVV/1-114    AC A0A287U6M0.1
#=GS A0A4W2F2D4_BOBOX/27-98    AC A0A4W2F2D4.1
#=GS A0A485MQA9_LYNPA/40-200   AC A0A485MQA9.1
#=GS A0A452HUK2_9SAUR/56-223   AC A0A452HUK2.1
#=GS F7BP60_MACMU/36-211       AC F7BP60.1
#=GS A0A3N0Y8W8_ANAGA/36-190   AC A0A3N0Y8W8.1
#=GS A0A1D5PDP9_CHICK/35-217   AC A0A1D5PDP9.1
#=GS A0A2I3GWK6_NOMLE/43-155   AC A0A2I3GWK6.1
#=GS A0A091EMR9_CORBR/30-205   AC A0A091EMR9.1
#=GS HIPL2_MOUSE/43-205        AC Q9D2G9.2
#=GS A0A5N5M567_PANHP/29-204   AC A0A5N5M567.1
A0A0D9QVZ4_CHLSB/36-211              ...........................................................VCMNA....KHHKEK.PGPED.....KLH.EQ.........................C.RP.WKKN...............................ACCSTNTS.QE.AH...K.DV.........SY...LY.RFNWNH..C..............G..E.....M...AP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.NVP..LC....KE....DCEQWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGF.....NK..CP.V..G..AAC........QPFHFYF.PT..PT...V.LC......NEIWTY.SYKVS....NYSRG................SGRCIQ................................................................
H2PEE7_PONAB/38-171                  ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..N.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQNL....FHSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPK-...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------hkhncfciqevvs...................................................
A0A022RC25_ERYGU/30-193              ............................................vcisqggrfppfsse-----....-----G.KAPKKa..arDAL.RF.........................C.RV.FRKR...............................TCCDVSQT.HA.AL...L.SI.........RK...LS.SY----..-..............G..E.....G...SQ..........DCL.QLW...ELV..ECSI-CDP.LVG--....VQH...........................................----..---.GPP.lIC....SS....LCDRLYQACST.A.....YFAM...D...AK.....--.T.QA..........................LSPCG.....A-..--.G..D..FVC........GRASEWV.SN..GT...E.LC......RAS-GF.SVTTS....-----................------ssseeeeeelsscyg.................................................
G3R6P4_GORGO/30-205                  ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCTASTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........RTFESYF.PT..PA...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
K7EM70_HUMAN/27-177                  ..........................................................a-C---....GGSRPL.QARSQ.....QHH.GL.........................A.AD.LGKG...............................KLHLAEMD.TT.ET...S.GP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0BRL9_PARTE/29-183                  ................................................ecslknriayg-----....------.---QQ.....KLH.QLtg....................myfC.DS.YAKR...............................TCCSQQNL.EE.LK...F.KW.........YR...E-.---QQL..A..............V..E.....L...SQ..........QCQ.EIF...TKT..ICSD-CDG.DIG--....-QQ...........................................----..--I.RVG..FC....PH....YCTQMYQACWR.D.....LFQY...D...EK.....TQ.K.--..........................LRLCY.....--..-Q.N..D..VLC........SELRNIV.NN..GD...Q.FC......TSL-GY.KVNS-....-----................------ysdreewmenkyl...................................................
A0A091HC73_BUCRH/21-188              ..........................................................g-CLEG....DTHKLK.PSPEP.....NMH.E-.........................C.TL.YSKS...............................SCCYADFT.EQ.LA...H.SP.........VT..kVS.NSYWNR..C..............G..Q.....L...SK..........SCE.DVT...KKI..ECFYRCSP.HAARW....IHP...........................................NSIA..AIQ.SVP..LC....QS....FCDDWYEACKD.D.....STCV...R...NW.....LT.D.WE..........................WDESG....eNR..C-.-..K..NKC........IPYHEMY.AN..GT...D.MC......RNMWGE.SFKVS....---ES................SCLCLQ................................................................
A0A094KCD0_ANTCR/1-98                ...........................................................-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..----ECSP.YAAHL....YDA..........................................eDPST..PMR.TIP.gLC....QD....YCRQVWQKCRS.I.....FRHL...S...AD.....QE.L.IA..........................LENNM....aKF..--.-..-..--C........RYLS---.LE..DT...D.YCf....pHLLENQ.HLNQ-....-----................------nlglvtadaegclq..................................................
A0A3Q7ENE1_SOLLC/41-192              ..................................................rfsnegkpp-----....----RK.VKKGP.....RDL.NL.........................C.RV.FRGK...............................TCCDVTQT.HP.AF...M.SI.........RR...LA.S-----..T..............G..E.....A...SQ..........ECL.HLW...EML..ECSI-CDP.RVG--....VQA...........................................----..---.GPP.vLC....TS....FCDKVYQACSN.A.....YFSI...D...A-.....KT.Q.VL..........................AP---.....CA..V-.N..D..FVC........GRASEWI.SN..GT...E.LC......RV-AGF.SVKSL....SDDPE................EVSCY-g...............................................................
A0A3Q2VYP3_HAPBU/23-198              ...........................................................MCMDA....KHHKTE.PGPEG.....QLY.QQ.........................C.SP.WRDN...............................ACCTANTS.AE.AH...D.DA.........SY...LY.NFNWNH..C..............G..T.....M...SK..........ECK.KHF...IQD..TCFYECSP.HLGPW....IQPvd.......................................qsWRKE..RIL.DVP..LC....KE....DCETWWEDCKN.D.....FTCK...T...NW.....HK.G.WD..........................WSSGI.....NK..CP.E..G..SKC........SKWTDVF.PT..PK...S.MC......EEIWSN.SYIYT....TYTKT................SGKCMQ................................................................
A0A1L8F8R7_XENLA/54-213              ......................................................qcldy-----....--KPPF.QPSQP.....LDF.--.........................C.SV.YSSF...............................GCCDSAQD.EA.IA...S.RY.........HY...IT.DF-LDH..S..............G..V.....-...-A..........ACG.DYI...RDI..LC-QECSP.YAAHL....YDA..........................................eDANT..PLR.DVP.gLC....GN....YCMEFWHHCRN.T.....LSL-...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------iiedkdvtelegdlgkfcsfltlddvnycypnvltnaelnsglgdvkedeegc...........
A0A2K5Y8K7_MANLE/20-194              .........................................qtpdlslpkcwdyrrepp-----....------.-----.....---.SP.........................C.RP.WKKN...............................ACCSTNTS.QE.AH...K.DV.........SY...LY.RFNWNH..C..............G..E.....M...AP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.NVP..LC....KE....DCEQWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGF.....NK..CP.V..G..AAC........QPFHFYF.PT..PT...V.LC......NEIWTY.SYKVS....NYSRG................SGRCIQ................................................................
A0A3P8TBX2_AMPPE/26-207              ...........................................................VCLQD....GKHKAT.PSPEP.....HLT.E-.........................C.GL.YADN...............................SCCTEEHI.QD.IS...Y.VP.........SA..sSK.NEPWDK..C..............G..R.....L...SP..........ECE.GFL...KRV..SCFYRCSP.DAARW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRM.D.....LTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GTC........VQYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDEPE................------evgeageigsegdgsrpcgclt..........................................
A0A3Q7VCQ0_URSAR/27-177              ..........................................................a-C---....GGSHPL.PSMSQ.....THQ.RL.........................A.AD.LGTG...............................QLHLTEMD.TP.EA...S.DP.........GM...VP.----ER..C..............G..D.....P...SP..........GCE.SFL...GHL..QVALHSRF.RLLLL...gIRQ...........................................----..---.AQP..LC....SE....LCDVWFATCEN.D.....ITC-...-...--.....GL.T.WL..........................PLLEK.....RG..C-.-..E..PGC........TTYEQTF.AD..GA...D.LC......RSVLGY.ALPVA....--APG................AGHCLN................................................................
A0A2K5NSK3_CERAT/47-206              .................................................dygppfqpll-----....------.-----.....-HL.EF.........................C.SD.YESF...............................GCCDQHKD.RR.IA...A.RY.........WD..iME.YFD---..-..............L..K.....R...HE..........LCG.DYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHS.A.....ISLL...T...ND.....-R.G.RQ..........................ESHGM.....DG..V-.-..-..---........RFCHLLD.LP..DK...D.YC......------.-----....-----................------fpnvlrnnylnrnlgmvaqdprgclq......................................
A0A2K6GQH9_PROCO/3-164               .....................................................saatev-----....------.-----.....---.-Q.........................C.SP.WRKN...............................ACCSVNTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............R..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IRQvd.......................................qsWRKE..RFL.DVP..LC....KE....DCQHWWEDCRT.S.....YTCK...S...NW.....HQ.G.WE..........................WTSGV.....NK..CP.A..G..ATC........RTFESYF.PT..PA...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A4W2GWX7_BOBOX/30-205              ...........................................................VCMNA....RYHKEK.PGPED.....KLH.GQ.........................C.SP.WKKN...............................ACCFVNTS.IE.AH...K.DI.........SS...LY.RFDWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IREvn.......................................qsWRKE..RIL.NVP..LC....KE....DCQSWWEDCRT.S.....YTCK...S...NW.....HR.G.WD..........................WTSGY.....NQ..CP.V..K..AAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SYKAS....NYSRG................SGRCIQ................................................................
G3QYN5_GORGO/19-179                  ................................................ahpqwplcrpp-----....------.-----.....QPL.RL.........................C.AQ.YSDF...............................GCCDEGRD.AE.LT...R.RF.........WA...LAsRVD---..-..............A..A.....E...WA..........ACA.GYA...RDL..LC-QECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRG.L.....FRHL...S...TD.....QE.L.WA..........................LEGNR....aRF..C-.-..-..---........RY---LS.LD..DT...D.YC......------.-----....-----................------fpyllvnknlnsnlghvvadakgclq......................................
V9EAT8_PHYPR/33-184                  ..............................................tcrsagvlkfdpe-----....----TH.PMQRT.....KGM.EV.........................C.SK.YRKS...............................TCCNATHA.HA.LR...L.KI.........RE..pVV.------..-..............A..K.....F...SR..........KCQ.ALT...EEM..ACSS-CHP.LMGTW...eMK-...........................................----..---.--N..VC....PS....LCNDWYDACKD.E.....YYAY...-...-G.....GA.G.TL..........................APCYG.....NA..L-.-..-..-VC........SPLKSIA.NS..GA...D.FC......VHM---.GFHVG....-----................------sdsdaegidcfd....................................................
A0A091HIE9_BUCRH/31-206              ...........................................................ICMDA....KHHKTK.PGPEG.....MLH.DQ.........................C.AP.WKDN...............................ACCTANTS.SE.AH...K.DQ.........SN...LY.NFNWNH..C..............G..L.....M...PP..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQad.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKD.F.....VTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFSQVF.PQ..PK...D.LC......EKIWSN.SYKYT....TEHRG................SGRCIQ................................................................
U3ICJ7_ANAPP/29-190                  ....................................................qcldfkp-----....----PF.RPPRG.....LA-.-F.........................C.RR.YGAF...............................GCCEPRRD.RE.LL...Q.RF.........YR...LS.---AHL..D..............G..H.....T...YA..........ACA.GHL...QEL..LC-QECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCQQVWQKCRS.I.....FRYL...S...SD.....PE.L.VA..........................LE---.....NN..M-.-..A..KLC........RYLSL--.-E..DT...D.YCf....pHLLTNE.NLNQNl..gLVTAD................AEGCL-q...............................................................
A0A2G5DLG5_AQUCA/36-190              .................................................sfssegkppr-----....-----K.VNKGP.....KDL.TL.........................C.RV.FRRS...............................TCCDVTQT.HQ.AL...L.TI.........RR...LA.SV----..-..............G..E.....A...NQ..........ECL.QLW...ELL..ECSI-CDP.LVG--....VQR...........................................----..---.GPP.lIC....SS....LCDRIFQSCSS.A.....YFSM...D...A-.....KT.Q.VL..........................SPCG-.....--..L-.S..D..FVC........GRASEWV.SN..GT...E.LC......QHA-GF.SVKSS...gNG---................------hkgmeetfcyg.....................................................
A0A671FGA5_RHIFE/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........HK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.EKVEEi..sRKHKH................NCFCIQ................................................................
A0A4W6D2B0_LATCA/22-194              ...................................................chpqcldy-----....--KPPF.EPRQP.....LVF.--.........................C.KE.YSKF...............................GCCDLEKD.GE.IS...V.KF.........YS..iME.N--FDH..S..............G..Y.....I...--..........TCS.KYI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.MLP.gLC....GD....YCSNYWNQCRY.T.....LSLL...L...ED.....MG.S.P-..........................QEFAN....lTA..TI.E..E..DRK........RFCDFLE.LK..DK...Q.YC......------.-----....-----................------ypnvltnaelnanlgsvredpkgcle......................................
A0A091IU12_EGRGA/31-206              ...........................................................VCMDA....KHHKTK.PGPEG.....KLH.EQ.........................C.AP.WKDN...............................ACCTANTS.LE.AH...K.DQ.........SN...LY.NFNWNH..C..............G..V.....M...PP..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQvd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKD.C.....MTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFSQVF.PR..PK...D.LC......EKIWSN.SYKYT....MEHRG................SGRCIQ................................................................
W5MQI6_LEPOC/34-194                  ..........................................................q-CL--....DFKPPF.KPPEE.....LTF.--.........................C.VM.YKDF...............................GCCDAIKD.QE.LM...A.KF.........YR..iMD.NFD---..-..............Y..H.....G...YA..........TCA.GYV...QDI..IC-QECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....GD....YCSEFWLQCRT.A.....ITLL...S...DD.....MQ.L.VE..........................LQEDQ....eQL..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------qylelgdrdycypgllanerlarnlgrvtadaegcl............................
A0A0R3UCR5_9CEST/37-165              ...........................................................MCQES....EHQKQR.PSPEY.....GLT.S-.........................C.TA.WKNN...............................SCCTAATA.TS.IT...S.EK.........--...LH.GFNFEV..C..............G..K.....M...SS..........ACL.AFF...HDD..HCLVKCSP.NLGPW....LVQls.......................................ssRFNE..RAF.KVP..LC....ES....DCNSWYDACKN.D.....KTCA...T...NW.....NSgG.FD..........................WES--.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------gr..............................................................
A0A093PLD3_9PASS/3-165               ..............................................qcldygppfqppf-----....------.-----.....-HL.EF.........................C.SA.YEKF...............................GCCDQERD.NS.IA...A.KY.........WD...IM.DYIDP-..-..............-..R.....G...HK..........LCG.TYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.SLP.gLC....FD....YCSEFHSNCRS.A.....IRL-...-...--.....--.-.LT..........................RDKHI.....QE..CC.E..T..NRT........RFCNLLQ.LH..DE...D.YCf....pNVLRNT.ALNYNl..gSVVED................QGGCIQ................................................................
A0A1P8BFS7_ARATH/14-174              ......................................cvskggrfppyelegkppksv-----....------.-GRGS.....KDL.TL.........................C.RV.FRKK...............................TCCSSVQT.NP.AF...V.AV.........RN...LA.TY----..-..............G..E.....A...SQ..........ECL.ELF...ELL..ECSI-CNP.NVG--....IQP...........................................----..---.GPP.rIC....AS....FCDRVFEACKD.A.....YFAS...N...AL.....--.-.--..........................KRVIG....pCG..VN.D..D..IIC........IKASNWE.SN..GT...S.FC......EAA---.GFAVQ...rNDDSR................EKPCY-g...............................................................
F4K5P6_ARATH/57-217                  ......................................cvskggrfppyelegkppksv-----....------.-GRGS.....KDL.TL.........................C.RV.FRKK...............................TCCSSVQT.NP.AF...V.AV.........RN...LA.TY----..-..............G..E.....A...SQ..........ECL.ELF...ELL..ECSI-CNP.NVG--....IQP...........................................----..---.GPP.rIC....AS....FCDRVFEACKD.A.....YFAS...N...AL.....--.-.--..........................KRVIG....pCG..VN.D..D..IIC........IKASNWE.SN..GT...S.FC......EAA---.GFAVQ...rNDDSR................EKPCY-g...............................................................
A0A3P8TFB6_AMPPE/26-198              ................................................cchpqcldykp-----....----PF.QPHQ-.....PLV.F-.........................C.KE.YSKF...............................GCCDVEKD.EQ.IS...H.RF.........YT..iME.N--FDH..S..............G..Y.....V...--..........TCG.RYI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.MLP.gLC....GD....YCSDYWHQCRY.T.....L---...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------gllledsgspqqfanltatieedrrkfcdflelkdqqycypnvlmntelnanlglvredpkgcl
A0A4W2E4G6_BOBOX/4-164               .......................................................vake-----....------.-----.....---.AQ.........................C.TP.WKKN...............................ACCSARVS.QE.LH...K.DT.........SS...LY.NFTWDH..C..............G..K.....M...EP..........ACQ.RHF...IQD..NCLYECSP.NLGPW....IQEvn.......................................qkWRKE..RFL.NVP..LC....KE....DCQSWWEDCRT.S.....YTCK...S...NW.....HR.G.WD..........................WTSGS.....NK..CP.T..G..TIC........RTFEAYF.PT..PA...A.LC......EGLWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A3P9BJ31_9CICH/23-198              ...........................................................MCMDA....KHHKTE.PGPEG.....QLY.QQ.........................C.SP.WRDN...............................ACCTANTS.AE.AH...D.DA.........SY...LY.NFNWNH..C..............G..S.....M...SK..........ECK.KHF...IQD..TCFYECSP.HLGPW....IQPvd.......................................qsWRKE..RIL.DVP..LC....KE....DCETWWEDCKN.D.....FTCK...T...NW.....HK.G.WD..........................WSSGI.....NK..CP.E..G..SKC........SKWTDVF.PT..PK...S.MC......EEIWSN.SYIYT....TYTKT................SGKCMQ................................................................
A0A0C2N382_THEKT/26-102              ...........................................................RCLKT....NHHKTS.PTAEN....vEDM.GL.........................C.SP.WADY...............................SCCDTDVA.NK.IT...S.PG.........KY..yIH.NVLFNQ..Cp...........trG..N.....L...SD..........ACK.LDF...ES-..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------idyif...........................................................
A0A669E0H7_ORENI/37-209              .................................................chpqcldykp-----....----PF.EPRQP.....LA-.-F.........................C.KE.YSKF...............................GCCDVEKD.EE.IS...G.RF.........YT..iME.N--FDH..S..............G..-.....-...YA..........ACG.KYV...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.VLP.gLC....GD....YCSDYWRQCRY.T.....LGLL...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------ledvgnsqqfanltatieedhrrfceflvlkdkeycypsvltnaelnanlgllnedpegcle..
A0A2Y9RL39_TRIMA/30-205              ...........................................................VCMDA....KYHKTK.PGPED.....KLH.GQ.........................C.SP.WRKN...............................ACCSVNTS.QE.LH...K.DI.........SR...LY.NFNWDH..C..............G..K.....M...EP..........DCK.RHF...IQD..NCLYECSP.NVGPW....IKQvn.......................................qrWRKE..RFL.DVP..LC....KE....DCQSWWEACRT.S.....YTCK...T...NW.....HR.G.WD..........................WTSGV.....NK..CP.V..G..TTC........HTFEFYF.PT..PA...D.LC......EGLWSH.SYKAS....NYSRG................SGRCIQ................................................................
RTBDN_HUMAN/27-183                   ..........................................................a-C---....GGSRPL.QARSQ.....QHH.GL.........................A.AD.LGKGklh.........................lagPCCPSEMD.TT.ET...S.GP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A2K5NUV5_CERAT/37-193              ..........................................................a-C---....GGSHPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagTCCPSEMD.AT.EI...S.GP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.RLRLL...gVRH...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A341D9E4_NEOAA/54-210              ..........................................................a-C---....GGSHPL.PARSQ.....RHH.RL.........................A.TN.LGTS...............................QLHLAEMN.TP.EA...S.DP.........GI...VS.----GS..C..............G..E.....L...SP..........GCE.SFL...GHL..QVALRSRF.HLLLL...gVRQ...........................................----..---.TQP..LC....SE....LCDAWFATCES.D.....IIC-...-...--.....SP.T.WL..........................PLLEK.....RG..C-.-..E..PGC........TTYGQTF.AD..GA...E.LC......RSFLGY.AVPVAdpgsVADPG................SGRCLN................................................................
A0A2T7PMZ4_POMCA/48-174              ...........................................................MCIDG....RNHKSQ.PGEES.....SLM.SF.........................C.SP.WKKR...............................SCCTQEIA.ER.MH...L.DR.........NW...LN.-FDWNH..C..............G..E.....L...SP..........SCR.EFF...VKD..LCFYECSP.NLGPW....IVPes......................................tpvQLEE..R--.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------vknlqifleqqngsakecgttalkwfqmemiasd..............................
A0A1D3D1A4_9EIME/63-234              ...........................vclrrlsfdghppqdqrelsakepaaaippih-----....------.-----.....---.--.........................S.SP.LCAA...............................ACCYPQHA.AL.VH...R.RL.........NA...LE.------..-..............-..-.....D...AQ..........DCR.RVS...EKV..LCSL-CEP.RFGTG...eLE-...........................................----..-HK.GKP.lLC....PD....LCEEWFTACQD.V.....YVSA...S...PS.....GS.A.ND..........................LAFCD....gR-..--.-..S..LIC........SRLSATI.ED..SF...T.FC......RKM-GY.DVVI-....-----................------deayeltaspregksacfd.............................................
A0A1S3HEA3_LINUN/39-216              ..........................................................t-CMELl..kSHSKSK.PSPEP.....GLE.--.........................C.PQ.YTKK...............................SCCKAGVT.ED.FE...T.KE.........NW...QN.ITNYVH..Cp...........qkS..S.....L...SP..........MCH.KMF...FDE..LCFFLCSP.YIGPW....IAPat......................................hdePVTD..RFT.DVP..LC....AS....ECNSWWEACKG.E.....YTCH...E...NW.....YT.D.FD..........................RDENG....lNV..CK.A..G..AEC........RTYEAMY.RT..AS...N.FC......EIIWDR.SFKVV....---PD................EEPCM-k...............................................................
A0A2R9BSE7_PANPA/1-108               ........................................................agy-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.--A...RDL..LC-QECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRG.L.....FRHL...S...TD.....QE.L.WA..........................LEGNR....aRF..C-.-..-..---........RY---LS.LD..DT...D.YC......------.-----....-----................------fpyvlinknlnsnlghvvadakgclq......................................
A0A3Q1MAD6_BOVIN/42-138              ....................................................elyeevd-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....--P..........................................rWQAE..RVL.DAP..LC....LE....DCERWWADCRT.S.....HTCK...S...NW.....LG.G.WA..........................WSRGK.....PR..CP.E..W..EPC........RPFPHHF.PT..PA...D.LC......ERIWSG.SFRAS....PERRG................SGRCLQ................................................................
A0A6J3RVA1_TURTR/34-209              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCSVNTS.QE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...KP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.NVP..LC....KE....DCQIWWEDCRT.S.....YTCK...T...NW.....HK.G.WN..........................WTSGY.....NQ..CP.V..R..AAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SYKVS....NYGRG................SGRCIQ................................................................
A0A212DI86_CEREH/1-106               .......................................................mlst-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...--N..FCLLLCRT.QVDPR....GQ-...........................................--AE..RVL.DAP..LC....LE....DCERWWADCRT.S.....HTCK...S...NW.....LG.G.WA..........................WSRGK.....PR..CP.E..R..ASC........RPFPHHF.PT..PA...H.LC......ERIWSG.SFRAS....PERRG................SGRCLQ................................................................
G3HSP0_CRIGR/26-186                  ...........................................................ICMNA....KHHKRE.PGPED.....KLF.LE.........................C.VP.WKDN...............................ACCTFTTS.WE.AH...L.DE.........LL...FF.NFSMLH..C..............G..L.....L...TP..........VCH.KHF...IQA..VCLHECSP.NLGPW....IQLvv.......................................pnRQEE..QVQ.GVP..LC....LE....DCEEWWEDCRS.S.....YTCK...S...NW.....HS.S.F-..........................-----.....HS..--.-..-..---........--SQDYF.PT..PS...D.LC......EKIWSN.TFKAS....PEHRN................SGRCLQ................................................................
A0A1D5NYI4_CHICK/27-188              ..................................................qcldfkppf-----....------.RPPR-.....-AL.AF.........................C.RR.YGAF...............................GCCDARRD.RA.LL...Q.RF.........YR...LS.---AHL..D..............G..P.....T...YA..........ACA.GHL...QDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCQQVWQKCRS.I.....FHYL...S...TD.....QE.L.IA..........................LENNM....aKF..--.-..-..--C........RYLS---.LE..DT...D.YCf....pHLLANE.NL---....-----................------nqnlglvtadaegclq................................................
A0A0P7YL54_SCLFO/38-212              ...........................................................ACLQD....GKHKAT.PSPE-.....PFL.NQ.........................C.AL.YAEN...............................ACCSQNDI.PE.LA...A.SP.........GL..kVE.EIFWDT..C..............G..P.....L...SP..........GCT.DFL...RRI..ACFHLCSP.DAARW....PHP...........................................QHPA..SYQ.AVP..LC....HS....FCRDWFETCKT.D.....LTCT...R...NS.....VG.D.GE..........................WHRHP.....IN..C-.-..T..GNC........VTYQQMY.EN..GR...N.LC......ESVWGD.AFMSVe.ddG---Dgt...........eagSCGCL-t...............................................................
A0A3P9C1U5_9CICH/57-219              ................................................qcldfkppfkp-----....------.--PW-.....-HL.EF.........................C.NQ.YEQF...............................GCCDQGTD.NM.IA...E.RY.........WD..iIE.QLE---..-..............A..A.....G...HE..........LCT.DML...KEI..MC-QECSP.YAAHL....YDA..........................................eDPYT..PVR.EIP.gLC....FD....YCSEFHSKCRH.V.....LKYL...-...-T.....VN.Q.LL..........................LYAAE.....RD..V-.-..T..TFC........SMV---D.LP..DQ...D.YC......------.-----....-----................------yptvlkssdlnsnlgqvvedprgclq......................................
A0A485NL80_LYNPA/14-175              ...................................................gcldfrpp-----....-----F.RPPQP.....--L.RF.........................C.AQ.YSAF...............................GCCAPEQD.AA.LA...R.RF.........GA...LAaRVD---..-..............A..A.....E...WA..........ACA.GYA...LDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRG.L.....FRHL...S...PD.....RE.L.WA..........................LEGNR....aKF..--.-..-..--C........RYLS---.LD..DT...D.YCf....pRLLVNE.NLNSNl..gRVVAD................AKGCLQ................................................................
A0A151NL07_ALLMI/35-221              ...........................................................RCLNG....SPPRRL.KKRER.....RLL.LLdepas..............gaellpC.RG.HYPR..............................lSCCARAGR.HG.LL...L.LP.........AA...TK.IFS---..-..............V..T.....N...NT..........ECM.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETSE..REL.VLP.yLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A093IHD5_FULGA/3-165               ..............................................qcldygppfqppf-----....------.-----.....-HL.EF.........................C.SA.YENF...............................GCCDQERD.NS.IA...A.KY.........WD...IM.DYIDP-..-..............-..R.....G...HK..........LCG.TYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.SLP.gLC....FD....YCSEFHFSCRS.A.....IRLL...-...--.....--.-.-T..........................SDKHI.....QE..CC.Q..T..NKT........RFCNLLH.PH..DE...D.YCf....pNVLKNT.ALNRNl..gSVVED................HKGCL-q...............................................................
FOLR1_HUMAN/36-211                   ...........................................................VCMNA....KHHKEK.PGPED.....KLH.EQ.........................C.RP.WRKN...............................ACCSTNTS.QE.AH...K.DV.........SY...LY.RFNWNH..C..............G..E.....M...AP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.NVP..LC....KE....DCEQWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGF.....NK..CA.V..G..AAC........QPFHFYF.PT..PT...V.LC......NEIWTH.SYKVS....NYSRG................SGRCIQ................................................................
#=GR FOLR1_HUMAN/36-211        SS    ...........................................................BEEST....SS-ESS.-BSBT.....TGG.TT.........................T.GG.GSSS...............................BSSBHHHH.HH.TT...S.TT.........-T...TT.SS-TTT..T..............S..S.....-...-H..........HHH.HHH...HHH..HHHHHH-S.TTGGG....EEEEE.......................................ETTEEE..EE-.SB-..B-....HH....HHHHHHHHTTT.S.....EES-...S...-S.....SS.S.-B..........................GTTSS.....-B..-S.S..G..GG-........EEHHHHS.SS..HH...H.HH......HHTTTT.SB---....SS-TT................SSSSB-................................................................
A0A2I4B9B7_9TELE/28-206              ...........................................................ACLQD....GKYKAT.PGPEA.....HLT.-E.........................C.GI.YAEN...............................SCCTEEHI.QD.IS...Y.VP.........SA..sSK.NEPWDK..C..............G..P.....M...SP..........ECE.GFL...KRV..ACFYRCSP.DASRW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFNACRM.D.....MTCA...-...--.....-R.N.WA..........................KDPRG.....QN..C-.-..T..GTC........VQYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDDPQevmeag...dsgaegrP-----cgclt...........................................................
A0A226PHQ1_COLVI/21-188              ..........................................................g-CLEG....DTHKEK.PSPEP.....NMH.E-.........................C.TL.YSES...............................SCCYANFT.EQ.LA...H.SP.........VI..kVS.NSYWNR..C..............G..Q.....L...SK..........SCE.DFT...KKI..ECFYRCSP.HAAHW....INP...........................................RHTA..AIQ.SVP..LC....QS....FCDDWYEACKD.D.....SICA...H...NW.....LT.D.WD..........................WDDRG....eNH..C-.-..R..SKC........VPYSEMY.AN..GT...D.MC......QNMWGE.SFKVS....---EA................SCLCLQ................................................................
A0A067EM12_CITSI/29-192              .............................................vcvsqggrfapfss-----....----EG.KPPERaskgrSDL.TL.........................C.RV.FRKK...............................TCCDAAQT.HP.AL...L.SI.........RK...LA.S-----..T..............G..E.....A...SQ..........ECL.HLW...ELL..ECSI-CDP.NVG--....VQP...........................................----..---.GPP.lIC....AS....FCERVYQACSN.A.....YFSM...D...A-.....KT.Q.VL..........................APCGV.....ND..F-.-..-..-VC........GRAAEWV.SN..GT...E.LC......HAA---.-----....-----................------gfavklpddryidgeetscy............................................
A0A5N5H2P0_9ROSA/26-188              ..........................................vcisqggrfppfssegk-----....------.-PPKRvtkgsKDL.TL.........................C.RV.FRKK...............................TCCDVAQT.HP.AL...V.SV.........RK...LA.S-----..S..............G..E.....A...GP..........ECL.HLW...ELL..ECSI-CDP.RIG--....VQS...........................................----..---.GPP.vIC....AS....FCDRVFEACAE.A.....YYST...-...DA.....IT.Q.VL..........................APCGV.....ND..Y-.-..-..-VC........GRASEWI.RN..GT...E.FC......HAA---.-----....-----................------gfdvkddisvskeepfcyg.............................................
A0A670IYA0_PODMU/31-172              ...........................................................RCLPG....GKHKAS.PSPEG.....QLG.I-.........................C.QI.YAEN...............................ACCSPEVT.QD.LS...K.AN.........DI...--.--YWNR..C..............G..S.....L...SS..........RCE.GYL...QQL..ECFYRCSP.IAAQW....PHP...........................................QRPT..AVL.AVP..LC....QS....FCDQWYDACKE.D.....LTCA...R...NW.....LT.D.WH..........................WGPEG.....NN..C-.-..S..QDC........LSYGQVR.--..--...-.--......------.-----....-----................------tlnapr..........................................................
A0A0E0NH62_ORYRU/49-201              .............................................fssegkrpgraakg-----....------.----R.....RDL.AL.........................C.RV.FRQN...............................TCCDVSQT.FS.AL...L.SV.........RK...LA.S-----..T..............G..E.....G...SQ..........ECL.HLW...ELL..ECSI-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFKACSE.A.....YFAI...-...D-.....VK.T.QA..........................LSPCG.....--..L-.G..D..ILC........GKAHKWV.SN..GT...E.LC......RSA---.-----....-----................------gfsvqalettsggvddtfcy............................................
A0A093C5Q2_9AVES/3-129               ........................................................lsv-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..T.....N...NT..........DCA.KLL...EEI..KCAH-CSP.HAQNL....FHPpe.......................................kgETPE..REL.TLP.yLC....KD....YCKEFYYTCRS.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
C3Z5S0_BRAFL/64-202                  .............................enpnnkvaerlgwpspvddchlqslhkdtv-----....------.-----.....---.--.........................-.--.----...............................--------.--.QK...I.KE.........AY...GK.EWHWDR..C..............G..P.....L...SS..........ACE.RFF...VQE..ACLYECEP.NAGFY....-RKfpdhvy...............................ndsdpnHNKW..QME.GMP..IR....AD....YCDAWFRACRY.D.....RFCA...A...DS.....--.-.GS..........................YSS--.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------careyakvdntgdn..................................................
A0A3Q3WCH9_MOLML/42-208              ...........................................................ACLQD....GKHKAM.PGPEL.....NLR.E-.........................C.TL.YADN...............................SCCTEGDI.HD.IS...H.LP.........SE..iNR.NEPWDK..C..............G..P.....L...SS..........ECE.GFL...KRV..SCFYRCSP.DAARW....PHP...........................................----..--H.HEP..--....--....-----KTQCQT.D.....MTCA...R...--.....--.N.WV..........................GDPRG.....QS..C-.-..T..GTC........VQYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDELE................------evgeaaevgaegdggrpcsclt..........................................
A0A3Q2I4K6_HORSE/36-171              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCSVNTS.RE.LH...K.DT.........SL...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RFL.DVP..LC....KE....DCESWWEACRT.S.....YTCK...S...NW.....QK.G.WD..........................WTSGG.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------hlgvg...........................................................
A0A093BRP3_CHAPE/31-206              ...........................................................ICMDA....KHHKTK.PGPEG.....MLH.GQ.........................C.SP.WKDN...............................ACCTANTS.SE.AH...K.DQ.........SN...LY.NFNWNH..C..............G..V.....M...PP..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQad.......................................ssWRRE..RIL.HVP..LC....RE....DCEEWWEDCKD.Y.....VTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFSQIF.PH..PK...D.LC......EKIWSN.SYKYT....TERRG................SGRCIQ................................................................
A0A5E4CV45_MARMO/104-279             ...........................................................VCMNA....QHHKRE.PGPED.....ELY.VE.........................C.IP.WKDN...............................ACCTATTS.WE.AH...L.EV.........SP...LH.NFTLVH..C..............G..L.....L...TP..........SCQ.KHF...IQA..ICFYQCSP.NLGPW....IQLvg.......................................psGQGE..RIV.GVP..LC....RE....DCEEWWADCRT.S.....YTCK...S...NW.....YS.S.WH..........................WSQGK.....NR..CP.A..E..DIC........HPFPHYF.PT..PT...D.LC......EKIWRN.SFKAS....PEHRN................SGRCLQ................................................................
A0A1U7SMZ8_ALLSI/53-228              ...........................................................VCMDA....KHHKTK.PGPEG.....ELH.NQ.........................C.TP.WKDN...............................ACCTANTS.ME.AH...K.DQ.........SY...LY.SFNWNH..C..............G..G.....M...KD..........KCK.RHF...IQD..TCFYECSP.NLGPW....IVQtd.......................................tsWRRE..RIM.DVP..LC....KE....DCDQWWNDCQD.S.....FTCK...E...NW.....HK.G.WN..........................WTTGS.....NQ..CP.R..G..SEC........RPFKTVF.PQ..PA...D.LC......EKLWSR.SYKYT....TESQG................SGRCMQ................................................................
A0A3Q2VVC9_HAPBU/33-194              ..................................................qcldfkppf-----....------.--RPQ.....KEL.EF.........................C.IM.YKEF...............................GCCDYQKD.QE.LM...S.KY.........YQ..iMD.NFD---..-..............Y..S.....G...YT..........SCA.GFI...FDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....SE....YCFQFWNKCSF.T.....IPF-...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------lsgdpyianfrenqtslchyleihdkdycypyllnnqqltqnlggiqvnsdgclq.........
A0A6G1AE76_CROCR/26-208              ...........................................................VCMNT....KHHKRK.PGPED.....KLY.DE.........................C.IP.WKDH...............................ACCTARTS.WE.AH...L.DV.........SL...LY.NFSLVH..C..............G..L.....M...MP..........GCE.KHF...IQA..VCFYECSP.NLGPW....IRKvrrlg................................wgmdlsGPGE..RIL.DVP..LC....QE....DCEQWWEDCRT.S.....YTCK...S...NW.....HS.D.WN..........................WSRGK.....NR..CP.A..R..AVC........HPFPHYF.PT..PA...D.LC......EKIWNN.SFKAS....PEHRG................SGLCLQ................................................................
A0A1V9Z6B1_9STRA/11-177              ............................................crstgglkfdpaepp-----....------.RQQRP.....GAM.EH.........................C.AK.YAKN...............................TCCNATHV.LP.LK...R.LV.........LE..pLV.------..-..............A..G.....V...NG..........RCQ.ELS...EEL..TCSA-CHP.LMGTS....---...........................................----..---.RME.rVC....PD....LCDEWFDACKH.E.....FYMA...G...NH.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------hlapcygnalicsplkdivstsvtrrthvalieaycrgrdfcrrmgytpgkatdtegkdcfd..
A0A2K6N9T1_RHIRO/36-211              ...........................................................VCMNA....KHHKAQ.PSPED.....ELY.GQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DI.........SR...LY.NFNWDH..C..............G..K.....M...QP..........ACK.RHF...IQD..ACLYECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCEHWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WSSGI.....NE..CP.A..G..ALC........RTFESYF.PT..PA...A.LC......EGLWGH.SFKVS....NYSGG................SGRCIQ................................................................
A0A314KWB8_NICAT/41-192              ..................................................rfsnegkpp-----....----RK.VKKGP.....RDL.NL.........................C.RI.FRGK...............................TCCDVTQT.HP.AL...L.SI.........RR...LA.S-----..T..............G..E.....A...SQ..........ECL.HLW...EML..ECSI-CDP.RVG--....VQA...........................................----..---.GPP.vLC....TS....FCNKVYQACSN.A.....YFSM...D...A-.....KT.Q.VL..........................APCGV.....ND..F-.-..-..-VC........GRASQWI.SN..GT...E.LC......RV-AGF.SVKSL....SDDPE................EVSCY-g...............................................................
A0A5F4CBX9_CANLF/91-206              ...............................chpawarpwlppplaegsppswpptqvn-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....-QS...........................................WRKE..RIL.HVP..LC....RE....DCEQWWQDCRT.S.....YTCK...S...NW.....HR.G.WN..........................WTSGV.....NK..CP.A..R..TTC........RTYEAYF.PT..PA...A.LC......EGIWDH.SYKAT....NYSRG................SG----qt..............................................................
A0A401SFU6_CHIPU/99-260              ...........................................................TCPVT....GSHKAA.PSPEP.....DLH.D-.........................C.PL.YSKN...............................ACCTANIK.DK.VN...T.SP.........EA...VS.---WNQ..C..............G..R.....L...ST..........KCE.QFF...SQL..SCFYRCSP.DVTIW....ASP...........................................RHSN..SLL.NVP..LC....QG....FCDQWYKACEN.D.....QTCV...R...DW.....NA.G.LK..........................GSNRT....rGI..C-.-..T..SDC........IPFTKMY.KN..GK...D.LC......ESISGS.SFKVR....-----................SCNCLN................................................................
A0A151P3F2_ALLMI/66-228              ...............................................qcldygppfqpp-----....------.-----.....LHL.EF.........................C.SA.YEKF...............................GCCDQEKD.NS.IA...A.KY.........WE...IM.DYIS--..-..............P..Q.....G...HR..........LCG.RYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSEFHFNCHS.A.....ITLL...T...N-.....--.-.--..........................DKHIQ.....EC..C-.E..R..NKT........RFCNLLN.LQ..DQ...D.YCf....pNILKNT.DLNRNl..gSVVED................PKGCL-q...............................................................
E2R888_CANLF/47-206                  .................................................dfgppfqpal-----....------.-----.....-HL.EF.........................C.SD.YESF...............................GCCDQRKD.RR.LA...A.RY.........ED...IM.DYL-D-..-..............L..K.....G...YE..........LCG.GYV...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHS.A.....ISLL...T...ND.....HRpR.GP..........................QEVDG....aHF..--.-..-..---........--CHLLN.LP..DE...D.YC......------.-----....-----................------fpnvlrndhlnrnlgvvaqdqqgclq......................................
Q94BQ5_ARATH/38-198                  ......................................cvskggrfppyelegkppksv-----....------.-GRGS.....KDL.TL.........................C.RV.FRKK...............................TCCSSVQT.NP.AF...V.AV.........RN...LA.TY----..-..............G..E.....A...SQ..........ECL.ELF...ELL..ECSI-CNP.NVG--....IQP...........................................----..---.GPP.rIC....AS....FCDRVFEACKD.A.....YFAS...N...AL.....--.-.--..........................KRVIG....pCG..VN.D..D..IIC........IKASNWE.SN..GT...S.FC......EAA---.GFAVQ...rNDDSR................EKPCY-g...............................................................
A0A060WNJ3_ONCMY/33-194              ..........................................................q-CL--....DYKPPF.QPREP.....LVF.--.........................C.KE.YAKF...............................GCCDLEKD.DK.IS...Q.NF.........YK...IM.DY-FDY..S..............G..Y.....-...-M..........TCA.KYI...RTI..LC-QECSP.YSAHL....YDA..........................................eDANT..PMR.ELP.gLC....GD....YCSEFWHQCRY.T.....ISLL...T...DN.....NA.T.VG..........................IEEDR....nKF..C-.-..-..---........NF---LE.LK..DR...E.YC......------.-----....-----................------ypnvlsddklnanlgdvradpegclq......................................
A0A3Q3ASB6_KRYMA/46-208              ................................................qcldfeppfkp-----....------.---Q-.....WHL.EF.........................C.TQ.YQDF...............................GCCDQKTD.NM.IA...E.RY.........WD..iIE.--HLEK..-..............-..A.....G...YD..........LCE.AML...KKI..MC-QECSP.YAAHL....YDA..........................................eDPYT..PVR.DLP.gLC....FG....YCSKFHSKCRH.V.....LKYL...-...-T.....VN.Q.VL..........................LDTSE.....RD..M-.-..S..TFC........SIVD---.LS..DQ...D.YCy....pNVLKST.DLNSNl..gQVVED................PRGCL-q...............................................................
W5NI26_LEPOC/18-180                  ..............................................qcldyrppfkppf-----....------.-----.....-HL.EF.........................C.TE.YETF...............................GCCDQDTD.NA.IA...E.RY.........WD...IM.DFY---..D..............I..Q.....G...YE..........LCG.GFV...KDI..LC-QECSP.YAAHL....YDA..........................................eNPYT..PLR.NLP.gLC....FN....YCSEFHVKCHS.V.....VKLL...T...--.....--.-.-D..........................DKHIQ.....ET..C-.E..K..DRF........MFCSLLN.LP..DQ...D.YCy....pN-----.-----....-----................------vlqntilnrnlgsmvqdrsgclq.........................................
A0A401PDQ3_SCYTO/172-236             .........................................................tk-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................----..---.---..--....--....-----YKACEH.D.....QTCV...R...NW.....NT.D.LK..........................WSNRT....eGT..C-.-..T..SDC........ISFDKMY.KD..GK...D.LC......QSTSGD.SFKVK....-----................SCNCLN................................................................
G1SCR2_RABIT/35-210                  ...........................................................VCMDA....KHHKEK.PSPED.....KLH.EQ.........................C.SP.WKKK...............................ACCSTNTS.QE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.DVP..LC....KE....DCQRWWEDCRT.S.....HTCK...S...NW.....HK.G.WN..........................WTSGF.....NQ..CP.V..G..AAC........HPFHFYF.PT..PA...A.LC......EEIWSH.SYKAS....NYSRG................SGRCIQ................................................................
H9GSY7_ANOCA/1-64                    ...........................................................-----....------.-----.....---.-Q.........................C.SP.WKEL...............................ACCTANTS.QA.AH...Q.DV.........SY...LY.NFNWNH..C..............G..I.....M...TA..........KCK.AHF...IQD..TCLYECSP.NLGPW....VV-...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------q...............................................................
A0A397Z2E1_BRACM/37-197              ..........................................vcvskggrfppyesegk-----....------.-PPKPvgkgsKDL.TL.........................C.QV.FRKR...............................TCCSPAQT.NP.AF...V.AV.........RN...LA.TF----..-..............G..E.....A...SQ..........ECQ.HLF...ELL..ECSI-CNP.NIG--....VQP...........................................----..---.GPP.rIC....AS....FCNKVFAACKD.A.....YFAS...N...AL.....--.-.--..........................TQMIG....pCG..V-.N..D..IIC........VKTSSWE.SN..GT...S.FC......EAA-GF.SVQTN....-DDSR................KEPC--yg..............................................................
H0VJP2_CAVPO/12-187                  ...........................................................VCMNA....RYHKRE.PGPED.....KLF.LQ.........................C.AP.WKDN...............................ACCTATTS.WE.AH...R.SE.........SY...LH.NFSLIH..C..............G..L.....L...TP..........SCQ.RHF...IQA..TCFYECSP.NLGPW....IRLvd.......................................pqDLEE..RVL.GVP..LC....QE....DCEEWWADCSS.S.....YTCK...S...NW.....HG.G.WD..........................WSQGK.....SR..CP.A..G..ALC........RPFPDYF.PT..PA...D.LC......EKIWSN.SFKAS....SAHRN................SGRCLQ................................................................
F7GMA9_CALJA/22-183                  ...................................................qcldfkpp-----....-----F.--RPP.....QLL.TL.........................C.SR.YSAF...............................GCCDAKRD.AE.LT...S.RF.........WA...LA.NR---M..L..............A..A.....E...WA..........DCA.GYA...REL..LC-QECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....QD....YCLTMWQKCRR.L.....LRH-...-...--.....--.-.FS..........................TDKAL.....RA..L-.E..D..NRD........KFCHYLS.LD..DT...D.YCy....pDLMSNK.NLNSDl..gHMVAD................ATGCL-q...............................................................
A0A4S2LXB7_OPIFE/34-206              ...........................................................ICING....THHKKA.PSPEP.....TDD.HI.........................C.TD.WASM...............................SCCEHKTM.RS.VQ...-.-D.........SL...LY.GFNHSH..C..............K..P.....M...SQ..........KCI.NMF...KRE..LCFYECSP.HVGPW...lV-Ktq.......................................slRRRE..RSY.LVP..LC....EE....DCNKWYEACKN.E.....ETCV...R...DW.....SV.E.FE..........................WSEVSg...mNV..CP.A..D..SSC........ELFSNVY.KD..AS...D.FC......HAIWDG.GWKVE....-K---................APRC--mhf.............................................................
K8EAN2_9CHLO/37-209                  .......................................................mtmk----K....RCKNTN.DAPKK.....QPL.TF.........................C.DD.YRSH...............................TCCTSRDT.DR.IL...V.HH.........VE...MQ.R-----..-..............Q..S.....V...SA..........TCA.SLF...GRF..ECSK-CDArNLGGS....TRN..........................................nNNSE..DDD.RFK..VC....SA....YAKQLYRACKE.E.....YFVE...G...AV.....GG.G.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------vgagrgssglissggrltpckstdaicakleefsgnwkeavemmgakvvgrtkkkarl......
A0A093CE29_TAUER/3-129               ........................................................lsv-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETPE..REL.TLP.yLC....KD....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A3Q1MF97_BOVIN/26-167              ...........................................................VCMNA....KPHKPE.PGPEA.....ELY.EE.........................C.IP.WKDN...............................ACCTASTS.WE.AH...L.DV.........SL...LY.NFSLVH..C..............G..L.....M...MP..........DCQ.RHF...LQA..ICFYQCSP.NLGPW....IQQvd.......................................prWQAE..RVL.DAP..LC....LE....DCERWWADCRT.S.....HTCK...S...NW.....LG.G.WA..........................WSRGN.....SR..--.-..-..---........-------.--..--...-.--......------.-----....-----................------vvgktaegi.......................................................
A0A2R9CB09_PANPA/44-206              ...............................................qcldygppfqpp-----....------.-----.....LHL.EF.........................C.SD.YESF...............................GCCDQHKD.RR.IA...A.RY.........WD..iME.YFD---..-..............L..K.....R...HE..........LCG.DYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNTQT..PLR.NLP.gLC....SD....YCSAFHSNCHS.A.....ISLL...T...ND.....-R.G.LQ..........................ESHGR.....DG..T-.-..-..---........RFCHLLD.LP..DK...D.YC......------.-----....-----................------fpnvlrndylnrhlgmvaqdpqgclq......................................
U3FQI0_CALJA/38-220                  ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2K6GLL1_PROCO/22-183              .....................................................rcldfr-----....---PPF.RPPQP.....LR-.-F.........................C.AQ.YSAF...............................GCCAPEQD.AA.LA...R.RF.........GA...LAaRV----..D..............A..A.....V...WA..........ACA.GYA...LDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....QD....YCLDMWQTCRG.L.....FRHF...S...PD.....--.R.VL..........................WSLEG.....NR..A-.-..-..---........KFCHYLS.LD..DA...D.YCf....pHLLVNE.NLNANl..gRVVAD................AKGCLQ................................................................
A0A4U5Q2I8_POPAL/29-190              ...........................................vcvskggrfppysseg-----....------.KPPKKvgkgaRDL.TL.........................C.RL.FHKK...............................TCCDVAQT.YP.AS...L.SV.........RR...LA.S-----..T..............G..E.....A...SQ..........ECL.QLW...ELL..ECSI-CDP.QIG--....VQP...........................................----..---.GPP.lIC....AS....FCDRVYQACAS.A.....YFSM...D...AN.....--.-.--..........................QRVIA....pCG..V-.N..D..FVC........GQAAEWV.SN..GT...E.LC......HAA---.-----....-----................------gfavklsdayvgveevsc..............................................
A0A096MUT0_PAPAN/47-206              .................................................dygppfqpll-----....------.-----.....-HL.EF.........................C.SD.YESF...............................GCCDQHKD.RR.IA...A.RY.........WD..iME.YFD---..-..............L..K.....R...HE..........LCG.DYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....SD....YCSAFHSNCHS.A.....ISLL...T...ND.....-R.G.LQ..........................ESHGM.....DG..V-.-..-..---........RFCHLLD.LP..DK...D.YC......------.-----....-----................------fpnvlrnnylnrnlgmvaqdprgclq......................................
A0A091RFS2_9GRUI/7-165               ...........................................................ICMDA....KHHKTE.PGPEG.....QLY.GQ.........................C.VL.WKDN...............................ACCTANTS.ME.AH...L.DQ.........SY...LY.NFNWDH..C..............G..A.....M...PD..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDEtd.......................................ssWRKE..RIQ.NVP..LC....RE....DCEQWWEDCQD.A.....VTCK...V...NW.....HR.G.WN..........................WTSGT.....NQ..CP.R..G..AMC........QKFKFVF.PT..PA...Q.LC......EQIWS-.-----....-----................------................................................................
A0A183TCR0_SCHSO/1-112               ...........................................................-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................----..---.-MP..LC....QS....DCDAWYDACRK.G.....LTCA...R...NW.....RS.GgFNwtseeldtileqeinkvtsksvlkqkSPAGT.....NH..CH.E..G..LTC........QPIELVF.SS..AK...D.FC......EQVWDG.SWKVI....PDSKH................------vwldeeplclh.....................................................
A0A3R7MUC2_PENVA/16-201              ..........................................................w-CLDA....RHHKKL.PGPEG.....DLF.KQ.........................C.TP.WKTR...............................SCCTEEVT.RK.IH...E.DS.........--...LY.SFNFNH..Cmh.........qtkK..E.....M...SR..........ECH.RHF...KQD..HCFYECSP.NVGPW....VVSek.......................................rsWRKE..RYF.KVP..LC....AS....DCEAWFNSCAD.D.....YTCT...D...NW.....SR.N.FDwles.................sqctsGTKCK....tNF..CP.K..G..SDC........RTFKEIY.LT..AQ...N.FC......EKVWDD.AWEYT....---ND................SSPCM-r...............................................................
A0A3Q3BLK1_KRYMA/38-209              ..............................................chpqcldykppfg-----....------.--PQQ.....PLV.F-.........................C.KE.YTKF...............................GCCDLSKD.EE.IS...S.RF.........YT..iMD.NF--DH..-..............-..S.....G...FT..........TCG.KYI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.VLP.gLC....RD....YCSDYWWECRY.T.....LS--...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------llledlgnppqfanltsaieedhkrfcdvlelkdkqycypnvltnaelnanlglvredpkgcl.
A0A2P4SLX7_BAMTH/21-123              ..........................................................g-CLQG....DTHKAK.PSPEP.....NMH.E-.........................C.TL.YSES...............................SCCYANFT.EQ.LA...H.SP.........VI..kVS.NSYWNR..C..............G..Q.....L...SK..........SCE.DFT...KKI..ECFYRCSP.HAAHW....INP...........................................RYTA..AIQ.SVP..LC....QS....FCDDW------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------................................................................
A0A3L6QEC6_PANMI/135-286             ..................................................fssegkppg-----....------.RAPKG....rRDL.AL.........................C.RI.FRQN...............................TCCDVTQT.FP.AL...I.SV.........RN...LA.L-----..T..............G..E.....G...SQ..........ECI.HLW...ELL..ECSI-CDP.RVG--....VRP...........................................----..---.GPP.aIC....AS....FCDMVFKACSE.S.....YFSI...-...--.....-D.T.KT..........................QALSP.....CG..L-.G..D..ILC........GKAHKWV.SN..GT...E.LC......RLA-GF.SV---....-----................------qvsgtssglvddifc.................................................
H2TG96_TAKRU/121-296                 ...........................................................MCMDA....KHHKKV.PGPEG.....QLY.LQ.........................C.AP.WRDN...............................ACCTANTS.TE.AH...E.DN.........SY...LY.NFNWNH..C..............G..A.....M...SD..........ECK.KHF...IQD..TCFYECSP.HLGPW....IQEvd.......................................qsWRKE..RIF.NVP..LC....KE....DCHEWWEDCKN.E.....FTCK...S...NW.....HT.G.WD..........................WSSGI.....NK..CP.A..D..RKC........RKWTEVY.PT..PK...Y.MC......EQIWSN.SYLYT....TYSKT................SGRCMQ................................................................
A0A674F571_SALTR/44-205              ..................................................qcldfkppf-----....------.KPQ--.....EDL.QF.........................C.AM.YRNF...............................GCCDSAKD.QE.LM...A.KF.........YK..iVD.NFD---..-..............N..Y.....A...YA..........NCA.GYV...QDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PIR.TLP.gLC....PD....YCSQFWLKCRS.T.....ITLL...S...DD.....LQ.L.AQ..........................AKPDQ....vHF..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------qhleledpdycyphllsnqqltqnlghvradpegclq...........................
A0A4W2D026_BOBOX/35-210              ...........................................................VCMDA....KHHKAE.PGPED.....SLH.EQ.........................C.SP.WRKN...............................ACCSVNTS.IE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IREvn.......................................qrWRKE..RVL.GVP..LC....KE....DCQSWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGY.....NQ..CP.V..K..AAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SYKAS....NYSRG................SGRCIQ................................................................
V8N7K0_OPHHA/78-142                  .................................................qqggqpgwaw-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....-S.R.WP..........................QTQSE....nRQ..CP.V..G..TMC........QKMKRVF.PN..PQ...D.LC......EKIWSN.SYKYT....TLSRG................SGLCIQ................................................................
A0A091J841_EGRGA/21-188              ..........................................................g-CLEG....DTHKLK.PSPEP.....NMH.E-.........................C.TL.YSKS...............................SCCYADFT.EQ.LA...H.SP.........VI..kVR.NSYWNR..C..............G..Q.....L...SK..........PCE.DFT...KKI..ECFYRCSP.HAAHW....IHP...........................................NYTA..AIQ.SVP..LC....QS....FCDDWYEACKD.D.....SICA...H...NW.....LT.D.WE..........................WDESG....eNR..C-.-..K..SKC........IPYSEMY.TN..GT...D.MC......QSMWGE.SFKVS....---ES................SCLCLQ................................................................
A0A2K6RRY4_RHIRO/22-183              ..................................................qcldfrppf-----....------.--RPP.....QLL.RL.........................C.AQ.YSDF...............................GCCDEGRD.AE.LT...R.RF.........WD...LAsRV----..D..............A..A.....E...WA..........ACA.GYA...RDL..LC-QECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRG.L.....FRHL...S...TD.....RE.L.Q-..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------alegnrarfcrylslddmdycfpyllvnknlnsnlghvvadakgclq.................
A0A1U7QHH8_MESAU/31-206              ...........................................................VCMDA....KHHKEK.PGPED.....NLH.NQ.........................C.SP.WKKN...............................SCCSTNTS.QE.AH...E.DI.........SY...LY.RFNWDH..C..............G..K.....M...TP..........ECK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.DVP..LC....KE....DCQRWWQDCRT.S.....FTCK...S...NW.....HK.G.WN..........................WTSGH.....NQ..CP.V..G..ASC........HPFDFYF.PT..PA...A.LC......EEIWSH.SYKLS....NYSRG................SGRCIQ................................................................
L5LKC4_MYODS/27-177                  ..........................................................a-C---....GRSRAL.PIRSQ.....RHH.RL.........................A.AD.LGTG...............................QLHLAEMD.TA.EA...P.EP.........GI...LS.----EG..C..............R..K.....P...SP..........RCE.SFL...GHL..QAALRSRF.RLLLL...gVHQ...........................................----..---.TQL..LC....PE....LCHAWVAICKS.A.....ITC-...-...--.....GP.T.WL..........................PPLEK.....RD..C-.-..D..PGC........RTFGQTF.AD..RV...D.LC......RSVPGY.TLPAV....--VPG................GGDCLN................................................................
A0A3P8T9E3_AMPPE/37-209              ................................................cchpqcldykp-----....----PF.QPHQ-.....PLV.F-.........................C.KE.YSKF...............................GCCDVEKD.EQ.IS...H.RF.........YT..iME.N--FDH..S..............G..Y.....V...--..........TCG.RYI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.MLP.gLC....GD....YCSDYWHQCRY.T.....L---...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------gllledsgspqqfanltatieedrrkfcdflelkdqqycypnvlmntelnanlglvredpkgcl
A0A2Y9DQ33_TRIMA/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.PQldlls...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.VD.........NK...IF.S-----..-..............V..T.....N...NT..........ECR.KLL...EEI..KCAH-CSP.HSQNL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A6J3QW28_TURTR/31-192              ......................................................qcldf-----....--RPPF.RPPQP.....LR-.-F.........................C.AQ.YSAF...............................GCCAPEHD.AA.LA...R.RF.........GA..lAA.RV----..D..............A..A.....I...WA..........ECA.GYA...LDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDLWQSCRG.L.....FRHL...S...PD.....RE.L.WT..........................LEGNR....aKF..--.-..-..--C........RYLS---.LD..DT...D.YCf....pHLLVNE.NLNSNl..gRVVAD................AMGCL-q...............................................................
A0A210PDV1_MIZYE/48-187              .......................................................fcsf-----....-FNNRA.PEPQP.....NLK.N-.........................C.TW.FKEN...............................SCCMQEEI.AE.TF...E.QV.........KS...LP.------..-..............-..G.....A...SP..........ACQ.QYT...NYL..MC-YICAP.YQNMF....YIW...........................................----..--G.YLK..VC....EE....FCDAWYGACGS.A.....ILKG...S...RV.....NQ.L.--..........................YTNGS.....DF..C-.-..K..SRS........YKVSTIA.QK..--...-.--......------.-----....-----................------dcfffdklmdttngqrs...............................................
A0A091UZ53_NIPNI/1-110               ...........................................................-----....------.-----.....---.-Q.........................C.AL.WKEN...............................ACCTANTS.VE.AH...Q.DQ.........SY...LY.NFNWDH..C..............G..A.....M...PE..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQvd.......................................nsWRKE..RIL.HVP..LC....RE....DCEQWWEDCQD.A.....VTCK...V...NW.....HK.G.WN..........................WTS--.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------g...............................................................
A0A3Q2EC14_CYPVA/37-198              .................................................qcldfkppfr-----....------.---PN.....RDL.EF.........................C.VM.YREF...............................GCCDQQKD.QE.LM...A.RY.........YQ..iME.NL--D-..-..............L..G.....G...YE..........SCA.AFV...MEL..LC-QECSP.YAAHL....FDA..........................................eDPST..PLR.TIP.gLC....PD....YCSQFWNECRS.V.....IPSL...S...ND.....HR.L.HH..........................AKDNQ.....NR..L-.-..-..--C........---KLLE.LD..DA...D.YCy....pHLLSNQ.KLTQNl..gRVQRD................SDGCLQ................................................................
A0A0D9RDG0_CHLSB/24-185              ..................................................qcldfrppf-----....------.--RPP.....QLL.RL.........................C.AQ.YSDF...............................GCCDEGRD.AE.LT...R.RF.........WD...LE.S---RV..D..............A..A.....E...WA..........ACA.GYA...RDL..LC-QECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRG.L.....FRHL...S...TD.....--.-.--..........................--QEL.....QA..L-.E..G..NRA........RFCRYLS.LD..DT...D.YCf....pYLLVNK.NLNSNl..gHVVAD................AKGCL-q...............................................................
A0A672JKW0_SALFA/49-221              ..................................................chpqcldyk-----....---PPF.EPRQP.....LIF.--.........................C.KE.SSKF...............................GCCDLEKD.EE.IS...R.RF.........YR..iME.N--FDH..S..............G..Y.....I...--..........TCG.KYI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.MLP.gLC....GD....YCSDYWHNCRY.T.....LSLL...L...EE.....IG.S.P-..........................QQFGN....qTS..MM.E..E..DRR........GFCDFLE.LK..DK...Q.YCy....pNVLTNA.ELNENl..gSVRED................SQGCL-e...............................................................
A0A060W5W4_ONCMY/34-195              ..................................................qcldfkppf-----....------.KPQ--.....EDL.QF.........................C.AM.YRNF...............................GCCDSAKD.QE.LM...A.KF.........YK..iMD.NFD---..-..............N..Y.....G...YA..........NCA.GYV...QDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PIR.TLP.gLC....PD....YCSQFWLKCRS.T.....ITLL...S...DD.....LQ.L.AQ..........................AEPDQ....vHF..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------qhleledpdycyphllsneqltqnlghvladpegclq...........................
F7DLZ1_XENTR/48-210                  ..................................................qcldyappf-----....------.KPP--.....AHL.EF.........................C.SQ.YETF...............................GCCDQDRD.NA.IA...E.KY.........WS..iMD.YFD---..-..............L..N.....G...YH..........TCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eDPHT..PLR.IIP.gLC....FN....YCSEFHLKCQS.S.....VTLL...T...E-.....--.-.--..........................DKQIR.....ES..C-.N..K..GRD........LFCNLLN.LP..DE...D.YCf....pN-----.-----....-----................------vlhntdlnnnlgsvvedpegcmk.........................................
S8CER6_9LAMI/17-162                  ..................................................pftvdgkpp-----....-----K.KSRKG....pGDL.SV.........................C.RI.FRRR...............................TCCDSTQT.HP.VF...L.SV.........RT...LA.S-----..S..............G..E.....A...TQ..........DCL.HLW...ELL..ECSI-CDP.SVG--....VTP...........................................----..---.GPP.rIC....AS....FCHRVFEACST.A.....YFST...D...P-.....--.T.KQ..........................A-S--.....PC..RG.S..D..FVC........GRASEWV.AN..GT...E.LC......HI----.-----....-----................------agfsvdnedrlscy..................................................
A0A024UI10_9STRA/18-172              ............................................qplcrstggikfdpt-----....---EPS.RQQKQ.....RSL.EH.........................C.SK.YWQN...............................SCCNETHT.IP.LK...L.RV.........ME...--.----PH..V..............A..M.....F...NS..........KCQ.ALH...EEL..TCSV-CHP.FVGTG...rMD-...........................................----..---.--R..IC....PD....LCDDWFDACKD.E.....FYT-...-...PD.....GS.Q.AL..........................SPCYG.....NA..L-.-..-..-IC........SPLHTIL.ST..GR...D.FC......KAM-GY.-----....-----................------tpgkstdtdgvtcfd.................................................
A0A553QUI6_9TELE/54-216              ..............................................qcldyqppfkplw-----....------.-----.....-HL.EF.........................C.RH.YEKF...............................GCCDQKTD.NN.IA...T.RY.........WD...VM.----DL..I.............gD..E.....G...YE..........VCG.DLV...KDI..MC-QECSP.YAAHL....FDA..........................................eDPYT..PVR.HLP.gMC....HQ....YCSDFLKKCQF.V.....VKYL...T...NN.....--.Q.AL..........................Q----.....-E..MS.E..R..DAS........HFCNLIN.LP..DQ...D.YC.....yPNVLSN.SILYSn.lgKVVED................TKGCL-q...............................................................
A0A674NVP1_TAKRU/29-168              ....................................................qcldykp-----....----PF.QPQQ-.....PLV.F-.........................C.KE.YSKF...............................GCCDLQKD.EE.IR...I.RF.........YT..iME.--NFDH..S..............G..Y.....V...--..........TCS.RYI...HSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.ILP.gLC....GN....YCADYWHRCRY.T.....MSLL...-...--.....LE.D.LG..........................VLHQY.....KG..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------qvnkvtlqvcvmyvlspel.............................................
A0A1S3AF88_ERIEU/21-196              ...........................................................VCMRS....AHHKPK.PSPED.....QLY.EE.........................C.AP.WKAN...............................ACCTANTS.WL.AH...L.DV.........SP...LL.GASLSH..C..............G..L.....L...AP..........DCR.RHF...TRA..LCFLHCSP.NLGPW....IRPep.......................................gaLQAR..RAA.GVP..LC....KE....DCEQWWEDCRS.A.....STCK...D...DW.....LH.G.WH..........................RSGGR.....TR..CP.P..G..ASC........RPFPRVF.PG..PA...A.LC......GRLWGG.TFRAS....GEPRG................SGRCLQ................................................................
A0A3Q1GNY2_9TELE/38-210              ...............................................schpqcldykpp-----....-----F.QPHQ-.....PLV.F-.........................C.KE.YSKF...............................GCCDVEKD.EQ.IS...Q.RF.........YT..iME.NF--DH..S..............G..-.....-...YS..........TCG.RYI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.ILP.gLC....GD....YCSDYWHQCRY.T.....LS--...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------llledsgspqqfanltaiieedrrkfcdflelkdkqycypnvltnaelnanlglvredpkgcl.
A0A3N0Z0F1_ANAGA/53-215              ......................................................qcldy-----....--QPPF.KPP--.....YHL.EF.........................C.RH.YEKF...............................GCCDQKTD.NN.IA...T.RY.........WD...IM.----DL..I..............G.eE.....E...YA..........VCG.DLV...KDI..MC-QECSP.YAAHL....FDA..........................................eDPYT..PVR.HLP.gLC....FT....YCSDFHSKCHS.V.....VKYL...T...N-.....--.-.--..........................SRTLQ.....ET..C-.E..K..DRS........HFCNLIN.LP..DQ...D.YCy....pNVMRNN.DLYSNl..gKVVED................TKGCLQ................................................................
S7MJ59_MYOBR/27-170                  ...........................................................VCMDA....KHHKER.PSPED.....KLH.EQ.........................C.GP.WKKN...............................ACCSVNTS.QE.AH...E.DV.........SY...LY.RFNWDH..C..............G..P.....M...KP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRRE..RIL.DVP..LC....KE....DCESWWEDCRT.S.....YTCK...G...NW.....HK.G.WN..........................WTAEL.....NL..L-.-..-..---........-------.--..--...-.--......------.-----....-----................------kkpthlspsf......................................................
A0A3Q1F5K7_9TELE/38-210              ...............................................schpqcldykpp-----....-----F.QPHQ-.....PLV.F-.........................C.KE.YSKF...............................GCCDVEKD.EQ.IS...Q.RF.........YT..iME.NF--DH..S..............G..-.....-...YS..........TCG.RYI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.ILP.gLC....GD....YCSDYWHQCRY.T.....LS--...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------llledsgspqqfanltaiieedrrkfcdflelkdkqycypnvltnaelnanlglvredpkgcl.
A0A1V4JUL1_PATFA/1-154               ..........................................................m-----....------.-----.....---.--.........................C.RG.LYPR..............................lSCCSRTDA.QG.LL...H.AE.........AK..iLS.------..-..............V..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETPE..REL.TLP.yLC....RD....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKDEEi..sRKHKH................NCFCIQ................................................................
A0A2Y9L219_ENHLU/31-206              ...........................................................VCMDA....KHHKEK.PSPED.....ELH.KQ.........................C.SP.WKKN...............................SCCSTNTS.QE.AH...K.DI.........SY...LY.RFNWNH..C..............G..H.....M...TP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.DVP..LC....KE....DCQQWWEDCRT.S.....YTCK...S...NW.....HQ.G.WD..........................WTSGY.....NR..CP.A..G..AAC........LPFHFHF.PT..PA...A.LC......SEIWTH.SYQAS....NYSRG................SGRCIQ................................................................
K7FXM7_PELSI/32-199                  ...........................................................RCLEG....ETHKPR.PSPEP.....DMH.E-.........................C.TL.YSES...............................SCCYANFT.EQ.LA...H.SP.........VI..kVS.HSSWDR..C..............G..E.....L...SK..........SCE.EYM...KKI..ECFYRCSP.HAAHW....INP...........................................NYTS..GIK.LVP..LC....QN....FCDDWYEACKS.D.....LTCV...H...NW.....LT.D.WE..........................WDENG....eNH..C-.-..K..NEC........ISYDKVY.AN..GT...D.LC......QSMWGD.SFKVS....---DS................SCLCLQ................................................................
A0A2K5MME5_CERAT/20-181              ..................................................qcldfrppf-----....------.--RPP.....QLL.RL.........................C.AQ.YSDF...............................GCCDEGRD.AE.LT...R.RF.........WD...LAsRV----..D..............A..A.....E...WA..........ACA.GYA...RDL..LC-QECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRG.L.....FHHL...S...T-.....--.-.--..........................-DQEL.....RA..L-.E..G..NRA........RFCRYLS.LD..DT...D.YCf....pYLLVNK.NLNSNl..gHVVAD................AKGCL-q...............................................................
A0A5N5MMC4_9ROSI/70-233              .......................................vciskggrfppytsegkppk-----....-----K.VSKGA.....KDL.TL.........................C.RV.FRKK...............................TCCDVAQT.YP.AS...L.SA.........RR...LA.S-----..T..............G..E.....A...SQ..........ECL.QLW...ELL..ECSI-CDP.QIG--....VQP...........................................----..---.GPP.lIC....AS....FCDRVYQECAN.A.....YFSM...D...AN.....-K.Q.VI..........................APCGL.....NE..--.-..-..FVC........GQAAEWV.SN..GT...E.LC......HAA---.-----....-----................------gfavklsddayvgaeeascy............................................
A0A672Z3F5_9TELE/16-188              ...................................................chpqcldy-----....--KPPF.EPRQP.....LVF.--.........................C.KE.YSKF...............................GCCDLERD.EE.IS...V.RF.........YS..iMD.NF--DH..S..............G..F.....-...-V..........TCG.KFI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.LLP.gLC....GD....YCTDYWHQCRY.T.....LSLL...L...ED.....LG.N.PQ..........................QFANM....tAG..L-.-..E..EDS.......rRFCDFLE.LK..DR...Q.YCy....pNVMTNE.DLNANl..gSVRED................ATGCL-e...............................................................
A0A1U8DXJ0_ALLSI/26-201              ...........................................................ICMDA....KHHKAK.PGPEG.....ELH.GQ.........................C.TP.WKAN...............................ACCTGNTS.TE.AH...Q.DQ.........SY...LY.RFNWNH..C..............G..V.....M...PR..........KCK.RHF...IQD..TCLYECSP.NLGPW....IVKtd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKD.Y.....VTCE...E...NW.....HK.G.WN..........................WATGT.....NH..CP.W..G..TMC........RPFKQVF.PR..AA...D.LC......EKIWSD.SYRYT....TAPRG................SGRCIQ................................................................
A0A674HIQ0_TAEGU/30-203              .......................................................hgrq-----....-TPQER.AGPEG.....RLY.QQ.........................C.SP.WKDN...............................ACCTANTS.LE.AH...K.DQ.........SY...LY.NFNWNH..C..............G..V.....M...PA..........KCK.RHF...IQD..TCLYECSP.NLGPW....IEQvd.......................................ssWRRE..RIL.HVP..LC....RE....DCEEWWEDCKD.A.....LTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFSQVF.PR..PQ...D.LC......EKIWSN.SFRYS....PEPRG................SGRCIQ................................................................
A0A368UHK4_SOYBN/40-203              ...............................................vcvsqggrfppf-----....KSEGST.PKKGP.....KDL.TL.........................C.RI.FRKK...............................TCCDVTHT.HP.AL...L.SV.........RK...LA.S-----..T..............G..E.....A...SQ..........ECL.HLW...ELL..ECSI-CDP.RVG--....TQP...........................................----..---.GPP.lIC....AS....LCERIYEACSN.A.....YFSM...-...DV.....KT.Q.IL..........................APCGV.....ND..F-.-..-..-VC........GRAAEWV.SN..GT...D.LC......LAA---.GFRVK....-----................------psesdivhiaseetscyg..............................................
A0A654GI13_9CEST/42-221              ...........................................................MCRYR....PHHKSA.PSPEP.....DLE.D-.........................C.AE.WRNL...............................SCCTKENS.EG.YL...-.-E.........KA...VE.GFDLHH..C..............S..Q.....P...LP.........lECS.RLF...HRE..YCHAYCSP.YLGPW...lVKTh........................................skRFPE..RAY.GMP..LC....QS....DCDAWYDACKK.G.....LTCA...R...NW....hAG.G.FN..........................WTTGT.....NQ..CR.A..G..LTC........QPIELVF.PS..AK...D.FC......EQVWDG.SWKVI....PDSKHvw...........lddEPQC--lh..............................................................
G1U5B1_RABIT/2-160                   ........................................................aev-----....------.-----.....---.-Q.........................C.SP.WRKN...............................ACCSVSTS.QE.LH...K.DG.........SR...LY.NFQWDH..C..............G..K.....M...EP..........ACK.QHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.DVP..LC....KD....NCQRWWEDCRT.S.....HTCK...S...NW.....HK.G.WD..........................WTSGV.....NR..CP.A..G..ATC........RTFESYF.PT..PA...A.LC......EGLWSH.SYKVS....NYSSG................SGRCIQ................................................................
A0A5F5XUN5_FELCA/46-110              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.TP.WRKN...............................ACCSHNTS.QE.LH...K.DP.........SL...LY.NFNLDH..C..............G..K.....I...EP..........ACK.S--...---..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------pp..............................................................
H2QQ84_PANTR/38-220                  ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................egEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2U4BPN7_TURTR/30-205              ...........................................................VCMDA....KHHKVK.PGPED.....KLH.DQ.........................C.IP.WKKN...............................ACCSAKVS.QE.LH...R.DT.........SS...LY.NFNWEH..C..............G..K.....M...KP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.NVP..LC....KE....DCQIWWEDCRT.S.....YTCK...A...DW.....HK.G.WN..........................WTSGS.....NK..CP.T..G..TTC........GTFEFYF.PT..PA...A.LC......EGLWSN.SYKLS....NYSRG................SGRCIQ................................................................
A0A3R7D121_CLOSI/65-236              ...........................................................ICMNG....THHKKA.PSPEP.....TDD.HI.........................C.TD.WASM...............................SCCEHQTM.RS.VQ...-.-D.........SL...LY.NFDHSH..C..............K..P.....M...SP..........ECI.DMF...KRE..LCFYECSP.HVGPW...lV-Ktq.......................................slRRKE..RSY.LVP..LC....EE....DCNMWYEACKN.E.....ETCV...R...DW.....SV.E.FE..........................WSKESg...mNV..CP.T..N..TSC........EPFSDVY.KN..AS...D.FC......HAIWDG.GWKVE....-K---................APRC--mh..............................................................
A0A5J5CGN2_9PERO/164-326             ..............................................qcldfeppfkpsw-----....------.-----.....-HL.EF.........................C.TQ.YEQF...............................GCCDQKTD.NT.IA...E.RY.........WD..iID.QLE---..-..............A..A.....G...HE..........LCA.DML...KEI..MC-QECSP.YAAHL....YDA..........................................eDPYT..PVR.ELP.gLC....SG....YCSEFHGKCRH.V.....VKY-...-...LT.....GN.Q.LL..........................WDTPG.....RD..V-.-..S..TFC........SMVDL--.-S..DQ...D.YCy....pNVLKSP.DLNSNl..gQVAED................PRGCLQ................................................................
M7BFF1_CHEMY/76-239                  ....................psqslhcsmgehdareetsnckmfgagivsllyvytrdr-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.-----Q..C..............L..A.....C..gQP..........GCE.DYM...KKI..ECFYRCSP.HAAHW....INP...........................................NYTA..GIE.FVP..LC....QN....FCDDWYEACKN.D.....STCI...R...NW.....MT.D.WE..........................WDENG....vNH..C-.-..K..NEC........IPYNKPI.QS..DH...C.--......------.-----....-----................------lhnvydnqgvsdfslrvalqtllkeycev...................................
A0A484CBS7_PERFV/57-219              ..............................................qcldfeppfkpsw-----....------.-----.....-HL.EF.........................C.TQ.YEQF...............................GCCDQKTD.NM.IA...E.RY.........WD..vID.QLE---..-..............A..A.....G...HE..........LCA.DML...KEI..MC-QECSP.YAAHL....YDA..........................................eDPYT..PVR.ELP.gLC....FG....YCSEFHEKCRH.V.....VKY-...-...LT.....GN.K.LL..........................WNTSG.....RD..V-.-..S..TFC........SMVDL--.-S..DQ...D.YCy....pNVLKSP.DLNSNl..gQVAED................PQGCLQ................................................................
A0A392MDZ5_9FABA/7-119               ..............................................vcvsqggrfppfk-----....-SEGNP.PKRGP.....KDL.TL.........................C.RV.FRKK...............................TCCDVTHT.HP.AL...L.SV.........RK...LA.-----S..G..............G..E.....A...SQ..........ECL.HLW...ELL..ECAI-CDP.RVG--....TQP...........................................----..---.GPP.lIC....AS....LCERIYDACSN.A.....YFSM...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------dvktqv..........................................................
A0A3Q1G199_9TELE/35-210              ............................................wwgschpqcldykpp-----....-----F.QPHQ-.....PLV.F-.........................C.KE.YSKF...............................GCCDVEKD.EQ.IS...Q.RF.........YT..iME.NF--DH..S..............G..-.....-...YS..........TCG.RYI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.ILP.gLC....GD....YCSDYWHQCRY.T.....LS--...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------llledsgspqqfanltaiieedrrkfcdflelkdkqycypnvltnaelnanlglvredpkgcl.
A0A672Z516_9TELE/37-210              ..................................................schpqcldy-----....--KPPF.EPRQP.....LVF.--.........................C.KE.YSKF...............................GCCDLERD.EE.IS...V.RF.........YS..iMD.NF--DH..S..............G..F.....-...-V..........TCG.KFI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.LLP.gLC....GD....YCTDYWHQCRY.T.....LSLL...L...ED.....LG.N.PQ..........................QFANM....tAG..L-.-..E..EDS.......rRFCDFLE.LK..DR...Q.YCy....pNVMTNE.DLNANl..gSVRED................ATGCL-e...............................................................
A0A3N0Z8E3_ANAGA/311-489             ....................................iraqtggtavsagmslsallkik-----....------.-----.....---.-I.........................C.SP.WKES...............................ACCTANTT.EE.AH...Q.DN.........SY...LY.NFNWNH..C..............G..I.....M...SD..........KCK.KHF...IQD..TCFYECSP.HLGPW....IQPan.......................................etWRKE..RIL.DVP..LC....RE....DCESWYEDCKN.D.....YTCK...E...NW.....HK.G.WD..........................WSTGI.....NH..CP.K..G..SHC........SRWTEIF.PS..AQ...D.MC......EKIWSN.SYKYT....TLSKG................SGRCMQ................................................................
A0A1U7SYQ8_CARSF/30-205              ...........................................................VCMDA....KHHKTK.PGPED.....ELH.GQ.........................C.SP.WRKS...............................ACCTVDTS.QE.LH...K.DT.........SR...LY.NFNWEH..C..............G..T.....M...EP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RFL.NVP..LC....KD....DCQSWWQDCRT.S.....YTCK...S...NW.....HE.G.WD..........................WSSGV.....NK..CP.T..G..ATC........RTFESYF.PT..PA...A.LC......EELWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A314YQ87_PRUYE/27-183              ..........................................cidsrapstlssplkfc-----....------.-----.....---.--.........................-.-P.YNET...............................ACCNSTED.SQ.IQ...K.QF.........QT...MN.------..-..............-..I.....S...NS..........GCA.SLL...KSV..LCA-RCDP.FSGEL....FTVdsvprpvp..........................llcnstvsaNSSQ..SIQ.DV-..--....ND....FCSNIWDTCQN.V.....SILN...S...P-.....--.-.FA..........................PSLQG....qAG..VP.V..K..SNV........SELTKLW.QS..KA...D.FC......NAFGG-.-----....-----................------assdgs..........................................................
C3Y1A9_BRAFL/437-606                 ..........................................................g-CLGG....RTNKRT.PGPEP.....DLQ.V-.........................C.SE.YSMN...............................SCCSAEFD.QQ.LR...M.SP.........VV..kID.KFYMNR..C..............G..T.....M...SP..........RCE.QFG...LAM..NCHYHCDP.MIYRY....GKR...........................................GHPW..AVQ.NIP..IC....SS....FCDDFFDACRD.D.....LTCA...E...SQ.....AT.D.WY..........................YSPEG....iNN..CR.P..D..SKC........RTFAEVY.VD..GR...G.LC......NNIWGD.SYVYT....---ED................DDTCI-n...............................................................
I3IVA9_ORENI/44-206                  ................................................qcldfkppfkp-----....------.--PW-.....-HL.EF.........................C.NQ.YEQF...............................GCCDQGTD.NM.IA...E.RY.........WD..iIE.QLE---..-..............A..A.....G...HE..........LCT.DML...KEI..MC-QECSP.YAAHL....YDA..........................................eDPYT..PVR.EIP.gLC....FD....YCSEFHSKCRH.V.....LKYL...-...-T.....VN.Q.LL..........................LYAAE.....RD..V-.-..T..TFC........SM---VD.LP..DQ...D.YCy....pNVLKSS.DLNSNl..gQVVED................PRGCL-q...............................................................
W5KWD9_ASTMX/32-207                  ...........................................................MCMNG....KHQKTE.PGPEG.....ELY.KQ.........................C.VP.WREN...............................ACCTANTS.AE.AH...E.DN.........SY...LY.NFNWNH..C..............G..V.....M...SP..........KCK.SHF...VQD..TCFYECSP.HLGPW....IQLad.......................................ssWRKE..RII.DVP..LC....LE....DCESWYNDCKY.D.....FTCK...D...NW.....HK.G.WD..........................WSSGT.....NH..CP.T..G..AEC........RLWSDVF.PD..AK...S.MC......ENIWTN.SYKYT....TLTKD................SGRCMQ................................................................
A0A4W5KDX8_9TELE/36-207              ...........................................................RCYDG....SMPKRL.KKRER.....KLS.VDsgas.................sgevC.HR.LYPR..............................vSCCPTRRA.AY.QI...V.HR.........RD...AR.IF----..-..............S..T.....N...NT..........ECS.RLL...EEI..KCAH-CSP.NAQVL....FHSpe.......................................ldKVPL..REP.HLP.rLC....QD....YCREFYYTCRG.H.....IPEL...-...-F.....QA.D.V-..........................DEFCQ....yYG..RR.D..G..GLCf.....pdFHRKQTR.GQ..DS...N.YL......------.-----....-----................------gdekvedinrfvt...................................................
F6ZR48_HORSE/72-247                  ...........................................................VCMDA....KHHKQK.PGPED.....TLH.EQ.........................C.NP.WKEN...............................SCCSLTTS.QE.AH...K.DI.........SH...LY.RFNWDH..C..............G..R.....M...EA..........IRK.RHF...IQD..TCLCECSP.NLGPW....IQQvd.......................................qsWSKE..RIL.DVP..LC....KE....DCPCRWEDCHP.S.....YTCK...T...NW.....HK.G.WN..........................CTSGF.....NQ..CP.V..E..AAC........RPFDFYF.PT..PE...A.LC......NEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A4X2KWJ3_VOMUR/39-222              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQmesls...............gaeavC.GA.FYPR..............................lSCCSRIDS.QS.LL...H.ME.........SK...IF.S-----..-..............V..T.....N...NT..........ECV.KLV...EEI..RCAH-CSP.HSQNL....FHSse.......................................rgDASE..RDL.ALP.lLC....ED....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yHA..RK.D..G..GLCf.....pdFPRKQVR.GP..TS...N.YL......DQMEEY.DKVDEi..sRKHKH................SCFCAQ................................................................
A0A1D5QFI7_MACMU/59-215              ..........................................................a-C---....GGSHPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagTCCPSEMD.AT.EI...S.GP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A674GAC0_TAEGU/35-217              ...........................................................RCLNG....TPPRRL.KKRDR.....RVL.SPeapg................ggeamC.RG.LYPR..............................lSCCSRSEA.QG.LP...H.AE.........AK..vLS.------..-..............V..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETPE..KEL.MLP.yLC....KD....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.AA..........................DEFCY....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A2U3WNY1_ODORO/27-213              ...........................................................VCMNT....KHHKRE.PGPED.....KLY.EE.........................C.LP.WQGN...............................ACCTAGTS.WE.AH...L.DV.........SL...LY.NFSLLH..C..............G..V.....M...MP..........GCE.KHF...LQA..VCFYQCSP.NLGPW....IRKvrrlgqg............................ggrhmdsgGPGE..RIL.DAP..LC....QE....DCEQWWEDCRT.S.....YTCK...S...NW.....HG.D.WD..........................WSGGK.....NR..CP.A..R..AVC........RPFPHYF.PT..PA...D.LC......EKIWSR.SFKAS....PEHRG................SGQCLQ................................................................
A0A2U3V4B3_TURTR/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........SK...MF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lLC....KD....YCKEFFYTCRG.H.....VPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A091HGA7_BUCRH/6-165               .................................................dygppfqpsf-----....------.-----.....-HL.EF.........................C.SA.YENF...............................GCCDQERD.NS.IA...A.KY.........WD...IM.DYID--..-..............P..K.....G...HK..........LCG.TYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNRRT..PLR.NLP.gLC....FD....YCSKFHFNCRS.A.....ISL-...-...--.....--.-.LT..........................HDKHI.....QE..CR.E..T..NKT........CFCNLLH.LH..DE...D.YCf....pNVLKNT.ALNRNl..gSVVED................RKGCL-q...............................................................
A0A5F5PPM8_HORSE/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GA.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEALE..RDL.ELP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEm..sRKHKH................NCFCIQ................................................................
A0A2K5F404_AOTNA/37-193              ..........................................................a-C---....GGSRSL.QARSQ.....RHH.GL.........................A.TD.LGKDkph.........................lagPCCPSEMD.TT.ET...S.GP.........GN...--.--YPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A0D2R9S0_GOSRA/43-205              .........................................cvsqggrfppfssegkpp-----....------.---KRvgkghKDL.TL.........................C.RV.FRKK...............................TCCDAAQT.HP.AL...L.SI.........RR...LA.L-----..T..............G..E.....A...SE..........ECL.HLW...ELL..ECSI-CDP.RVG--....VQP...........................................----..---.GPP.lIC....TS....FCDRVFQACSN.A.....YFSM...D...A-.....KT.Q.VL..........................APCGA.....ND..F-.-..-..-VC........GRASEWA.SN..GT...E.LC......LA----.-----....-----................------agfrveqsvgmhggieelscy...........................................
A0A663ESH4_AQUCH/67-242              ...........................................................VCMDA....KHHKTA.PGPEG.....QLY.GQ.........................C.TP.WKDN...............................ACCTANTS.VQ.AH...Q.DQ.........SY...LY.NFNWDH..C..............G..I.....M...PE..........KCK.RHF...IQD..TCLYECSP.NLGPW....IKPad.......................................ssWRKE..RIL.YVP..LC....LE....DCEQWWEDCQN.A.....ATCK...V...NW.....HK.G.WN..........................WTTGI.....NQ..CP.R..G..TSC........QKFRYVF.PT..PA...D.LC......QQIWSH.SYRYT....SYRRG................SGRCIQ................................................................
A0A093IJZ7_FULGA/31-206              ...........................................................ICMDA....KHHKTK.PGPEG.....MLH.DQ.........................C.AP.WKDN...............................ACCTANTS.SE.AH...K.DQ.........SN...LY.NFNWNH..C..............G..L.....M...PP..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQad.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKD.Y.....VTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFSHVF.PR..PK...D.LC......EKIWSN.SYKYT....TEHRG................SGRCIQ................................................................
A0A446VF45_TRITD/47-198              ................................................fegkppgkaak-----....------.---GR.....RDL.AL.........................C.RI.FRQN...............................TCCDVTQT.FP.AL...L.SV.........RK...LS.S-----..T..............G..E.....G...SG..........ECL.HLW...ELL..ECSV-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFEACSE.A.....YFSI...-...D-.....MK.T.QA..........................LSPCG.....--..L-.G..D..ILC........GKAHKWV.SN..GT...E.LC......RLA-GF.SVQVS....-----................------daglsevdetfcyg..................................................
A0A2K5TT37_MACFA/37-193              ..........................................................a-C---....GGSHPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagTCCPSEMD.TT.EI...S.SP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QHALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
E4XG97_OIKDI/32-253                  ..........................................................r-CMSN....TW-NQS.PGPT-.....-AG.NV.........................C.PK.YSCY...............................GCCDENEA.MK.HF...A.SG.........NAyghYG.PYQFYG..Cssdgk...idttgsG..G.....L...SE..........QCH.TFI...QNN..HCLSACSP.NVYLW....FAKtg.......................................nsRHDD..HLH.GMK..TC....TS....FCTDFYNSCKD.E.....HICF...N...QDg...lA-.-.-Eyftdyl.............sgqlseeKDY-K....iFH..CE.G..N..YKC........QKIQDSLiAK..PL...D.LS......------.-----....-----................------smtslglssnlrtdsqsrnevenfcskfsfgmfdmeketdhvci....................
A0A3B5Q412_XIPMA/39-210              ...............................................hpqcldykppfg-----....------.--PQQ.....PLV.F-.........................C.KE.YIKF...............................GCCDLQKD.EE.IS...R.KY.........DS..iME.NFD---..-..............T..L.....G...SA..........KCG.AYI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.VLP.gLC....GD....YCSDYWRDCRY.T.....LSLL...L...E-.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------dkgnpqqfanltaaieedrrrfcdflefkdkqycypnvltdaelnanlglvqedskgcle....
A0A1D5R4Y4_MACMU/3-164               ......................................................paame-----....------.-----.....---.VQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........LTFESYF.PT..PV...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A2C9VFH6_MANES/11-134              .......................................................fhhf-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...Q.LK.........EN...LQ.KRRLAS..T..............G..E.....A...SQ..........ECL.QLW...ELL..ECSI-CDP.KIG--....VQP...........................................----..---.GLP.lIC....TS....FCDRVYQACAD.A.....YFSM...D...AK.....-T.Q.VV..........................A-P--.....CG..V-.N..D..FVC........GKASQWV.SN..GT...E.LCl....sAGFTVK.SYEAA....EGGTE................EASC--yg..............................................................
W5NB87_LEPOC/15-167                  ..........................................................q-CL--....DYKPPF.QPPEP.....LTF.--.........................C.KE.YSEF...............................GCCDLERD.TR.IS...G.RY.........YE...IM.DYF-D-..-..............F..S.....G...FI..........ICG.KYI...RSI..LC-QECSP.YAAHL....FDA..........................................eDANT..PMR.ELA.gLC....GD....YCTEFWLQCRS.T.....LSLL...M...D-.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------netiiqiegdrdtfcallelkdpeycypnvltntelnanlgav.....................
H9GK27_ANOCA/32-193                  ...........................................................RCLSG....GKHKPS.PSSEE.....QLG.V-.........................C.QI.YAES...............................ACCSPEIA.QD.LS...K.AN.........DI...--.--YWNR..C..............G..H.....L...SS..........RCE.KYL...EQV..ECFYRCSP.IAAQW....PHP...........................................QRPT..ALL.AVP..LC....QG....FCDRWYDACKD.D.....LTCA...R...NW.....LT.D.WH..........................WGPDG.....NN..C-.-..S..QDC........ISYGQMY.QN..GK...E.LC......ETIWDD.TFTVS....---TD................PCECL-t...............................................................
A0A087XCB2_POEFO/40-210              ................................................pqcldykppfg-----....------.--PQQ.....PLV.F-.........................C.TD.YTKF...............................GCCDLQKD.EE.IS...R.KY.........DL..iME.NFD---..-..............T..L.....G...SA..........RCG.KYI...SSI..LC-QECSP.YAAHL....YDA..........................................eDANT..QMR.VLP.gLC....GD....YCSDYWRDCRY.T.....LSLL...L...ED.....KG.N.LQ..........................QFANL.....TA..AI.E..E..DRR........RFCDFLE.LK..DK...Q.YCy....pNVLTDA.ELNA-....-----................------nlglvredstgcle..................................................
A0A2Y9KV80_ENHLU/31-206              ...........................................................VCMDA....KHHKAK.PGPED.....KLH.GQ.........................C.TP.WKEK...............................ACCSVSTS.QE.LH...K.DT.........SL...LY.NFTWEH..C..............G..K.....M...EP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.HVP..LC....KE....DCQQWWEDCRT.S.....YTCK...N...NW.....QR.G.WD..........................WTSGI.....NK..CP.A..G..TTC........RTFETYF.PT..PA...A.LC......EGLWSH.SYQAS....NYSRG................SGRCIQ................................................................
A0A4W2E4I1_BOBOX/201-256             ...................................................gyrssilp-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................--TGY.....NQ..CP.V..K..AAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
K1PIY6_CRAGI/27-189                  .................................................cldfrppfnp-----....------.---E-.....GAL.QF.........................C.TE.YSNF...............................GCCTNRDD.LD.VR...D.EY.........DR...IM.R---QL..S..............D..A.....D...VR..........ACE.RYV...KEL..VC-QRCSP.YAAHI....YDA...........................................EGTL..MSR.PFP.gLC....NS....YCRDFYRSCRQ.I.....VRH-...-...--.....--.-.FT..........................PDPNI....qQQ..I-.S..Y..GTS........AFCNYIR.LN..DD...D.YCypdlktNPILNN.RISIK....QYTSE................GCLCM-e...............................................................
G3NU04_GASAC/28-209                  ..........................................................l-CLQD....GKHKAA.PGPEP.....QLT.E-.........................C.GI.YADN...............................SCCTEENI.QD.IS...H.VP.........SE..vNK.NEPWDK..C..............G..A.....L...SS..........ECK.GFL...KRV..SCFYRCSP.DAARW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACKM.D.....MTCA...-...--.....-R.N.WA..........................KDPRG.....HN..C-.-..T..GTC........VQYQQMY.QH..GR...D.LC......ESLWGD.AFVAV....EDEPEyageageagseggggrP-----cgclt...........................................................
A0A5E4CV46_MARMO/26-201              ...........................................................VCMNA....QHHKRE.PGPED.....ELY.VE.........................C.IP.WKDN...............................ACCTATTS.WE.AH...L.EV.........SP...LH.NFTLVH..C..............G..L.....L...TP..........SCQ.KHF...IQA..ICFYQCSP.NLGPW....IQLvg.......................................psGQGE..RIV.GVP..LC....RE....DCEEWWADCRT.S.....YTCK...S...NW.....YS.S.WH..........................WSQGK.....NR..CP.A..E..DIC........HPFPHYF.PT..PT...D.LC......EKIWRN.SFKAS....PEHRN................SGRCLQ................................................................
I3M8E2_ICTTR/38-220                  ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlelln...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCVQ................................................................
A0A498K8T5_MALDO/26-188              ..........................................vcisqggrfppfssegk-----....------.-PPKRvskgsKDL.TL.........................C.RV.FRKK...............................TCCDVAQT.HP.AL...V.SV.........RK...LA.S-----..S..............G..E.....A...GP..........ECL.HLW...ELL..ECSI-CDP.RIG--....VQS...........................................----..---.GPP.vIC....AS....FCDRVFEACAE.A.....YYST...-...DA.....IT.Q.VL..........................APCGV.....ND..Y-.-..-..-VC........GRASEWI.RN..GT...E.FC......YAA---.-----....-----................------gfavkddisvskeepfcyg.............................................
A0A3Q2W1W4_HAPBU/28-209              ...........................................................VCLQD....GKHKAT.PSPEP.....HLT.E-.........................C.SL.YADN...............................SCCTQEQI.QD.IS...H.VP.........SA..nNQ.NEPWDK..C..............G..S.....L...SP..........ECE.GFL...KRV..LCFYRCSP.DAARW....PHP...........................................QRSS..YIQ.AVP..LC....HS....FCRDWFDACRM.D.....LTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GNC........VQYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDEPE................------evgeageigvdvegvrpcgclt..........................................
A0A6I8RR28_XENTR/26-188              ..................................................qcldyappf-----....------.KPP--.....AHL.EF.........................C.SQ.YETF...............................GCCDQDRD.NA.IA...E.KY.........WS..iMD.YFD---..-..............L..N.....G...YH..........TCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eDPHT..PLR.IIP.gLC....FN....YCSEFHLKCQS.S.....VTLL...T...E-.....--.-.--..........................DKQIR.....ES..C-.N..K..GRD........LFCNLLN.LP..DE...D.YCf....pN-----.-----....-----................------vlhntdlnnnlgsvvedpegcmk.........................................
A0A4D9E2K4_9SAUR/40-206              ...........................................................RCLAG....GKHKVA.PSPEG.....QLG.V-.........................C.QL.YAAN...............................ACCSPKVA.QE.IS...S.AP.........LT..kLN.DIYWNR..C..............G..S.....L...SP..........RCE.HYL...QRV..ECFYRCSP.SAARW....PHP...........................................QRPT..AVL.GVP..LC....LS....FCGVWYEACKD.D.....LTCA...R...NW.....VS.D.WQ..........................WGPQG.....NN..C-.-..S..RDC........VPYSQMY.RD..GR...E.LC......ENIWGD.SFVAA....---RQ................PCPCL-s...............................................................
A0A4X2K2Y3_VOMUR/33-194              ..........................................................q-CL--....DFKPPF.RPPHP.....LLF.--.........................C.EQ.YSAF...............................GCCDAEQD.AE.LS...R.RY.........WA...VT.RRL---..E..............P..D.....T...FA..........VCA.AYV...RDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PVR.TVP.gLC....KD....YCIDVWHKCRT.I.....FRHL...S...PD.....PE.L.WA..........................LETNR....aKF..C-.-..-..---........RYLS---.LD..DA...D.YCf....pRLLVNE.NLNVNl..gQVRAD................TEGCL-e...............................................................
A0A1L8G6J3_XENLA/51-210              .................................................dygppfkplv-----....------.-----.....-HL.EF.........................C.SQ.YETF...............................GCCDQDKD.NV.IA...E.KY.........WS..iMD.YFD---..-..............L..N.....G...YH..........TCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eDPHT..PLR.IIP.gLC....FN....YCSEFHLKCQN.S.....ITLL...T...E-.....--.-.--..........................DKQIR.....ES..C-.D..K..GRD........LFCNLLN.LP..DE...D.YC......F-----.-----....-----................------pnvlhntelnnnlgsvvedpegcik.......................................
A0A2K5TT28_MACFA/59-215              ..........................................................a-C---....GGSHPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagTCCPSEMD.TT.EI...S.SP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QHALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A0Q3PC11_AMAAE/1-154               ..........................................................m-----....------.-----.....---.--.........................C.RG.LYPR..............................lSCCSRSDA.QG.LL...H.AE.........SK..iLS.------..-..............V..T.....N...NT..........ECA.KLL...EEI..RCAH-CSP.HAQNL....FHSpe.......................................kgETPE..REL.TLP.yLC....KD....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GICf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A2U3YPX7_LEPWE/30-205              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.TP.WKEK...............................ACCSASTS.QE.LH...K.NI.........SL...LY.NFTVDH..C..............G..K.....M...EP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.HVP..LC....KE....DCQRWWEDCRT.S.....YTCK...S...NW.....HR.G.WN..........................WTSGI.....NQ..CP.T..G..TTC........RTFETYF.PT..PA...A.LC......EGLWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A671VG97_SPAAU/23-198              ...........................................................MCMDA....KHHKTE.PGPEG.....QLY.KQ.........................C.AP.WSDN...............................ACCRANTS.EE.AH...A.DN.........SY...LY.NFNWNH..C..............G..A.....M...SD..........QCK.KHF...IQD..TCFYECSP.HLGPW....IQEat.......................................esWRKE..RIL.DVP..LC....KE....DCHQWWDDCKN.D.....FTCK...T...NW.....HK.G.WD..........................WSSGI.....NK..CP.E..G..SKC........RKWTDVY.PT..PK...D.MC......EQIWSS.SYLYT....THLKT................SGRCMQ................................................................
A0A2K6PQ81_RHIRO/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A059B747_EUCGR/107-259             ................................................asegkppgkvg-----....------.--RGS.....KGL.TL.........................C.RV.FRKK...............................TCCDVSQT.HP.AL...I.AT.........RR...LT.L-----..K..............G..E.....A...SE..........ECV.QLW...ELL..ECSI-CDP.NVG--....VQP...........................................----..---.GPP.lIC....AS....LCDKIFQACSN.A.....YFSM...D...PK.....-T.Q.VL..........................APCGV.....NE..V-.-..-..-IC........ARASECV.SN..GT...E.LC......LAA---.-----....-----................------gfsvkldddryvgseeahcyg...........................................
W1NXD4_AMBTC/33-196                  ..........................................cisqggrfppfslegkp-----....---PQK.ATKGP.....KDL.AL.........................C.RV.FRAK...............................TCCDIVQT.YP.AL...L.SI.........RR...LA.S-----..S..............G..E.....A...NP..........ECL.HLW...EML..ECSL-CDP.RVG--....VQR...........................................----..---.GPP.vIC....KS....FCDSVFQACSN.A.....YFA-...-...--.....ID.G.ST..........................QVLSP.....CG..-S.K..D..IVC........GAATGWA.KN..GS...E.FC......QLA---.-----....-----................------gfsvhsledgshgiedsycfg...........................................
G1P7A4_MYOLU/33-191                  ................................................lsgrpsgppqp-----....------.-----.....--L.SF.........................C.AQ.YSAF...............................GCCAPERD.AA.LG...R.RF.........WA...LAaRV----..D..............A..G.....V...WA..........ACA.GYA...LDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PLR.TLP.gLC....ED....YCLDMWQTCRG.L.....FRHL...S...PD.....RK.L.WA..........................LEGDR....aKF..--.-..-..--C........RYLS---.LD..DT...D.YCf....pRLLVNE.NLNSNl..gRVVAD................AKGCLQ................................................................
G1T5D7_RABIT/56-231                  ...........................................................VCMNA....KHHKRE.PGPED.....ELY.VE.........................C.EP.WKDN...............................ACCTPTTS.WE.AH...L.DV.........SP...LY.NFSFVH..C..............G..L.....L...TP..........DCH.RHF...IQA..ICFYECSP.NLGPW....IQPvd.......................................psGPEQ..RAM.DVP..LC....HE....DCEQWWEDCRT.S.....YTCK...S...NW.....HG.G.WD..........................WSRGR.....NR..CP.A..E..APC........RPFPHYF.PT..PA...D.LC......EKIWNN.TFKAS....PEHQG................SGRCLQ................................................................
Q0VCN9_BOVIN/30-205                  ...........................................................VCMDA....KHHKAE.PGPED.....KLH.NQ.........................C.TP.WKKN...............................ACCSARVS.QE.LH...K.DT.........SS...LY.NFTWDH..C..............G..K.....M...EP..........ACQ.RHF...IQD..NCLYECSP.NLGPW....IQEvn.......................................qkWRKE..RFL.NVP..LC....KE....DCQSWWEDCRT.S.....YTCK...S...NW.....HR.G.WD..........................WTSGS.....NK..CP.T..G..TIC........RTFEAYF.PT..PA...A.LC......EGLWSH.SYKLS....NYSRG................SGRCIQ................................................................
C3YX09_BRAFL/253-382                 ......................................................ycpff-----....--DNRA.PSAQP.....NLR.N-.........................C.SW.YQSR...............................SCCQQREI.DI.IF...L.AT.........YP...LS.------..-..............-..A.....A...SD..........ECL.KQL...SFL..YC-YVCDP.AQNTF....YSY...........................................----..--E.TLT..VC....ET....FCDRIFAACGT.A.....LWKG...S...SM.....RS.V.--..........................YSSGR.....D-..--.-..-..---........-------.--..--...-.--......------.-----....-----................------fclrrsfkanatgahgnmsnls..........................................
A0A670HV81_PODMU/64-226              ..............................................qcldygppfqppf-----....------.-----.....-HL.EF.........................C.SA.YETF...............................GCCDQDKD.NT.IA...A.KY.........WE...VM.DYI---..D..............P..Q.....A...HK..........LCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSEFHLYCRS.A.....ITLL...T...D-.....--.-.--..........................DKHIQ.....EC..C-.E..R..NKT........RFCNLLN.IQ..DE...D.YCf....pDVLKNT.DLNRNl..gSVVED................KKGCL-q...............................................................
A0A094KFU9_ANTCR/30-205              ...........................................................ICMDA....KHHKTE.PGPEG.....TLY.GQ.........................C.SP.WKDN...............................ACCTANTS.SE.AH...K.DQ.........SN...LY.NFNWNH..C..............G..L.....M...PS..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQvd.......................................ssWRRE..RVL.HVP..LC....KE....DCEEWWEDCKD.S.....LTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFSHVF.PR..PK...D.LC......EKIWSN.SYKYT....TERRG................SGRCIQ................................................................
F1M928_RAT/26-202                    ...........................................................VCMNS....KHHKQE.PGPED.....KLY.FE.........................C.MP.WKDN...............................ACCTRDTS.WE.AH...L.DE.........PL...LF.NFSMTH..C..............G..L.....L...TP..........LCH.KHF...IQA..ICFYECSP.NLGPW....IQPvv......................................pnrQEEQ..RLW.DVP..LC....LE....DCEEWWKDCRT.S.....HTCK...A...DW.....LH.G.WV..........................WDQGK.....NG..CP.A..H..APC........LPFSDYF.PT..PA...D.LC......EKIWNN.TFKAS....PERRN................SGRCLQ................................................................
A0A2K5DCI7_AOTNA/22-181              ...................................................qcldfrpp-----....------.-FRPQ.....QLL.SL.........................C.SR.YSAF...............................GCCDEKRD.AE.LT...S.RF.........WS...LA.NR---M..L..............A..A.....E...WA..........DCA.GYA...REL..LCQVSGRA.ATARA....EDP...........................................--ST..PLR.TVP.gLC....QD....YCLTMWQKCRR.L.....IRH-...-...--.....--.-.FS..........................TDKEL.....QA..L-.E..D..NRD........KFCHRLS.LD..DA...D.YCy....pNLMVNK.NLNSDl..gHMVTD................ATGCLQ................................................................
H2NEZ7_PONAB/28-204                  ...........................................................ICMNA....KHHKRV.PSPED.....KLY.EE.........................C.IP.WKDN...............................ACCTLKTS.WE.AH...L.DV.........SP...LY.NFSLFH..C..............G..L.....L...MP..........GCR.KHF...IQA..ICFYECSP.NLGPW....IQPvg......................................slgWEGE..RIV.NAP..LC....QE....DCEEWWEDCRM.S.....YTCK...S...NW.....RG.G.WD..........................WSQGK.....NR..CP.K..G..AQC........LPFSHYF.PT..PA...D.LC......EKTWSN.SFKAS....PERRN................SGRCLQ................................................................
A0A671FG48_RHIFE/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........HK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.EKVEEi..sRKHKH................NCFCIQ................................................................
A0A0P7VT40_SCLFO/30-191              ..........................................................q-CL--....DYKPPF.QPPEP.....LTF.--.........................C.KE.YIKF...............................GCCDKEKD.NL.IS...Q.RY.........HH...IM.EY-FDQ..L..............G..S.....L...--..........TCG.KYI...HSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.QLP.gLC....AP....YCSEFWNYCRY.T.....LSLL...L...DS.....N-.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------vtlsieddrekfcnflelkdpeycypnvltnaelnanlgtvqadpegclq..............
A0A673SKJ8_SURSU/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.SG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FNSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCQG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCYCI-r...............................................................
A0A3Q3AI29_KRYMA/26-204              ...........................................................ACLQD....GKHKST.PSPEP.....HLT.E-.........................C.GL.YADN...............................SCCTEEHI.QD.IG...Y.VP.........SA..sNK.NEPWDK..C..............G..P.....V...NP..........ECE.GFL...KRV..ACFYRCSP.DASRW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRM.D.....MTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GTC........VQYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDDPQevgeag...dtgvegrP-----cgclt...........................................................
A0A6G0HZL2_LARCR/38-199              .................................................qcldfkppfq-----....------.---SQ.....REL.AF.........................C.VM.YKEF...............................GCCDYEKD.QQ.LM...A.KY.........YQ..iMD.NFD---..-..............Y..Y.....G...YA..........NCA.GFV...LEL..IC-QECSP.YAAHL....FDA..........................................eDPHT..PVR.TIP.gLC....PD....YCSQYWKKCRD.T.....IPLL...S...D-.....HP.H.IA..........................K----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------vkedqtnlcwylelgdmdycyphllskqkltqnlgrvqsdsdgclq..................
V4AWK8_LOTGI/5-94                    .........................................................fa-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....A...SK..........TCA.NMM...NYL..MCFF-CSP.DQHIW....YKQ...........................................----..---.RAR..VC....SD....FCTDLYDECKD.A.....EFKG...E...KI.....GS.N.YE..........................NGSM-.....-F..CE.-..-..---........-------.--..--...-.--......------.-----....-----................------aqdfsvadsgcfkfdpkvfdgav.........................................
A0A2K5D9I4_AOTNA/3-164               .....................................................paatev-----....------.-----.....---.-Q.........................C.SP.WRKN...............................ACCTADTS.QE.LH...K.DT.........SR...LY.NFNWEH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........RTFEFYF.PT..PA...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
E4XH70_OIKDI/26-129                  ..........................................................s-CLLS....HIHKPS.PSPEP.....NLN.GE.........................C.RQ.WRSN...............................SCCMANGY.KQ.YS...F.KS.........ST...-T.SYQTDH..C..............G..Q.....L...SD..........QCL.IMM...QRQ..WCLYQCDP.YLEKW....VVN...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------vtkaetnnyfgdmdlnivnek...........................................
H0ZR53_TAEGU/26-187                  ....................................................qcldfkp-----....----PF.RPPRG.....LA-.-F.........................C.RR.YAEF...............................GCCDPRRD.RA.LL...Q.RF.........YR...LS.---ARL..D..............E..R.....A...YA..........ACA.GHL...QEL..LC-QECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCTQVWQNCRS.I.....FRAL...S...AD.....PE.L.IA..........................LENNM....aKF..C-.-..-..---........RYLS---.LE..DT...D.YC......------.-----....-----................------fphllanqnlnqnlglvtadaegclq......................................
A0A3Q1JZL4_ANATE/35-196              ..............................................qcldfkppfrplr-----....------.-----.....-EL.EF.........................C.VM.YKDF...............................GCCDYQKD.KE.LM...T.KY.........YR..iMD.HFD---..-..............Y..Y.....E...YA..........NCA.GFV...MEL..LC-QECSP.YAAHL....FDA..........................................eDQST..LVR.TIP.gLC....PD....YCSQFWKKCNS.T.....IPFI...S...D-.....NP.H.IA..........................-----.....-K..I-.K..E..DQT........RLCHYLE.LD..DM...D.YCy....pHLLSNQ.KLTQNl..gQVQSD................SDGCLQ................................................................
A0A672HEJ9_SALFA/34-195              ................................................qcldfkppfrp-----....------.--PA-.....-PL.QL.........................C.VM.YQDF...............................GCCDQQRD.QQ.LL...R.SF.........QR...VM.----DH..P.............dA..P.....G...DP..........ACA.GYV...LEL..LC-QECSP.YAAHL....FDA..........................................eDPST..PVR.TVP.gLC....PD....YCSEFYRRCRS.A.....LPLL...T...DD.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------rhisrlmdnqtgvcrhlelgdmdycyphllsnqrlnqnlgrvqadsdgclq.............
A0A0C2I8J2_THEKT/24-101              ..........................................................s-CLKS....GNHKFK.PSPEN....vEDM.GL.........................C.SA.WSEF...............................SCCSAHTA.KS.LS...N.PG.........EY..fIH.NVLFNQ..Cp...........shG..N.....L...SE..........ECK.FEF...---..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------sfigyilc........................................................
G1NTC5_MYOLU/26-201                  ...........................................................VCMKT....KHHKPE.PGPED.....QLY.DE.........................C.SP.WKGN...............................ACCTTNTS.WE.AH...L.DE.........AV...LY.NFSLIH..C..............G..L.....M...IP..........DCQ.KHF...IQA..KCLHQCSP.NLGPW....IRQva.......................................pcEQEE..RIL.DAP..LC....QE....DCVQWWADCRT.S.....YTCK...S...NW.....LR.G.WD..........................WSRGK.....SR..CP.A..R..ARC........RPFPYYF.PT..PA...A.LC......EKIWGN.SFKAS....PERRN................SGRCLQ................................................................
A0A2B4SLT0_STYPI/10-111              ................................................eafsaegpdyv-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..----ECQP.SKEKL...aVLP...........................................NSRL..NLR.KVP..--....WE....FCTIFHGT---.-.....IVEH...E...DW.....LE.D.FN..........................YTSSK.....YV..CR.S..D..SKC........RKFSKLN.KD..GK...G.LC......NKMWGQ.SFKYE....----N................SHNC--mm..............................................................
A0A2K6FMJ5_PROCO/39-221              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRS.H.....LPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2K5MD48_CERAT/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
G3UM80_LOXAF/4-128                   .........................................................sv-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..T.....N...NT..........ECG.KLL...EEV..KCAH-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKAEEi..sRKHKH................NCFCIQ................................................................
A0A1U8CQ94_MESAU/24-199              ......................................................flvtr-----....GGSHPL.QARSW.....GHP.GL.........................A.AD.VGTSqlhlagrpqpypr.....iqdpdsqtspvpePCCTPEKD.RP.EA...P.RP.........GI...LL.----ES..C..............G..A.....P...SP..........ECE.FFL...GHL..QRALRNRF.HPLLL....G--...........................................----..---.VQP..LC....PE....LCQIWFTACEA.D.....FTC-...-...--.....GL.T.WL..........................QPSVK.....RG..C-.-..E..ASC........RTFGQTF.TN..AE...D.LC......RMALGQ.APVAA....---PG................SRHCLN................................................................
A0A2P5W0P9_GOSBA/17-179              .........................................cvsqggrfppfssegkpp-----....------.---KRvgkghKDL.TL.........................C.RV.FRKK...............................TCCDAAQT.HP.AL...L.SI.........RR...LA.L-----..T..............G..E.....A...SE..........ECL.HLW...ELL..ECSI-CDP.RVG--....VQP...........................................----..---.GPP.lIC....TS....FCDRVFQACSN.A.....YFSM...D...A-.....KT.Q.VL..........................APCGA.....ND..F-.-..-..-VC........GRASEWA.SN..GT...E.LC......LAA---.-----....-----................------gfrveqsvgmhggieeescy............................................
E9FW82_DAPPU/43-215                  ..........................................................s-CIDG....NNHKRE.PGPED.....SLH.KQ.........................C.LP.WKNN...............................SCCTGNTT.VH.AH...G.GK.........MY...--.GFNYNH..Cp............nR..K.....M...SS..........KCL.EHF...VQD..LCFYECSP.NVGPW....MQMvn.......................................mkMRRE..RFL.DVP..LC....AT....DCDDWFNACKD.D.....YTCT...D...NW.....TL.N.FK..........................WINGT.....NH..CR.P..E..SEC........RTFSDIF.QN..SS...N.FC......ERVWDH.SWKYT....---NN................SEPCM-r...............................................................
A0A402EUL2_9SAUR/62-224              ..............................................qcldygppfqppf-----....------.-----.....-HL.EF.........................C.TA.YETF...............................GCCDQEKD.NV.VA...A.KF.........WE...IM.DYID--..-..............P..Q.....A...YE..........LCG.RYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....FD....YCSEFHLYCRS.A.....ITLL...T...D-.....--.-.--..........................DKHIQ.....EC..C-.E..K..NKT........RFCNLLD.IQ..DP...D.YCf....pNVLKNT.DLNRNl..gSVVED................KKGCL-q...............................................................
A0A340XNT4_LIPVE/30-205              ...........................................................VCMNA....KHHKEK.PGPED.....KLH.EQ.........................C.SP.WKKN...............................ACCSVNTS.QE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.NVP..LC....KE....DCQIWWEDCRT.S.....YTCK...T...NW.....HK.G.WN..........................WTSGY.....NQ..CP.L..R..AAC........HRFDFYF.PM..PA...D.LC......NEIWSH.SYKVS....NYGRG................SGRCIQ................................................................
A0A2F0BFV1_ESCRO/1-108               .........................................................vn-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....-QS...........................................WRKE..RVL.NVP..LC....KE....DCQIWWEDCRT.S.....YTCK...T...NW.....QK.G.WNwtsgegl...........rvgrwrwrMEKGG....sNK..CP.T..G..TTC........GTFEFYF.PT..PA...A.LC......EGLWSH.SYKLS....NYSRG................SGRCIQ................................................................
M5WJ83_PRUPE/27-188                  ....................................ctsqggrfppfsyegkpprrvnk-----....------.---GP.....KDL.TL.........................C.RV.FRKK...............................TCCDVSQT.HP.AL...V.SV.........RK...LA.S-----..T..............G..E.....A...NP..........ECL.QLW...ELL..ECSI-CDP.RIG--....VQP...........................................----..---.GPP.vIC....AS....FCDRVFKACAE.A.....YYST...-...DA.....IT.Q.VL..........................APCGV.....ND..Y-.-..-..-VC........GRASEWI.VN..GT...E.FC......HAA---.-----....-----................------gfavkdditvrkreafcyg.............................................
A0A3L8RTB7_CHLGU/28-203              ...........................................................VCMDA....KHHKTE.PGPEG.....QLY.GQ.........................C.IL.WKDN...............................ACCTANTS.LE.AH...Q.DQ.........SY...LY.NFNWDH..C..............G..A.....M...PE..........KCK.RHF...IQD..LCLYECSP.NLGPW....IDQad.......................................tsWRKE..RIR.DVP..LC....QE....DCEQWWEDCQD.A.....VTCK...V...NW.....HK.G.WN..........................WTTGT.....NQ..CP.K..G..AMC........QKFKFVF.PT..AA...A.LC......EQIWSG.SYRYT....SHHRG................SGRCIQ................................................................
K7F2U2_PELSI/35-210                  ...........................................................MCMDA....KHHKTQ.PGPEG.....ALH.GQ.........................C.TP.WKDN...............................ACCTAQTS.TE.AH...K.DQ.........SY...LY.SFNWHH..C..............G..V.....M...PE..........KCR.QHF...IQD..TCLYECSP.NLGPW....IHQhs.......................................ssWRRQ..RIL.HVP..LC....KE....DCEQWWEDCKD.A.....RTCK...E...NW.....HK.S.WN..........................WTAGT.....NR..CP.R..G..SRC........RPFWSVF.PR..PA...D.LC......EKIWSN.SYKYT....QEHRG................GGRCIQ................................................................
A0A674BBE5_SALTR/34-195              .................................................qcldfkppfk-----....------.--PQ-.....DDL.QF.........................C.AM.YRNF...............................GCCDSAKD.KE.LM...A.KF.........YK..iMD.NFD---..-..............Y..Y.....G...YA..........SCA.GYV...QDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PIR.TLP.gLC....PD....YCSQFWLKCRS.T.....ITLL...S...DD.....PQ.L.AE..........................AEPDQ....dRF..C-.-..-..---........---QHLE.LE..DP...D.YC......------.-----....-----................------yphlvsneqltqnlgrvradpegclq......................................
U3K4J0_FICAL/22-189                  ..........................................................g-CLEG....DTQKLK.PSPEP.....SMQ.E-.........................C.TL.YSKS...............................SCCYADFT.EQ.LA...H.SP.........VI..kVS.SSYWSR..C..............G..Q.....L...SK..........SCE.DFT...KKI..ECFYRCSP.YASRW....IHP...........................................NDSA..AIQ.AVP..LC....QS....FCDDWYEACKD.D.....SICV...R...NW.....LT.D.WE..........................RDESG....eNH..C-.-..K..NKC........IPYREMY.TN..GT...D.LC......QSMWGK.SFKVS....---ES................SCLCLQ................................................................
A0A1S3SQX4_SALSA/34-195              .................................................qcldfkppfk-----....------.--PK-.....DDL.QF.........................C.AM.YRNF...............................GCCDSAKD.KE.LM...A.KF.........YK..iMD.NFD---..-..............Y..Y.....G...YA..........SCA.GYV...QDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PIR.TLP.gLC....PD....YCSQFWLKCRS.T.....ITLL...S...DD.....PQ.L.AE..........................AEPDQ....dRF..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------qhleledpdycyphllsneqltqnlgrvradpegclq...........................
G3SMM0_LOXAF/11-186                  ...........................................................VCMEA....KYHKTK.PGPED.....KLY.GQ.........................C.SP.WRKN...............................ACCSVNTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ECK.RHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQNWWEACRT.S.....YTCK...N...NW.....HK.G.WD..........................WTSGV.....NE..CP.V..G..TTC........HTFEFYF.PT..PA...D.LC......ERLWSY.SYKAS....NYSRG................SGRCIQ................................................................
A0A087V3Y1_BALRE/3-129               ........................................................lsv-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................krETPE..REL.ILP.yLC....KD....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A3P9PH90_POERE/26-201              ...........................................................VCLQD....GKHKAT.PGAEP.....HLS.E-.........................C.GL.YADN...............................SCCTEEDI.QD.IA...Y.VP.........SD..sNK.NEPWDK..C..............G..P.....L...SA..........ECE.GYL...KRV..SCFYRCSP.DASRW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRM.D.....ITCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GTC........VQYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDDQQeagen......gaegrPCGCL-t...............................................................
C5XWG6_SORBI/45-198                  ..................................................fssegkppg-----....------.RAPKG....rRDL.AL.........................C.RI.FRQN...............................TCCDVTQT.FP.AL...V.SV.........RN...LA.L-----..T..............G..E.....G...SQ..........ECI.HLW...ELL..ECSI-CDP.RVG--....VRP...........................................----..---.GPP.vVC....AS....FCDMVFKACSE.S.....YFSV...-...-D.....MK.T.QA..........................LSPCG.....--..L-.G..D..ILC........GKAHKWV.SN..GT...E.LC......RLA-GF.SVQVS....ET---................------ssdgvddtfcyg....................................................
A0A4W4E328_ELEEL/13-71               ...........................................................ACLQD....GRHKAT.PGPEP.....YLR.E-.........................C.SL.YREN...............................ACCSEQDI.ED.LT...A.PP.........AG...SV.ATPWDR..C..............G..S.....L...SA..........---.---...---..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------m...............................................................
A0A2K5LBK7_CERAT/36-211              ...........................................................VCMNA....KHHKAQ.PSPED.....ELY.GQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..ACLYECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGI.....NE..CP.A..R..ALC........RTFESYF.PT..PA...A.LC......EGLWSH.SFKVS....NYSGG................SGRCIQ................................................................
A0A654GJ15_9CEST/37-215              ...........................................................MCALG....NYHKPS.PSPEP.....ELT.N-.........................C.SD.FRNS...............................SCCTRKTT.EL.IF...S.GE.........--...LH.SFDFEH..C..............G..E.....M...KK..........KCR.DFF...NQD..YCFVECSP.YLGPW...lVHSe........................................rsLGLE..RVY.KVP..LC....QT....DCDAWYDACKT.S.....MTCA...E...NW....qSG.G.FN..........................WTAGT.....NT..CR.K..G..FTC........MPIEEVY.KT..AK...D.FC......EKVWDH.SWKVI....PDGKH................N-----wsttepqcmh......................................................
A0A671F1W8_RHIFE/31-206              ...........................................................VCMDA....KYHKEK.PSPED.....KLH.EQ.........................C.SP.WKKN...............................ACCSYNTS.KE.AH...K.DI.........SY...LY.RFNWDH..C..............G..Q.....M...EH..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.DVP..LC....KE....DCESWWEDCRT.S.....YTCK...S...NW.....HQ.G.WD..........................WTSGS.....NQ..CP.V..G..ATC........QPFHIYF.PT..PA...A.LC......NEIWSH.SYKIS....QYSQG................SGRCIQ................................................................
A0A443RRG9_9ACAR/58-231              ..........................................................s-CMDT....NYHKKE.PGNET.....QLF.GE.........................C.TR.WQEN...............................GCCTPNTT.RR.FH...E.TV.........NQ...F-.NFDLSH..Cye.........qtnR..T.....M...SE..........KCK.KFF...HQD..ICFYGCEP.HVGHW....FINvn.......................................lsFARE..RMY.KVP..LC....AS....VCNEWWNACKK.E.....FTCH...S...NW.....PK.N.--..........................YKSIK.....NH..C-.S..N..STC........KRFDQVW.TS..AS...D.FC......ENVWNH.SWKYT....---ND................KEPCM-k...............................................................
A0A1U8IUT8_GOSHI/17-179              .........................................cvsqggrfppfssegkpp-----....------.---KRvgkghKDL.TL.........................C.RV.FRKK...............................TCCDAAQT.HP.AL...L.SI.........RR...LA.L-----..T..............G..E.....A...SE..........ECL.HLW...ELL..ECSI-CDP.RVG--....VQP...........................................----..---.GPP.lIC....TS....FCDRVFQACSN.A.....YFSM...D...A-.....KT.Q.VL..........................APCGA.....ND..F-.-..-..-VC........GRASEWA.SN..GT...E.LC......LAA---.-----....-----................------gfrveqsvgmhggieemscy............................................
T1J4T1_STRMM/43-216                  ...........................................................RCLDA....KYHKTK.PGVED.....ELH.EM.........................C.SP.WKDH...............................ACCTKNTS.HL.IP...N.GQ.........MY...--.HLNFDH..Ca...........hiK..N.....M...SD..........NCK.RHF...TQD..LCFYECEP.NLGPW....MLKvn.......................................mkHRKE..RAF.EVP..LC....AA....DCDEWFSACRN.D.....YTCA...A...NW.....VR.N.LT..........................TKNGR.....MH..CP.P..T..SEC........KTFKEIY.KN..SS...N.FC......EQVWDH.SWKYT....---PN................EQPCM-r...............................................................
F6UJL7_CALJA/40-212                  ........................................................swa-----....GHHIEH.PKIKP.....KPL.N-.........................T.DP.WRKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWEH..C..............G..R.....M...EP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IRQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRT.S.....YTCK...S...NW.....QK.G.WN..........................WTSGI.....NE..CP.A..G..ALC........HTFESYF.PT..PA...A.LC......EGLWSH.SYKVS....DYSRG................SGRCIQ................................................................
F7BP54_MACMU/36-211                  ...........................................................VCMNA....KHHKAQ.PSPED.....ELY.GQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........LTFESYF.PT..PV...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A2U9CLX5_SCOMX/34-196              ............................................pqcldfkppfrplre-----....------.-----.....--L.DF.........................C.VM.YKEF...............................GCCDYQKD.QE.LM...T.KF.........YR..iMD.NFD---..-..............Y..H.....G...YT..........SCA.GFV...LEL..LC-QECSP.YAAHL....FDA..........................................eDPGT..TLR.TIP.gLC....QD....HCFQFWEKCSS.T.....IPLL...S...DD.....--.-.--..........................--PHM.....VK..V-.K..E..DRA........RFCQYVG.LD..DV...D.YCy....pHLLSNQ.KLTNNl..gRVQSD................SDGCLQ................................................................
A0A2K6BUM3_MACNE/37-193              ..........................................................a-C---....GGSHPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagTCCPSEMD.TT.EI...S.SP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QHALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
M7AN26_CHEMY/4-129                   .........................................................sv-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..T.....N...NT..........ECV.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgEASE..REL.ALP.fLC....KD....YCKEFYYTCRG.Q.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEl..sRKHKH................NCFCIQ................................................................
K7ESG0_HUMAN/59-185                  ..........................................................a-C---....GGSRPL.QARSQ.....QHH.GL.........................A.AD.LGKGklh.........................lagPCCPSEMD.TT.ET...S.GP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTY----.--..--...-.--......------.-----....-----................------g...............................................................
A0A3Q7U7Q6_VULVU/38-220              ...........................................................RCLNG....NPPKRL.KRRER.....RLM.SQlells...............ggealC.GG.FYPR..............................lSCCLRSDS.AG.LG...R.PD.........TK...IF.S-----..-..............M..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.YSQSL....FHSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRS.H.....IPG-...-...-F.....IQ.T.TA..........................EEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A5F9DQ18_RABIT/35-210              ...........................................................VCMDA....KHHKEK.PSPED.....KLH.EQ.........................C.SP.WKKK...............................ACCSTNTS.QE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.DVP..LC....KD....NCQRWWEDCRT.S.....HTCK...S...NW.....HK.G.WD..........................WTSGV.....NR..CP.A..G..ATC........RTFESYF.PT..PA...A.LC......EGLWSH.SYKVS....NYSSG................SGRCIQ................................................................
A0A556VW12_BAGYA/99-144              ..........................................................t-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....NR..CP.A..G..AQC........QKWTDVF.PT..AQ...S.MC......EKIWSN.SYKYT....TYRKD................SGRCMQ................................................................
A0A0D9QVX7_CHLSB/30-205              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCRT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........LTFESYF.PT..PV...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
U3JSL4_FICAL/25-156                  ....................................................cglqvls-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............V..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETPE..KEL.MLP.yLC....KD....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCY....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A1D2NCW9_ORCCI/33-207              ...........................................................TCMDA....RNHKSK.PGPED.....SLH.AQ.........................C.SP.WFNR...............................SCCTTKTS.IM.TH...T.QN.........MY...--.NFQWSH..Cs...........qvA..P.....L...SE..........KCL.KHF...RQD..LCFYECSP.NVGPW....LVKvd.......................................mkIRKQ..RFI.NVP..LC....KS....DCTAWFRDCSD.D.....YTCT...D...NW.....GI.N.FE..........................WTKYG.....NR..CP.T..G..SIC........KKFREIYsNN..AT...H.FC......ETVWDH.SWKVV....---ED................NEHCM-r...............................................................
A0A2J8RY52_PONAB/27-183              ..........................................................a-C---....GGSRPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagPCCPSEMD.TT.ET...S.GP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A5J5B2C6_9ASTE/39-189              ....................................................pfsnegk-----....--PPRK.VSKGP.....KDL.TL.........................C.RV.FRRK...............................TCCDIAQT.HP.AF...L.SI.........RR...LA.S-----..A..............G..E.....A...SQ..........ECL.QLW...ELL..ECSI-CDP.YVG--....IQP...........................................----..---.GPP.vIC....AS....LCDRVYEACSS.A.....YFSM...D...A-.....KK.Q.VL..........................APCGV.....ND..F-.-..-..-VC........GRASEWI.SN..GT...E.LC......R-VAGF.AVKSS....-DEMD................EKSCY-g...............................................................
A0A218UKV1_9PASE/45-220              ...........................................................VCMDA....KHHKTE.PGPEG.....QLY.GQ.........................C.IL.WKDN...............................ACCTANTS.LE.AH...Q.DQ.........SY...LY.NFNWDH..C..............G..A.....M...PE..........KCK.RHF...IQD..LCLYECSP.NLGPW....IDQad.......................................tsWRKE..RIR.DVP..LC....WE....DCEQWWEDCQD.A.....VTCK...V...NW.....HK.G.WN..........................WTTGT.....NQ..CP.K..G..AMC........QKFKFVF.PT..AA...A.LC......EQIWSG.SYRYT....SHHRG................SGRCIQ................................................................
H2Q164_PANTR/44-206                  ...............................................qcldygppfqpp-----....------.-----.....LHL.EF.........................C.SD.YESF...............................GCCDQHKD.RR.IA...A.RY.........WD..iME.YFD---..-..............L..K.....R...HE..........LCG.DYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNTQT..PLR.NLP.gLC....SD....YCSAFHSNCHS.A.....ISLL...T...ND.....-R.G.LQ..........................ESHGR.....DG..T-.-..-..---........RFCHLLD.LP..DK...D.YC......------.-----....-----................------fpnvlrndylnrhlgmvaqdpqgclq......................................
E9PXB5_MOUSE/34-103                  ...........................................................VCMDA....KHHKEK.PGPED.....NLH.DQ.........................C.SP.WKTN...............................SCCSTNTS.QE.AH...K.DI.........SY...LY.RFNWNH..C..............G..T.....M...TS..........ECK.RHF...IQD..TC------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------................................................................
C5L2Q1_PERM5/40-188                  .....................................................isvdrs-----....------.--KSS.....EPL.SF.........................C.AE.YSGN...............................TCCGLRDD.LR.IR...S.RY.........VN...LV.GRGMGK..E..............D..G.....V...SQ..........ECA.DML...RKV..AC-LPCDG.YLA--....SQ-...........................................----..--S.KLP.sIC....GS....FCDSWFDSCRG.D.....FFAV...-...-V.....GS.G.NQ..........................LDLCD.....PK..S-.-..T..LIC........ARLDEIV.AD..SA...E.LC......ERSGLG.QITEE....---EE................ESEC--fd..............................................................
A0A4W2E2A4_BOBOX/26-201              ...........................................................VCMNA....KPHKPE.PGPEA.....ELY.EE.........................C.IP.WKDN...............................ACCTASTS.WE.AH...L.DV.........SL...LY.NFSLVH..C..............G..L.....M...MP..........DCQ.RHF...LQA..ICFYQCSP.NLGPW....IQQvd.......................................prWQAE..RVL.DAP..LC....LE....DCERWWADCRT.S.....HTCK...S...NW.....LG.G.WA..........................WSRGK.....PR..CP.E..W..EPC........RPFPHHF.PT..PA...D.LC......ERIWSG.SFRAS....PERRG................SGRCLQ................................................................
A0A667XMM0_9TELE/34-195              ..................................................qcldfkppf-----....------.--RPQ.....KEL.EF.........................C.VT.YKEF...............................GCCDFEKD.QN.LM...S.KY.........YR..iMD.NFD---..-..............Y..Y.....G...YA..........NCA.GIV...QEL..LC-QECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....PD....YCARLWNKCSS.T.....IPF-...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------lsddpylasvqsdqaslceylqlddmdycyphllnnqqlsqslgrvqtdtdgclq.........
A0A6G1ACW8_CROCR/1-99                ..........................................................q-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..----ECSP.YAAHL....YDA..........................................eDPAT..PLR.TVP.gLC....ED....YCRDLWQTCRG.L.....FRHL...S...PD.....RE.L.WA..........................LEGNR....aKF..--.-..-..--C........RHLS---.LD..DA...D.YCf....pRLLVNE.NLNSDl..gRVRAD................ARGCLQ................................................................
G3QFT6_GORGO/44-206                  ...............................................qcldygppfqpp-----....------.-----.....LHL.EF.........................C.SD.YESF...............................GCCDQHND.RR.VA...A.RY.........WD..iME.YFD---..-..............L..K.....R...HE..........LCG.DYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNTQT..PLR.NLP.gLC....SD....YCSAFHSNCHS.A.....ISLL...T...ND.....-R.G.LQ..........................ESHGR.....DG..T-.-..-..---........RFCHLLD.LP..DK...D.YC......------.-----....-----................------fpnvlrndylnrhlgmvaqdpqgclq......................................
G3U4R3_LOXAF/45-206                  ................................................cldygppfkpq-----....------.-----.....VHL.EF.........................C.SD.YEAF...............................GCCDQSKD.HR.IA...S.RY.........WD...IM.DYFD--..-..............L..R.....G...HE..........LCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NFP.gLC....SD....YCSAFHSNCHS.A.....ISLL...T...SD.....--.-.--..........................RRLQG.....--..SQ.G..K..DGA........RFCHLVN.IP..DK...D.YC......------.-----....-----................------fpnvlrkdhlnrnlgvvaedqqgclq......................................
A0A087RHL9_APTFO/21-188              ..........................................................g-CLEG....DTHKLK.PSPEP.....NMH.E-.........................C.TL.YSKS...............................SCCYADFT.EQ.LA...H.SP.........VI..kVN.NSYWNR..C..............G..Q.....L...SK..........SCE.VFT...KKI..ECFYRCSP.HAAHW....IHP...........................................SYTA..AIQ.SVP..LC....QS....FCDDWYEACKD.D.....SICV...H...NW.....LT.D.WE..........................WDESG....eNH..C-.-..K..NKC........IPYSEMY.AN..GT...D.MC......QTMWGE.SFKVS....---ES................SCLCLQ................................................................
A0A2K5Y8J7_MANLE/32-202              .............................................phlmirpscpvssp-----....------.-----.....---.IQ.........................C.RP.WKKN...............................ACCSTNTS.QE.AH...K.DV.........SY...LY.RFNWNH..C..............G..E.....M...AP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.NVP..LC....KE....DCEQWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGF.....NK..CP.V..G..AAC........QPFHFYF.PT..PT...V.LC......NEIWTY.SYKVS....NYSRG................SGRCIQ................................................................
H2Y7U9_CIOSA/24-200                  ...........................................................TCPRG....DYHKET.PSAET.....HLQ.A-.........................C.KQ.YTCD...............................SCCFENIT.IE.LA...S.VP.........IA..qVG.KLDYHQ..C.............sK..Q.....L...TD..........ACS.NQH...TYL..QCLYQCSP.NLYPW....MGK...........................................-VTR..IPN.SIP..LC....SN....FCDQWYLTCQA.D.....MTCA...PgvgNW.....KT.G.LNkg......................fdADGNP....vNP..CK.D..G..VMC........RNYTEVY.GS..GQ...A.LC......ENIWGT.MFTYT....---TD................TTNCI-d...............................................................
A0A674BB98_SALTR/35-196              .................................................qcldfkppfk-----....------.--PQ-.....DDL.QF.........................C.AM.YRNF...............................GCCDSAKD.KE.LM...A.KF.........YK..iMD.NFD---..-..............Y..Y.....G...YA..........SCA.GYV...QDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PIR.TLP.gLC....PD....YCSQFWLKCRS.T.....ITLL...S...DD.....PQ.L.AE..........................AEPDQ....dRF..C-.-..-..---........---QHLE.LE..DP...D.YC......------.-----....-----................------yphlvsneqltqnlgrvradpegclq......................................
B3RPR5_TRIAD/37-169                  ..........................................................y-CP--....YFHNRL.ARPQS.....QLS.S-.........................C.SW.FRNQ...............................SCCYQAEI.DS.IF...T.DN.........IP...LF.------..-..............-..N.....V...ND..........QCR.QSL...TYL..MC-YICAP.DQKDF....YAD...........................................----..--R.RLT..IC....DD....MCQDLYDACIN.A.....TYKG...-...DP.....IY.Y.W-..........................YRNGR.....EF..C-.-..Q..GRQ........FQV----.--..--...-.--......------.-----....-----................------qsyqsgkcysikryen................................................
A0A022RAA7_ERYGU/30-193              ............................................vcisqggrfppfsse-----....-----G.KAPKKa..arDAL.RF.........................C.RV.FRKR...............................TCCDVSQT.HA.AL...L.SI.........RK...LS.SY----..-..............G..E.....G...SQ..........DCL.QLW...ELV..ECSI-CDP.LVG--....VQH...........................................----..---.GPP.lIC....SS....LCDRLYQACST.A.....YFAM...D...AK.....--.T.QA..........................LSPCG.....A-..--.G..D..FVC........GRASEWV.SN..GT...E.LC......RAS-GF.SVTTS....-----................------ssseeeeeelsscyg.................................................
A0A3Q0E9K2_CARSF/1-120               ...........................................................-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....M...EP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IRQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRT.S.....YTCK...S...NW.....QK.G.WN..........................WTSGI.....NQ..CP.T..G..TTC........RTFESYF.PT..PA...A.LC......EDLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A2B4SW98_STYPI/68-255              ..........................................................k-CLPG....AKHKES.PSAEE.....SMA.A-.........................C.KS.YKDA...............................SCCTSDFT.RQ.LA...T.PP.........IK..kVG.NFSWTP..C.............nK..T.....L...ST..........KCE.AFM...VMV..ECFYRCSH.NAYFW....KNP...........................................YFTS..AIT.KAP..VC....SG....FCDGWFDACKD.D.....LTCA...K...NW.....IT.D.FK..........................MEAGV.....NN..C-.-..K..QPC........KNFSDYY.AN..GK...D.LC......ESMWGA.SFVYK....-----................KTNCL-qmnftspnpndalveklskekqf.........................................
F7AWH6_CIOIN/27-202                  ...........................................................TCPRG....DYQKES.PSGQE.....HLA.A-.........................C.KQ.YTCN...............................SCCFENIT.TQ.LA...I.MP.........IQ..qVG.KLNYNQ..C..............D..K.....L...TD..........ACS.TQH...TYL..QCLYQCSP.NLYPW....MIE...........................................-STR..KLI.AIP..LC....AS....FCDQWFMTCSA.D.....MTCApgeG...NW.....KT.G.LNkg......................fdASGNP....vNP..CK.P..G..VMC........RNYTETY.GS..GE...G.LC......NNIWGT.LFKYS....---TD................TKNCI-d...............................................................
F7F2B5_MACMU/77-233                  ..........................................................a-C---....GGSHPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagTCCPSEMD.AT.EI...S.GP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A091DMG9_FUKDA/34-209              ...........................................................VCMDA....KHHKDK.PSPED.....KLH.EQ.........................C.SP.WKKN...............................SCCSANTS.QE.AH...K.NI.........SN...LY.RFNWDH..C..............G..E.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.DVP..LC....KE....DCQRWWEDCKT.S.....LTCK...S...NW.....HK.G.WN..........................WEKGY.....NK..CP.T..D..AAC........HPFPFYF.PT..PA...D.LC......QEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
H0ZTN3_TAEGU/45-220                  ...........................................................VCMDA....KHHKTE.PGPEG.....QLY.GQ.........................C.TL.WKDN...............................ACCTANTS.LE.AH...Q.DQ.........SY...LY.NFNWDH..C..............G..A.....M...PE..........KCK.LHF...IQD..LCLYECSP.NLGPW....IDQad.......................................tsWRKE..RIR.NVP..LC....RE....DCEQWWEDCQD.A.....VTCK...V...NW.....HK.G.WN..........................WTTGT.....NQ..CP.K..G..AMC........QKFKFVF.PT..AA...A.LC......EQIWSG.SYRYT....SHHRG................SGHCIQ................................................................
A0A091EID6_CORBR/1-107               ..........................................................g-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.-HL...QDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCMQVWQNCRS.I.....FRSL...S...AD.....PE.L.IA..........................LENNM....aKF..--.-..-..--C........RYLS---.LE..DT...D.YCf....pH-----.-----....-----................------llanqnlnqnlglvtadaegclq.........................................
F7D0L5_HORSE/27-200                  .........................................................ac-----....GRSHPF.PATSR.....RHH.GL.........................V.AD.LGTGqlhlagdpqalvpqpylriqdpssqespsprPCCPSEMD.TP.KA...L.GP.........GI...I-.------..-..............-..-.....-...-P..........RCK.SFL...GHL..QIALRSRL.RLLQL...gVRR...........................................----..---.GQP..LC....AE....LCDAWFATCES.A.....IAC-...-...--.....GR.T.WL..........................PFPEK.....KG..C-.-..E..PDC........TIYGQTF.TD..GA...D.LC......RSVLGS.ALPVA....--APG................TAHCL-s...............................................................
U3EWX7_CALJA/37-193                  ..........................................................a-C---....GGSRPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagPCCPSEMD.TT.ET...S.GP.........GN...--.--YPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.HLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A493TRT2_ANAPP/96-213              ...........................................................VCMDA....KHHKTK.PGPEG.....TLH.GQ.........................C.AP.WKDN...............................ACCTANTS.SE.AH...R.DQ.........SY...LY.NFNWNH..C..............G..V.....M...PP..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQ...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------mwfdpakgnpnvvvakhpsshagapshlfscctc..............................
Q8BY83_MOUSE/26-162                  ...........................................................VCMNS....KRHKQE.PGPED.....ELY.QE.........................C.RP.WEDN...............................ACCTRSTS.WE.AH...L.EE.........PL...LF.NFSMMH..C..............G..L.....L...TP..........ACR.KHF...IQA..ICFHECSP.NLGPW....IQPvv......................................pngQEEQ..RVW.GVP..LC....QE....DCEDWWRACHS.S.....LTCK...S...NW.....LH.G.WD..........................WSEV-.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------kgllsm..........................................................
A0A087QV99_APTFO/3-165               ..............................................qcldygppfqppf-----....------.-----.....-HL.EF.........................C.SA.YENF...............................GCCDQERD.NS.IA...A.KY.........WD...IM.DYI---..D..............P..Q.....R...HK..........LCG.TYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....FD....YCSEFHFNCRS.A.....ISLL...-...--.....--.-.-T..........................SDKHI.....QE..CC.E..T..NKT........RFCNLLH.LH..DE...D.YCf....pNVLKNT.ALNHNl..gSVVQD................RKGCLQ................................................................
A0A093PR50_9PASS/21-196              ...........................................................VCMDA....KHHKSQ.PGPEG.....KLH.DQ.........................C.SP.WKDN...............................ACCTANTS.SE.AH...K.DE.........SN...LY.NFNWNH..C..............G..V.....M...PP..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQad.......................................ssWRRE..RIL.HVP..LC....QE....DCEQWWEDCRE.A.....VTCK...E...NW.....HK.G.WN..........................WATGR.....NR..CP.W..G..SLC........RPFSEVF.PR..PR...D.LC......EKIWSH.SYRYT....TARRG................SGRCVQ................................................................
A0A0G4IP33_PLABS/18-159              ....................................................pdavhcn-----....------.-APGP.....RFL.KY.........................C.DA.YADA...............................TCCSRQDD.QR.AL...R.RA.........AP...LY.T-----..-..............G..Q.....F...SA..........RCK.EIT...AQM..ACSV-CDP.RVG--....MKK...........................................----..---.VDA..VC....QS....RCDDWYESCKN.D.....FFTT...P...AS.....TS.A.VL..........................EP---.....CS..V-.S..S..LVC........SRLSDIV.TS..GE...E.FC......SRS-GY.SVATS....----S................STACF-d...............................................................
A0A074ZFF7_9TREM/40-209              ...........................................................ICMNG....THHKKA.PSPEP.....TDD.HI.........................C.TD.WASM...............................SCCEHKTM.RS.VQ...-.-E.........SL...LY.NFNHSH..C..............K..P.....M...SP..........KCM.DMF...KRE..LCFYECSP.HVGPW...lV-Ktr.......................................srRRME..RSY.HVP..LC....EE....DCNMWYEACKI.E.....ETCV...R...DW.....SV.E.FE..........................WSKGM.....NV..CP.S..T..SAC........ELFSDVY.KN..AS...D.FC......HAIWDG.GWKVE....-K---................APRC--mh..............................................................
A0A4W2C680_BOBOX/16-173              ttstspsgpqphgsrrqarrtgqrcdqkpqsckrrvwplarslrtqprgqpathgpwgp-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..---QECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRG.L.....FRHL...S...PD.....RE.L.WA..........................LEGNR.....A-..--.-..-..KLC........RSLSL--.-D..DT...D.YCf....pRLLVNE.NLNSNl..gRVVAD................AEGCLQ................................................................
H0WKX3_OTOGA/30-205                  ...........................................................VCISA....RPHKRK.PGPED.....ELY.DE.........................C.TP.WKDN...............................ACCTAKTS.WE.AH...L.EV.........SP...LY.NFSLVH..C..............G..L.....L...LP..........GCL.KHF...IQA..ICFYECSP.NLGPW....IRPvt.......................................slGLGE..RAA.AIP..LC....QE....DCEEWWEDCSS.S.....YTCK...A...NW.....HV.G.WD..........................WSRGR.....NH..CP.A..G..AQC........LPFPHYF.PT..PA...D.LC......EKIWSN.LFKAS....PERRH................SGRCL-r...............................................................
A0A565AY75_9BRAS/40-200              ......................................ciskggrfppyelegkppksv-----....------.-GRGS.....KDL.TL.........................C.RV.FRKR...............................TCCSSLQT.NP.AF...V.AV.........RN...LA.TY----..-..............G..E.....A...SQ..........DCL.HFF...ELL..ECSI-CNP.NVG--....IQP...........................................----..---.GPP.rIC....AS....FCDRVFEACKD.A.....YFAS...N...AI.....T-.-.--..........................-RVIG....pCG..VN.D..D..IIC........VKASNWE.TN..GT...A.FC......EAA-GF.SVQTT....A-DSR................EEPC--yg..............................................................
M3X2M1_FELCA/27-188                  ......................................................qcldf-----....--RPPF.RPPQP.....LR-.-F.........................C.AQ.YSAF...............................GCCAPEQD.AA.LA...R.RF.........GA...LAaRVD---..-..............A..A.....E...WA..........ACA.GYA...LDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRG.L.....FRHL...S...PD.....RE.L.WA..........................LEGNR....aKF..--.-..-..--C........RYLS---.LE..DT...D.YCf....pRLLVNE.NLNSNl..gRVVAD................AKGCLQ................................................................
A0A3P8WSY5_CYNSE/23-198              ...........................................................MCMDA....KHHKTS.PGPEG.....LLY.NQ.........................C.AP.WKNN...............................ACCTANTS.EE.AH...S.DN.........SY...LY.NFNWNH..C..............G..S.....M...SP..........KCK.KHF...IQD..TCFYECSP.HLGPW....IQEvd.......................................qsWRKE..RIV.DVP..LC....ME....DCHSWWEDCKD.D.....FTCK...S...DW.....HT.G.WN..........................WNSGF.....NH..CP.A..G..AKC........RKWTDFY.PT..PK...S.MC......EQIWSN.SYLYT....THSKT................SGRCMQ................................................................
A0A4W5Q6H5_9TELE/23-168              ...........................................................MCMDA....KHHKKE.PGAEG.....QLY.QQ.........................C.AP.WKDN...............................ACCTANTS.AE.AH...D.DN.........SY...LY.NFNWNH..C..............G..V.....M...TN..........KCK.KHF...TQD..TCFYECSP.HLGPW....IQQvd.......................................qsWRKE..RIL.HVP..LC....QE....DCHSWWDDCKD.D.....FTCK...Q...DW.....HY.G.WD..........................WTTA-.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------aplrasllaastllyq................................................
A0A091LTK2_CARIC/3-165               ..............................................qcldygppfqppf-----....------.-----.....-HL.EF.........................C.SA.YENF...............................GCCDQERD.NS.IA...A.KY.........WD...IM.DYID--..-..............P..R.....G...RK..........RCG.TYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....FD....YCSEFHFNCRS.A.....ISLL...-...--.....--.-.-T..........................SDKHI.....QE..CC.E..T..NKT........RFCSLLH.LH..DE...D.YCf....pNVLKNT.ALNRNl..gSVVED................RKGCL-q...............................................................
A0A671E9F7_RHIFE/31-192              ......................................................qcldf-----....--RPPF.RPPQP.....LR-.-F.........................C.AQ.YSAF...............................GCCAAEQD.AE.LA...G.RF.........GA...LAaRV----..D..............A..G.....L...WA..........SCA.GYA...LDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRG.L.....FRHL...S...PD.....RE.L.WA..........................LEGNR....aKF..--.-..-..--C........RYLS---.LD..DT...D.YCf....pRLLVNE.NLNSNl..gRVVAD................AKGCLQ................................................................
A0A3P8X963_ESOLU/34-195              ..................................................qcldfkppf-----....------.KPQ--.....EDL.QF.........................C.TM.YGTF...............................GCCDSVKD.QE.LM...T.KF.........YN..iMD.NFD---..-..............Y..Y.....G...YA..........NCA.GYV...QDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PTR.TIP.gLC....PD....YCSQFWSKCRS.T.....ITLL...S...DQ.....PQ.H.AE..........................TEQDQ....vRF..C-.-..-..---........---QN--.--..--...-.--......------.-----....-----................------lqledpdycyphilrneqltqnlgrvvanpegclq.............................
A0A3P9NQM6_POERE/68-230              ................................................qcldfeppfkp-----....------.---Q-.....WHL.EF.........................C.SQ.YEQF...............................GCCDQRTD.NV.IA...E.RY.........WD..vIE.QLE---..-..............T..A.....G...YD..........LCE.DML...KEI..MC-QECSP.YAAHL....YDA..........................................eDPYT..PVR.DLP.gLC....FG....YCSEFHSKCRH.V.....LRYL...T...D-.....-N.Q.LL..........................LDTSG.....RD..M-.-..A..TFC........SLVD---.LS..DQ...D.YCy....pRVLKST.DLNSNl..gQVVED................PKGCL-q...............................................................
A0A2K5QP32_CEBCA/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEVLE..RDL.VFP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-L.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A3B1IPY3_ASTMX/14-189              ...........................................................MCMNG....KHQKTE.PGPEG.....ELY.KQ.........................C.VP.WREN...............................ACCTANTS.AE.AH...E.DN.........SY...LY.NFNWNH..C..............G..V.....M...SP..........KCK.SHF...VQD..TCFYECSP.HLGPW....IQLad.......................................ssWRKE..RII.DVP..LC....LE....DCESWYNDCKY.D.....FTCK...D...NW.....HK.G.WD..........................WSSGT.....NH..CP.T..G..AEC........RLWSDVF.PD..AK...S.MC......ENIWTN.SYKYT....TLTKD................SGRCMQ................................................................
A0A125YTP5_TOXGV/134-324             ............................kssrerhaesrkhttngvclpsmgflpdvpr-----....------.-DRRD.....EVF.LA.........................C.HE.HESN...............................TCCQRRDT.ES.IL...R.RL.........AFy.fTP.EAVKSD..V..............S..F.....P...PK..........NCA.SFT...SAA..LCSK-CDA.RVGVG...kM--...........................................----..TRK.NAP.lLC....RS....FCERWYHACEN.D.....YFAP...-...--.....AP.S.GS..........................PQALT.....FC..YP.D..S..VIC........SPLRDVA.RD..GA...T.FC......SKLG--.-----....-----................------fevagldreesaeqeeeedaaacy........................................
A0A4D9E3P2_9SAUR/24-191              ...........................................................RCLEG....ETHKHR.PSPEL.....DMH.E-.........................C.TL.YSEF...............................SCCYANFT.EQ.LA...H.SP.........VI..qVS.NSYWNR..C..............G..N.....L...SK..........SCE.DYM...KKI..ECFYRCSP.HAAHW....INP...........................................NYTA..GIE.FVP..LC....QN....FCDDWYEACKN.D.....STCV...R...NW.....IT.D.WE..........................WDENG....eNH..C-.-..K..NEC........IPYNKVY.AN..GT...D.MC......QSMWGD.SFKVS....---ES................SCLCLQ................................................................
A0A0E0K1U4_ORYPU/51-203              .............................................fssegkrpgraakg-----....------.----R.....RDL.AL.........................C.RI.FRQN...............................TCCDVSQT.FS.AL...L.SV.........RK...LA.S-----..T..............G..E.....G...SQ..........ECL.HLW...ELL..ECSI-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFKACSE.A.....YFAI...-...D-.....VK.T.QA..........................LSPCG.....--..L-.G..D..ILC........GKAHKWV.SN..GT...Q.LC......RSA---.-----....-----................------gfsvqalestsggvddtfcy............................................
A0A384DSE0_URSMA/27-177              ..........................................................a-C---....GGSHPL.PSMSQ.....THQ.RL.........................A.AD.LGTG...............................QLHLTEMD.TP.EA...S.DP.........GM...VP.----ER..C..............G..D.....P...SP..........GCE.SFL...GHL..QVALHSRF.RLLLL...gIRQ...........................................----..---.AQP..LC....SE....LCDVWFATCEN.D.....ITC-...-...--.....GL.T.WL..........................PLLEK.....RG..C-.-..E..PGC........TTYEQTF.AD..GA...D.LC......RSVLGY.ALPVA....--APG................AGHCLN................................................................
A0A2K6FVT6_PROCO/26-201              ...........................................................ICMNA....KHHKRK.PSPED.....KLY.EE.........................C.IP.WKGN...............................ACCTAETS.WE.AH...L.DV.........SP...LY.NFSRIH..C..............G..L.....L...MP..........GCQ.KHF...IQA..TCFYECSP.NLGPW....IQPaa.......................................wsGQGE..RVV.DVP..LC....RE....DCEEWWEDCRW.S.....YTCK...S...NW.....QG.G.WD..........................WSQGK.....NR..CP.A..K..ARC........LPFPHYF.PT..PA...D.LC......EKVWSN.SFKAS....PERRH................SGRCLQ................................................................
A0A452CAM7_BALAS/30-203              ...........................................................VCMNA....KHHKEK.PGPED.....KLH.EQ.........................C.SP.WKKK...............................ACCSVNTS.RE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...EX..........--K.RHV...IQD..PCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RVL.NVP..LC....KE....DCQIWWEDCRT.S.....YTCK...T...NW.....HK.G.WN..........................WTSGY.....NQ..CP.V..R..TAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SYKVS....NYGRG................SGRCIQ................................................................
A0A3Q7XHC1_URSAR/31-206              ...........................................................VCMDA....KHHKEK.PSPED.....ELH.KQ.........................C.SP.WKKN...............................SCCFTNTS.EE.AH...K.DI.........SY...LY.KFNWNH..C..............G..H.....M...TP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.DVP..LC....KE....DCQQWWEDCRT.S.....YTCK...S...NW.....HK.G.WD..........................WSSGY.....NR..CP.A..G..AAC........LPFHFYF.PT..SA...A.LC......SEIWSH.SYKPS....NYSRG................SGRCIQ................................................................
JUNO_MOUSE/26-202                    ...........................................................VCMNS....KRHKQE.PGPED.....ELY.QE.........................C.RP.WEDN...............................ACCTRSTS.WE.AH...L.EE.........PL...LF.NFSMMH..C..............G..L.....L...TP..........ACR.KHF...IQA..ICFHECSP.NLGPW....IQPvv......................................pngQEEQ..RVW.GVP..LC....QE....DCEDWWRACHS.S.....LTCK...S...NW.....LH.G.WD..........................WSEEK.....KH..CP.A..H..EPC........LPFSYHF.PT..PD...D.LC......EKIWNN.TFKAS....PERRN................SGRCLQ................................................................
#=GR JUNO_MOUSE/26-202         SS    ...........................................................----S....SSS-SS.-B--S.....---.GG.........................G.GG.GTTS...............................BSS-HHHH.HH.TT...S.SS.........--...SS.S----E..E..............S..-.....-...-H..........HHH.HHH...HHH..HHHHHH-G.GGGGG....EEESS......................................SSSSSSE..EE-.-EE..E-....HH....HHHHHHHHTTT.S.....EES-...S...--.....S-.-.--..........................-----.....--..--.T..T..S--........EEHHHH-.SS..HH...H.HH......HHTTTT.TEEE-....SS-GG................GSSSB-................................................................
A0A5F8GHM3_MONDO/53-229              ...........................................................VCMDG....KHHKYK.PGQED.....NLH.QQ.........................C.SP.WKKR...............................ACCTASTS.IA.AH...E.DA.........SH...LY.KFNFSH..C..............G..M.....L...TP..........ACK.RHF...VQD..LCLYECSP.NLGPW....IQPvn.......................................ssWRKE..RVM.NIP..LC....KE....DCNMWWEDCKT.S.....YTCK...E...NW.....HK.G.WN..........................WSSGI.....NE..CP.V..K..AAC........HPFSFYF.PT..PT...S.LC......ENIWSR.SYNAS...hSYGRG................SGKCIQ................................................................
W5P2F1_SHEEP/30-207                  ...........................................................VCMDA....KHHKAE.PGPED.....KLH.NQt.......................qC.TP.WKKN...............................ACCSARVS.QE.LH...K.DT.........SS...LY.NFTWDH..C..............G..K.....M...EP..........ACQ.RHF...IQD..NCLYECSP.NLGPW....IQEvn.......................................qkWRKE..RFL.NVP..LC....KE....DCQSWWEDCRT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGS.....NK..CP.N..G..TTC........RTFEAYF.PT..PA...A.LC......EGLWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A2Y9T9A0_PHYMC/33-194              ......................................................qcldf-----....--RPPF.RPPQP.....LR-.-F.........................C.AQ.YSAF...............................GCCAPEHD.AA.LA...R.RF.........RA...LE.A---RV..D..............A..A.....I...WA..........ECA.GYA...LDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDLWQSCRG.L.....FRHL...S...PD.....RE.L.WT..........................LEGNR....aKF..--.-..-..--C........RYLS---.LD..DT...D.YCf....pRLLANE.NLNSNl..gRVVAD................AMGC--lq..............................................................
G3WJX2_SARHA/110-235                 ..............................................stsgspimagicl-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.--IWDR..C..............G..G.....L...SP..........RCE.SFL...QNL..SNFLHCSP.LGANW....THL...........................................EKPR..SIQ.ALP..IC....AA....FCDQWFLACKN.D.....LTCG...-...--.....-R.N.WL..........................S-QPG.....GS..C-.-..E..GGC........LTFDQTF.LD..AR...D.LC......GSALGD.YLVAA....---PA................PCPCLQ................................................................
A0A3Q7W815_URSAR/27-213              ...........................................................VCMNT....KHHKRE.PGPED.....KLY.EE.........................C.IP.WQDN...............................ACCTAGTS.WE.AH...L.DA.........SL...LY.TFSLLH..C..............G..V.....M...MP..........GCE.KHF...LQA..ICFYECSP.NLGPW....IQKvrrlgrg............................grrrvdssGPGE..RIL.DVP..LC....QE....DCEQWWEDCRT.S.....YTCK...S...NW.....HG.D.WD..........................RSGGK.....NR..CP.A..R..AVC........HPFPHYF.PT..PA...D.LC......EKIWNH.SFKAS....PEPRN................SGQCLQ................................................................
A0A3P4P3Q8_GULGU/31-206              ...........................................................VCMDA....KHHKEK.PSPED.....ELH.KQ.........................C.SP.WKKN...............................SCCSTNTS.QE.AH...K.DI.........SH...LY.RFNWNH..C..............G..H.....M...TP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.DVP..LC....KE....DCQQWWEDCHT.S.....YTCK...S...NW.....HQ.G.WD..........................WTSGY.....NR..CP.A..G..AAC........LPFHFYF.PT..PA...A.LC......SEIWTH.SYQAS....NYSRG................SGRCIQ................................................................
F1RS40_PIG/38-220                    ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........SK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..RCAL-CSP.HSQSL....FHSp........................................erEALG..RDP.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEDi..sRKHKH................NCFCIQ................................................................
H9GUQ6_ANOCA/9-102                   ..................................slhafyvlsretsqskatfynlsls-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................----..---.---..--....-S....LCR--YDACKN.D.....FICV...K...NA.....LT.D.WE..........................IDERG....eNH..C-.-..K..NEC........ISYRKMY.AN..GT...E.MC......ETMWGV.SLKVS....---DS................NCLCLQ................................................................
W5MF72_LEPOC/23-189                  ..........................................................k-CLQG....RDHKKA.PSEEH.....-SM.KE.........................C.TV.YSNS...............................SCCYSNFT.EQ.LV...S.PV.........KK...VD.NTQWDL..C..............Q..K.....L...ST..........GCE.AFM...KKV..ECFYQCSP.SAVNW....MNP...........................................NYTA..GLL.HVP..LC....VS....FCNNWFDACKN.D.....LTCA...K...NW.....IT.D.FK..........................WDENG....nNH..C-.-..S..GDC........VPFNKMY.SN..GT...D.LC......QSMWGQ.TFMVT....---DS................DCRCL-r...............................................................
F5GXV3_HUMAN/30-167                  ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCTASTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSA-.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------alceglws........................................................
Q69GM1_XENLA/38-218                  ...........................................................RCLNG....SSPRRV.KKRHR.....KLQ.TLdlgg.................agegC.RG.LYPR..............................lSCCPKTDI.PG.MP...M.DS.........KI...LS.------..-..............V..A.....N...NT..........ECA.KLV...EEI..RCAH-CSP.HAQNL....FHAse.......................................rsETSE..RQL.FLP.vLC....KD....YCKEFYYTCRG.Q.....IPG-...-...-L.....LQ.T.SA..........................DEFCF....yHG..MR.D..S..GLCf.....pdFPRKQMR.GP..AS...N.YL......DQMEDY.DKVEEi..sRKHKH................NCYCIQ................................................................
A0A1U8DMF6_ALLSI/9-109               .............................................evlsslpmqtdssc-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................-QRE..AIL.HVP..LC....KE....DCEEWWEDCKD.Y.....VTCK...E...NW.....HK.G.WN..........................WATGP.....NH..CP.W..G..TMC........RPFKQVF.PR..AA...D.LY......EKIWSD.SYKYT....TAPRG................NGRCIQ................................................................
A0A0D3CMJ5_BRAOL/39-190              ............................................vciskegpfstsase-----....---GKL.ADPEF.....EDL.NV.........................C.KV.FHEK...............................TCCSASRM.LS.AS...K.AV.........ES...LA.TY----..-..............G..E.....A...AK..........DCL.YLF...ELL..ECSI-CQP.G----....---...........................................----..---.TLP..IC....AS....FCGRVFQACSD.A.....YFSS...D...AS.....--.-.--..........................DQVIV....pCG..AS.E..S..IIC........GKATKWE.TN..GT...A.FC......YAL---.GFTVQ....-----................------saveescygsk.....................................................
A0A0D3AFH2_BRAOL/43-207              .........................................vcvskggrshqayelegk-----....------.-LPESadlefKDL.NM.........................C.NM.FHEK...............................TCCSASRM.LS.AS...L.AL.........QN...LA.TH----..-..............G..E.....A...SK..........DCL.FWF...ELL..ECSI-CHP.DVGVQ....SGP...........................................----..---.-LR..VC....AS....FCDTVFEACSD.A.....YFST...S...DS.....TN.Q.VI..........................V---P.....CV..AS.N..D..TIC........EKASKLE.TN..GT...A.FC......EAV---.G----....-----................------ftvakpagdsveepcyg...............................................
A0A212DIP5_CEREH/111-156             ..........................................................i-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....QE..CP.N..G..TTC........RTFETYF.PT..PA...A.LC......EGLWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A401S518_CHIPU/23-189              ..........................................................g-CVSG....INHKAM.PSPEP.....DMR.E-.........................C.KL.YSQS...............................SCCFSNYT.EQ.LA...V.SP.........VI..kVY.NTYWNR..C..............G..Q.....L...SS..........RCE.EYM...KKI..DCFYHCSP.HAFNW....INP...........................................NNSY..SLL.AAP..IC....QS....FCDDWFAACRN.D.....LTCV...R...NW.....IS.D.WE..........................WDDHG.....NN..C-.-..R..NEC........IPYHQMY.KN..GK...D.LC......NNMWGA.TFNVT....---SY................PCHCL-m...............................................................
A0A1A6FTX1_NEOLE/29-204              ...........................................................VCMDA....KHHKTK.PGPED.....XLH.DQ.........................C.SP.WKKN...............................ACCSVNTS.QE.IH...K.DN.........SR...LY.NFNWDH..C..............G..K.....M...TP..........TCK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RFL.NVP..LC....KE....DCQEWWEACRT.S.....STCK...T...DW.....HK.G.WD..........................WTSGI.....NK..CP.D..T..AVC........HTFQHYF.PT..PA...S.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
G3HCX1_CRIGR/27-199                  ..........................................................a-C---....GGSHPL.QARFW.....EHP.GL.........................A.AN.VSTSqlhlaghpqpyrr.....iqdpgsqtspvpePCCTSDKD.RP.EA...P.SP.........GV...L-.---LES..C..............G..A.....P...SP..........ECE.LFL...GHL..LRTLRNRF.HPLLL....GMQ...........................................----..---.--P..LC....PE....VCQIWFTTCEA.D.....FTC-...-...--.....GL.T.WL..........................QPSGK.....RG..C-.-..E..SSC........RTFGQTF.TN..AE...D.LC......RTALGH.AVVAA....---PG................SRHCLN................................................................
A0A3M6UV93_9CNID/50-223              ..........................................................k-CIEG....KWHKKS.PSPET.....AEF.KT.........................C.HA.FKES...............................SCCNAAFT.VE.LM...A.NE.........TR..nLY.NHSWHR..C..............G..T.....L...SA..........KCQ.SFW...VKQ..ECFYQCSP.KVYRY....EDP...........................................NFKG..GLK.GVP..VC....SG....FCDEWYEACKE.D.....QICV...E...NV.....LV.D.YN..........................FTKHE....eNY..CP.V..N..SSC........KSYQAMY.GN..GK...N.LC......EKMWGE.SYKYT...lP-DAD................YSNCL-m...............................................................
A0A091QQF2_HALAL/1-98                ...........................................................-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..----ECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCLQVWQKCRS.I.....FRYL...S...ED.....QE.L.IA..........................LENNM....aKF..C-.-..-..---........---HYLS.LE..DT...D.YCf....pHLLANQ.NLNQ-....-----................------nlglvtadaegclq..................................................
S7NL61_MYOBR/26-201                  ...........................................................VCMKT....KHHKPE.PGPED.....PLY.DE.........................C.SP.WKGN...............................ACCTTNTS.WE.AH...L.DE.........AG...LY.NFSLIH..C..............G..L.....M...IP..........DCQ.KHF...IQA..KCLHQCSP.NLGPW....IRQva.......................................pcEQEE..RIL.DAP..LC....QE....DCVQWWADCRT.S.....YTCK...S...NW.....LR.G.WD..........................WSRGK.....SR..CP.A..R..ARC........RPFPYYF.PT..PA...A.LC......EKIWGN.SFKAS....PERRN................SGRCLQ................................................................
A0A437C2F9_ORYJA/58-220              ................................................qcldfqppfkp-----....------.---Q-.....WHL.EF.........................C.RQ.YEQF...............................GCCDQGTD.NT.IA...E.RY.........WN...II.EL-LE-..-..............A..A.....G...QD..........LCE.DML...KEV..MC-QECSP.YAAHL....YDA..........................................eDPHT..PVR.ELP.gLC....FG....YCSEFHGKCRH.V.....LKY-...-...LT.....GS.R.VL..........................LDTSE.....RD..V-.-..S..TFC........SMIDL--.-P..DQ...D.YCy....pNVLSSP.DLNSN....-----................------lgqvledprgclq...................................................
W5KD05_ASTMX/27-199                  ...........................................................ACLQD....GRHKAT.PSPEP.....YLK.E-.........................C.TM.YMEN...............................ACCSEQDI.TD.LT...A.PP.........AG...DD.GTPWDR..C..............G..T.....L...SP..........VCD.AFL...KRV..VCFYRCSP.HAAHW....PHP...........................................QRNS..FLK.AVP..LC....TS....FCRDWYEACKS.D.....LTC-...-...--.....AR.D.WA..........................GDPRG.....LN..C-.-..T..GSC........VPYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDEAGeedg........veghGCGCL-t...............................................................
K7F2U9_PELSI/27-202                  ...........................................................ICMDA....KHHKTR.PGPEG.....KLY.QQ.........................C.AL.WKDN...............................ACCTANTS.TE.AH...Q.DQ.........SY...LY.NFNWNH..C..............G..V.....M...PA..........KCK.QHF...IQD..TCLYECSP.NLGPW....IQQad.......................................nsWRRE..RIL.HVP..LC....KE....DCEQWWEDCKD.A.....ITCK...E...NW.....HK.G.WN..........................WTAGT.....NR..CP.R..G..SMC........QPFRYVF.PR..PA...D.LC......EKIWSN.SYKYT....QEHRG................SGRCIQ................................................................
A0A1S3A0V0_ERIEU/31-207              ...........................................................VCMNA....KHHKEK.PGPED.....KLH.YQ.........................C.SP.WKKN...............................SCCSVNTS.QE.IH...K.DI.........SY...LY.NFNWDH..C.............pE..K.....M...TP..........ACK.RHF...IQD..VCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGF.....NQ..CP.V..E..AAC........HPFSFYF.PT..PE...A.LC......SNIWSN.SYKVS....NYSRG................SGRCIQ................................................................
M4FEA4_BRARP/39-188                  ......................................vciskegpfsssasegkladl-----....------.---EF.....EDL.NV.........................C.KV.FHEK...............................TCCSASRM.LS.AS...K.AV.........ET...LA.TY----..-..............G..E.....A...PK..........DCL.DLF...ELL..ECSI-C--.-----....-QS...........................................----..--G.TLP..IC....AS....FCDRVFEACSD.A.....YFSS...D...AT.....NQ.V.I-..........................---VP.....CG..AS.E..S..IIC........GKATKWE.TN..GT...A.FC......YAL---.-----....-----................------gftvqsaveepcyg..................................................
A0A094LC38_PODCR/31-206              ...........................................................ICMDA....KHHKTK.PGPEG.....MLH.DQ.........................C.AP.WKDN...............................ACCTANTS.SE.AH...K.DQ.........SN...LY.NFNWNH..C..............G..V.....M...PP..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQvd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKD.Y.....VTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFSHVF.PK..PK...D.LC......EKIWSN.SYKYT....TEHRG................SGRCIQ................................................................
A0A673BCP5_9TELE/30-211              ...........................................................MCMDA....KHHKVE.PGPEG.....YLY.RQ.........................C.EP.WRDN...............................ACCTSNTS.TA.AH...D.DN.........SY...LY.NFNWNH..C..............G..A.....M...SE..........QCK.KHF...IQD..TCFYECSP.HLGPW....IQQvwsms.................................wiwssWRKE..RIL.DVP..LC....QE....DCHSWWEDCKN.D.....FTCK...T...DW.....HK.G.WD..........................WSSGT.....NK..CP.K..D..SRC........SKWTEIY.PT..PQ...S.MC......EQIWSN.SYRYT....TYSKT................SGRCMQ................................................................
H2NM84_PONAB/22-183                  ...................................................qcldfrpp-----....-----F.RPPQ-.....-PL.RL.........................C.AQ.YSDF...............................GCCDEGRD.AE.LT...R.RF.........WA...LAsRVD---..-..............A..A.....E...WA..........ACA.GYA...RDL..LC-QECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRG.L.....FRHL...S...TD.....QE.L.WA..........................LEGNR.....AG..F-.-..-..--C........RYLS---.LD..DT...D.YC......------.-----....-----................------fpyllvnknlnsnlghvvadtkgclq......................................
A0A665WE74_ECHNA/36-197              ..............................................qcldfkppfrplr-----....------.-----.....-EL.EF.........................C.VM.YKEF...............................GCCDYTRD.QE.LM...A.KY.........YR..iLD.NFD---..-..............Y..Y.....G...YA..........HCT.GFV...QEL..LC-QECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....PD....YCFQFWGKCSS.I.....IPLL...S...DH.....SH.I.IK..........................IK---.....--..--.-..G..DQS........RLCQSLT.LD..DM...D.YCy....pHLLSNQ.KLTKNl..gRVESD................ADGCL-q...............................................................
A0A1U8ACQ3_NELNU/44-200              ...............................................rfppfssegsap-----....----RK.ATKGP.....KDL.TL.........................C.RV.FRRK...............................TCCDVAQT.HP.AL...L.SI.........RR...LA.S-----..T..............G..E.....A...NQ..........ECL.QLW...ELL..ECSI-CDP.RVG--....VQP...........................................----..---.GPP.lIC....AS....LCDRVFQACSN.A.....YFSM...-...DV.....KT.Q.VL..........................S-P--.....CG..L-.S..E..FIC........GRASEWA.PN..GT...E.LC......RLA---.-----....-----................------gfavkpsedsyqsteqpscy............................................
A0A2K6R535_RHIRO/47-206              .................................................dygppfqpll-----....------.-----.....-HL.EF.........................C.SD.YESF...............................GCCDQHKD.RR.IA...A.RY.........WD..iME.YFD---..-..............L..K.....R...HE..........LCG.DYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHS.A.....ISLL...T...ND.....-R.G.LQ..........................ESHGM.....DG..V-.-..-..---........RFCHLLD.LP..DK...D.YC......------.-----....-----................------fpnvlrndylnrnlgmvaqdprgclq......................................
A0A671WUM8_SPAAU/44-206              ................................................qcldfeppfkp-----....------.---Q-.....WHL.EF.........................C.VE.YEQF...............................GCCDQQTD.NT.IA...E.RY.........WD..iID.QLE---..-..............V..A.....G...YD..........LCA.DML...KDI..MC-QECSP.YAAHL....YDA..........................................eDPYT..PVR.ELP.gLC....SG....YCYEFHGKCRH.V.....VKYL...T...--.....EN.K.LL..........................QDTSE.....RD..V-.-..S..TFC........SLLDL--.-S..DQ...D.YC......------.-----....-----................------ypnvlktsvlnnklgkvaedttgclk......................................
A0A0L8HUS0_OCTBM/23-187              ..................................................chpqcldfk-----....------.PPFQS.....NTL.EF.........................C.SQ.YRDF...............................GCCTKQQE.DV.IF...Q.RY.........EY...VK.---TQL..S..............E..T.....L...LQ..........TCE.PYL...REL..LC-QPCSP.YAAHI....YSA...........................................EQTM..HAS.TFP.gLC....SN....YCSEFYTKCKD.La...kYITS...D...QE.....IL.G.TL..........................N-SK-.....--..--.-..E..NFC........LVVQ---.LT..DT...D.YCy....pNLLKNE.HLNFN....-----................------isiqqitkegcmcve.................................................
E4WUE2_OIKDI/17-186                  ..........................................pykdgapvafsegidyf-----....------.-----.....---.--.........................-.--.YNCD...............................SCCTEETF.KN.VQ...D.TS.........SI..dVW.--AFAG..C..............S..NeteiiA...HE..........ECL.ALT...EQV..NLDLTCSP.NNFLW....LNS...........................................-GKN..ALQ.EYP..IC....AE....FCNRWFDACKN.V.....PSCT...L...TP.....HN.Y.WI.........................tARLCT.....AD..L-.D..P..NMC........RLLGDQF.YD..SK...L.FC......EYFFSE.KGKQVi..iQAPMN................NEFCL-d...............................................................
A0A5J5N4V4_MUNRE/27-208              ..........................................................a-C---....GGSHPL.PARSQ.....RHH.RL.........................V.TN.LGTDqlhleegpqvlvpqlylrtqdwnsleslslwPSFPSEMN.PP.EA...S.DP.........GL...VP.----VR..C..............E..E.....L...SL..........RCE.SFL...VHL..QAALRSRF.HLLLL...gVRQ...........................................----..---.TQP..LC....SE....LCDAWFATCES.D.....VTC-...-...--.....SP.T.WL..........................PLLEK.....RG..C-.-..E..PGC........TTYGQTF.AD..GA...E.LC......RSLLGD.ALPVA....--DPG................SDHCLN................................................................
A0A5F9D225_RABIT/35-210              ...........................................................VCMDA....KHHKEK.PSPED.....KLH.EQ.........................C.SP.WRKN...............................ACCSVSTS.QE.LH...K.DG.........SR...LY.NFQWDH..C..............G..K.....M...EP..........ACK.QHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.DVP..LC....KD....NCQRWWEDCRT.S.....HTCK...S...NW.....HK.G.WD..........................WTSGV.....NR..CP.A..G..ATC........RTFESYF.PT..PA...A.LC......EGLWSH.SYKVS....NYSSG................SGRCIQ................................................................
A0A078A8F8_STYLE/36-193              ..................................kdkdkpdpalkcaggygneyqlnml-----....------.-----.....---.NEn......................lfC.TE.HAGR...............................TCCNLNDT.LK.IK...A.KV.........GF...AK.-VK---..-..............S..D.....V...SD..........QCM.AFT...AKA..LCSH-CDG.DMGLG....---...........................................----..---.KLN.gVC....QS....YCEQWYNVCQN.E.....YFD-...-...--.....-P.Y.VN..........................QNENL.....PF..CKkD..S..LIC........SAVNDVVdAD..PI...K.FC......KMM---.GVKVQ....-----................------delsescfn.......................................................
A0A340XRU3_LIPVE/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........SK...MF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lLC....KD....YCKEFFYTCRG.H.....VPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
F1STK4_PIG/26-201                    ...........................................................ICMNA....KPHKPE.PSPED.....KLY.EE.........................C.IP.WKHN...............................ACCTADTS.WE.AH...L.DV.........AL...LY.NFSLVH..C..............G..L.....M...MP..........GCQ.KHF...LQA..ICFYECSP.NLGPW....IQQtd.......................................phGQAE..RIL.DAP..LC....QE....DCEEWWADCRT.S.....YTCK...S...NW.....LG.G.WT..........................WSRGK.....HR..CP.A..R..ALC........HPFPHYF.PT..PA...D.LC......EKIWSH.SFKAS....PERRD................SGRCLQ................................................................
W4H1E2_9STRA/9-169                   .......................................asstpsqplcrstggikfdp-----....----TE.PSRQQk...qRSL.DH.........................C.TK.YWQN...............................SCCNATHT.IP.LK...R.RV.........ME..pIV.------..-..............A..L.....F...NS..........KCQ.ALH...DEM..TCSA-CHP.FVGTG...rL--...........................................----..---.-ER..IC....PD....LCDDWFDACKD.E.....YYT-...-...PD.....GS.Q.AL..........................SPCYG.....NA..L-.-..-..-IC........SPLHSIV.PS..GR...E.FC......KAM-GY.-----....-----................------tpgkstdtegvtcfd.................................................
F7BPH5_CIOIN/32-206                  ...........................................................VCLDG....KHHKES.PGPEA.....ELF.DT.........................C.SP.WKTR...............................SCCTNETA.FL.TH...Q.DG.........VN..gAY.NFNYNH..C..............G..I.....M...SD..........KCR.RHF...NED..SCFYECSP.NMGPW....IVDve.......................................ssYRNQ..KFE.DVP..LC....RS....ECVDWWADCKD.E.....LTCK...N...NW.....SV.G.WN..........................WTSGV.....NE..CP.S..G..AEC........KKFSEYF.TG..AV...D.LC......ENIYPR.DFKVP....--SND................SAPCM-v...............................................................
A0A091Q9F4_MERNU/3-129               ........................................................lsv-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETPE..REL.TLP.yLC....KD....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A4W2F2D4_BOBOX/97-163              ..........................................................l-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................----..---.---..--....--....LCDAWFATCES.D.....VIC-...-...--.....SP.T.WL..........................PLLEK.....RG..C-.-..E..PGC........TTYRQTF.AD..GA...E.LC......RSLLGD.ALPVA....--DPG................SGHCLN................................................................
A0A2Y9LC22_ENHLU/27-187              ..........................................................a-C---....GGSRPL.PAMSR.....RHH.RL.........................A.AD.LGTSqlhla.....................gehsrPCLTSEMD.TP.EA...L.DP.........GM...--.--APER..C..............G..D.....P...SP..........GCE.SFL...GHL..QVALHSRF.RLLLL...gIRQ...........................................----..---.AQP..LC....SE....LCDVWFATCES.D.....ITC-...-...--.....GP.T.WL..........................TILEK.....RG..C-.-..E..PGC........PTYEQTF.AD..GA...E.LC......RSVLGY.AMPVA....--APG................AGHCLN................................................................
A0A2R9B8B1_PANPA/3-164               .....................................................paatev-----....------.-----.....---.-Q.........................C.SP.WKKN...............................ACCTASTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............S..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........RTFESYF.PT..PA...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3P8TBQ6_AMPPE/37-209              ................................................cchpqcldykp-----....----PF.QPHQ-.....PLV.F-.........................C.KE.YSKF...............................GCCDVEKD.EQ.IS...H.RF.........YT..iME.N--FDH..S..............G..Y.....V...--..........TCG.RYI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.MLP.gLC....GD....YCSDYWHQCRY.T.....L---...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------gllledsgspqqfanltatieedrrkfcdflelkdqqycypnvlmntelnanlglvredpkgcl
A0A3Q1AU19_AMPOC/35-196              ..................................................qcldfkppf-----....------.--RPR.....RDL.EF.........................C.VM.YKEF...............................GCCDYEKD.QE.LM...T.KY.........YQ..iMD.NFD---..-..............Y..H.....G...YA..........NCA.SFV...LEL..LC-QECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....PD....YCSQFWRKCSI.I.....IPLL...S...DD.....--.-.--..........................--PHV.....AK..I-.R..E..NQT........HLCQYLE.LD..DV...D.YCy....pHLLSNQ.KLSQHl..gRVQSD................SYGCL-q...............................................................
A0A3Q1M192_BOVIN/30-205              ...........................................................VCMNA....KPHKPE.PGPEA.....ELY.EE.........................C.IP.WKDN...............................ACCTASTS.WE.AH...L.DV.........SL...LY.NFSLVH..C..............G..L.....M...MP..........DCQ.RHF...LQA..ICFYQCSP.NLGPW....IQQvd.......................................prWQAE..RVL.DAP..LC....LE....DCERWWADCRT.S.....HTCK...S...NW.....LG.G.WA..........................WSRGK.....PR..CP.E..W..EPC........RPFPHHF.PT..PA...D.LC......ERIWSG.SFRAS....PERRG................SGRCLQ................................................................
A0A3Q3RZ90_9TELE/28-209              ...........................................................VCLQD....GKHKAT.PSPEP.....HLG.-E.........................C.AL.YADN...............................SCCTQEDI.QD.IA...H.VP.........SA..sSK.NEPWDR..C..............G..P.....L...SS..........ECE.GFL...KRV..SCFYRCSP.DAARW....PHP...........................................HSRS..YIQ.AVP..LC....HS....FCHDWFEACRM.D.....LTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GTC........VQYQQMY.QH..GR...D.LC......ESLWGD.AFVTV....EEEPA................------dvgqagepgaegdgrrpcgclt..........................................
H0WGV9_OTOGA/36-211                  ...........................................................VCMDA....KHHKEK.PGPED.....NLH.RQ.........................C.SP.WKKN...............................ACCSVNTS.QE.AH...K.DN.........SY...LY.NFNWDH..C..............G..M.....M...QP..........ICK.QHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.NVP..LC....KE....DCEHWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGT.....NH..CP.V..K..TTC........RPFHIVF.PT..PA...A.LC......NEIWSH.SYEVS....NYSRG................SGRCIQ................................................................
A0A1V4JW39_PATFA/1-154               ..........................................................m-----....------.-----.....---.--.........................C.RG.LYPR..............................lSCCSRTDA.QG.LL...H.AE.........AK..iLS.------..-..............V..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETPE..REL.TLP.yLC....RD....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKDEEi..sRKHKH................NCFCIQ................................................................
A0A3Q1M4M1_BOVIN/26-208              ...........................................................VCMNA....KPHKPE.PGPEA.....ELY.EE.........................C.IP.WKDN...............................ACCTASTS.WE.AH...L.DV.........SL...LY.NFSLVH..C..............G..L.....M...MP..........DCQ.RHF...LQA..ICFYQCSP.NLGPW....IQQvgrgg................................lgvdprWQAE..RVL.DAP..LC....LE....DCERWWADCRT.S.....HTCK...S...NW.....LG.G.WA..........................WSRGK.....PR..CP.E..W..EPC........RPFPHHF.PT..PA...D.LC......ERIWSG.SFRAS....PERRG................SGRCLQ................................................................
A0A093GV59_STRCA/3-165               ..............................................qcldygppfqppf-----....------.-----.....-HL.EF.........................C.TA.YENF...............................GCCDQEKD.NS.IA...A.KY.........WE..iMD.HID---..-..............P..Q.....R...HK..........LCG.TYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....FD....YCSEFHFNCRS.A.....IGLL...-...--.....--.-.TA..........................DKHIQ.....EC..C-.E..T..NKT........RFCNLLN.VH..DK...D.YCf....pN-----.-----....-----................------vlknialnrnlgsvvedrkgclq.........................................
A0A2K6RR39_RHIRO/47-110              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...DA..........---.---...---..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------tlsrt...........................................................
A0A091LJK1_CATAU/3-129               ........................................................lsv-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQIL....FHSpe.......................................kgETPE..REL.TLP.yLC....KD....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A5F9CRB4_RABIT/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlemls...............ggevlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NQ...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HAQSL....FHSp........................................ekEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....LPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A673B7A9_9TELE/28-203              ...........................................................MCMDA....KHHKVE.PGPEG.....YLY.RQ.........................C.EP.WRDN...............................ACCTSNTS.TA.AH...D.DN.........SY...LY.NFNWNH..C..............G..A.....M...SE..........QCK.KHF...IQD..TCFYECSP.HLGPW....IQQtd.......................................qsWRKE..RIL.DVP..LC....QE....DCHSWWEDCKN.D.....FTCK...T...DW.....HK.G.WD..........................WSSGT.....NK..CP.K..D..SRC........SKWTEIY.PT..PQ...S.MC......EQIWSN.SYRYT....TYSKT................SGRCMQ................................................................
A0A444UEV1_ACIRT/63-225              .....................................................qcldyr-----....---PPF.KPPH-.....-HL.EF.........................C.TQ.YDKF...............................GCCDQNKD.ND.IA...E.RY.........WD...IM.DFFD--..-..............I..Q.....G...HE..........LCG.GFV...KDL..LC-QECSP.YAAHL....FDA..........................................eDPYT..PVR.NLP.gLC....FN....YCSEFHIKCQS.V.....ITLL...T...D-.....--.-.--..........................-DKNL....rES..C-.E..K..DRY........KFCNLMN.LP..DQ...D.YCf....pNVIQNT.DLNSNl..gSVVQD................SKGCFQ................................................................
A0A2K6A9I0_MANLE/4-146               .........................................................gs-----....------.-----.....---.--.........................-.--.----...............................--CVFPTH.QE.LH...K.DT.........SH...LY.NFNWDH..C..............G..K.....M...EP..........ACK.CHF...IQD..TCLYECSP.NLGPW....ICW...........................................-RKE..RIL.NVP..LC....KE....DCERWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGI.....NE..CP.A..R..ALC........RTFESYF.PT..PA...A.LC......EGLWSH.SFKVS....NYSGG................SGRCIQ................................................................
A0A1U7SET6_ALLSI/5-167               ...............................................qcldygppfqpp-----....------.-----.....LHL.EF.........................C.SA.YEKF...............................GCCDQEKD.NS.IA...A.KY.........WE...IM.DYIS--..-..............P..Q.....G...HR..........LCG.RYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSEFHFNCHS.A.....ITLL...T...N-.....--.-.--..........................DKHIQ.....EC..C-.E..R..NKT........RFCNLLN.LQ..DQ...D.YCf....pNVLKNT.DLNRNl..gSVVED................PKGCL-q...............................................................
A0A3Q2H4A7_HORSE/36-211              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCSVNTS.RE.LH...K.DT.........SL...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RFL.DVP..LC....KE....DCESWWEACRT.S.....YTCK...S...NW.....QK.G.WD..........................WTSGS.....NK..CP.A..E..ATC........RTFESYF.PT..PA...A.LC......EELWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A2Y9F958_PHYMC/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........SK...MF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lFC....KD....YCKEFFYTCRG.H.....VPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A5F4CYM6_CANLF/31-206              ...........................................................VCMDA....KHHKEK.PSPED.....GLH.KQ.........................C.SP.WKKN...............................SCCFANTS.RE.AH...K.DI.........SY...LY.RFNWNH..C..............G..S.....M...TP..........ACK.KHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.HVP..LC....KE....DCEQWWQDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGV.....NK..CP.A..R..TTC........RTFEAYF.PT..PA...A.LC......EGIWDH.SYKAT....NYRRG................SGRCIQ................................................................
A0A2Y9HW32_NEOSC/44-206              ...............................................qcldygppfqpp-----....------.-----.....LHL.EF.........................C.SA.YESF...............................GCCDQHRD.RR.LA...A.RY.........RD...IM.DY-FDL..-..............-..G.....G...HE..........LCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSKCHS.A.....ISLL...T...ND.....LR.L.--..........................-----.....QG..SH.E..K..DGA........HFCHLLN.LP..DK...D.YC......------.-----....-----................------fpnvlrndhlnrnlgvvaedhqgclq......................................
A0A2F0B285_ESCRO/44-203              .................................................dygppfqpll-----....------.-----.....-HL.EF.........................C.SD.YESF...............................GCCDQRKD.HR.IA...A.RY.........WD..iME.YFD---..-..............L..K.....G...HE..........RCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....SD....YCSAFHSNCHS.A.....ISLL...T...ND.....RR.L.QE..........................-----.....--..SH.D..K..DGA........RFCHLLN.VP..DK...D.YC......------.-----....-----................------fpnvlrsdhlnrnlgvvaedprgclq......................................
A0A452STK5_URSAM/20-194              ...........................................wgaqprtprarmdlln-----....------.-----.....---.-Vc......................mdC.TP.WKEK...............................ACCSASTS.QE.LH...K.DI.........SL...LY.NFTWDH..C..............G..K.....M...EP..........ACR.RHF...IQD..NCLYECSP.NLGPW....IREvn.......................................qsWRRE..RFL.HVP..LC....KE....DCQRWWEDCRT.S.....YTCK...A...NW.....HR.G.WD..........................WTSGI.....NK..CP.A..K..TTC........RTFEAYF.PT..PA...A.LC......EGLWSH.SYQAS....NYSRG................SGRCIQ................................................................
A0A1U7T349_CARSF/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RVM.SQlells...............ggeapC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........SK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................ekEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
K7FXM9_PELSI/22-189                  ...........................................................RCLEG....ETHKPR.PSPEP.....DMH.E-.........................C.TL.YSES...............................SCCYANFT.EQ.LA...H.SP.........VI..kVS.HSSWDR..C..............G..E.....L...SK..........SCE.EYM...KKI..ECFYRCSP.HAAHW....INP...........................................NYTS..GIK.LVP..LC....QN....FCDDWYEACKS.D.....LTCV...H...NW.....LT.D.WE..........................WDENG....eNH..C-.-..K..NEC........ISYDKVY.AN..GT...D.LC......QSMWGD.SFKVS....---DS................SCLCLQ................................................................
A0A068Y5C3_ECHMU/36-215              ..........................................................i-CPDS....GELKDH.PSPEP.....DLK.Q-.........................C.GE.WKSR...............................TCCSPETA.EQ.IA...-.-N.........AT...LH.GFSFDF..C..............G..N.....M...SE..........QCR.NYF...HYD..YCMVKCSP.DLGPW....IVKmt.......................................ssRFKE..RAF.RVP..LC....ES....DCCAWYEACKW.D.....KACF...T...NW....rSG.G.FD..........................WSEGT.....NK..CR.K..G..FEC........LNISMVY.GS..PT...A.FC......EHVWDH.AYRVV....PVE--................------svavwgssdkycmh..................................................
G1NQU6_MELGA/30-211                  ...........................................................VCMDA....KHHKTK.PGPE-.....GLH.GQ.........................C.AP.WKDN...............................ACCTANTS.SE.AH...R.DQ.........SY...LY.NFNWNH..C..............G..V.....M...PP..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQvgy.....................................pssPRDS..STL.RAL..LC....DE....HFYIYWWCMAE.S.....WICP...P...SPvlshhTS.G.WQ..........................LSSGT.....NR..CP.W..G..SMC........RPFTQVF.PR..PK...D.LC......EKIWSN.SYKYT....TERRG................SGRCIQ................................................................
A0A151NL04_ALLMI/35-221              ...........................................................RCLNG....SPPRRL.KKRER.....RLL.LLdepas..............gaellpC.RG.HYPR..............................lSCCARAGR.HG.LL...L.LP.........AA...TK.IFS---..-..............V..T.....N...NT..........ECM.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETSE..REL.VLP.yLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2K6KH33_RHIBE/22-183              ..................................................qcldfrppf-----....------.--RPP.....QLL.RL.........................C.AQ.YSDF...............................GCCDEGRD.AE.LT...R.RF.........WD...LAsRV----..D..............A..A.....E...WA..........ACA.GYA...RDL..LC-QECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRG.L.....FRHL...S...TD.....-R.-.--..........................----E.....LQ..VL.E..G..NRA........RFCHYLS.LD..DT...D.YCf....pYLLVNK.NLNSNl..gHVVAD................AKGCL-q...............................................................
H2ZLB1_CIOSA/30-139                  ...........................................................VCMDG....KHHKAT.PGPEA.....ELF.GT.........................C.SP.WKDR...............................SCCTNETA.FL.SH...Q.DG.........EE..gAY.GFNYDH..C..............G.qK.....M...SD..........KCR.QRF...NED..NCFYECSP.NMGPW....IVDvq.......................................ssYRNQ..KFE.DVP..LC....MS....ECVDWW-----.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------................................................................
A0A2I3RAM3_PANTR/3-164               .....................................................paatev-----....------.-----.....---.-Q.........................C.SP.WKKN...............................ACCTASTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........RTFESYF.PT..PA...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A6G0WZV7_9STRA/17-168              .............................................crstggikfdplep-----....-----S.RQQKQ.....RTL.EH.........................C.AK.YWQN...............................SCCNATHT.LP.LK...R.QI.........ME..pIV.------..-..............A..N.....F...NT..........KCQ.AMH...EEL..TCSA-CHP.FIGTG...rMD-...........................................----..---.--R..VC....PD....LCDEWYDSCKD.E.....FYTP...-...--.....-S.G.GQ.........................sLSPCY....gN-..--.-..A..LVC........SPLRHIV.ST..GR...E.FC......KRM-GY.-----....-----................------tpgkstdtegvtcfd.................................................
A0A1S3JE41_LINUN/10-111              ...........................dhspeknqyqnqrpdqnpypfwyqspeqnqfg-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................----..---.---..--....--....LCEEWWDACKE.E.....YTCH...R...NW.....IT.D.MD..........................W--GE....iNS..CK.E..G..SVC........KKYKEFY.SS..AA...D.FC......TAIWHD.AYKVV....---PD................SEPCM-v...............................................................
A0A6J3R8G1_TURTR/27-177              ..........................................................a-C---....GGSHPL.PARSQ.....RHH.RL.........................V.TN.LGTS...............................QLHLAEMN.TP.EA...S.DP.........GI...VS.----GS..C..............G..E.....L...SP..........GCE.SFL...GNL..QVALRSRF.HLLLL...gVRQ...........................................----..---.TQP..LC....SE....LCDAWFATCES.D.....IIC-...-...--.....SP.T.WL..........................PLLEK.....RG..C-.-..E..PGC........TTYGQTF.AD..GA...E.LC......RSFLGY.AVPVA....--DPG................SGHCLN................................................................
A0A6A1Q9Z3_BALPH/19-134              .......................................................lkgh-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...-E..........RCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....SD....YCSAFHSNCHS.A.....ISLL...T...ND.....RR.L.-Q..........................-----.....-E..SH.D..K..DGA........RFCHLLN.VP..DK...D.YC......------.-----....-----................------fpnvlrsdhlnrnlgvvaedprgclq......................................
A0A0C2JGK5_THEKT/25-189              ...........................................................YCLKN....EHDKST.PTHEN....tAEM.GI.........................C.QP.WSNY...............................SCCSSKTA.QY.IT...S.PG.........EL..yIR.NVLYNQ..Cp...........hrG..T.....L...SN..........KCK.RYF...QLD..QCFYLCGS.MFLPWl..vVTQs........................................anGTKE..RWR.GIP..MC....SS....DCEAWYEACKD.D.....FTCS...A...TW.....YP.S.SF..........................GTING....kPV..C-.-..K..TEC........RKFKDFH.PN..AR...D.FC......ETIF--.-----....-----................------kg..............................................................
A0A452F775_CAPHI/27-177              ..........................................................a-C---....GGSHPL.PARSQ.....RHR.RL.........................A.TN.LGTD...............................QLCLEEMN.PP.EA...S.DS.........GL...LP.----VR..C..............G..E.....L...SP..........RCE.SFL...VHL..QAALRSRF.HLLLL...gVRQ...........................................----..---.RQP..LC....SE....LCDAWFATCES.D.....VIC-...-...--.....SP.T.WL..........................PLLEK.....RG..C-.-..E..PGC........TTYGQTF.AD..GA...E.LC......RSLLGD.ALPVA....--DPG................SVHCLN................................................................
A0A250XD00_9CHLO/29-204              ...............................sfkstraqsdhrtckpqglltldapypq-----....------.-----.....---.--.........................-.--.---Lqvleggl................pfcpqfpcTCCNRSHI.TA.MH...R.SM.........AG...AF.DEPSSL..S..............S..S.....F...SS..........RCA.EML...KII..ACRP-CDP.MVGVG....LKE...........................................----..---.--K..VC....RH....TCKAWLSACRN.D.....YFGF...D...SI.....-S.G.AL.........................vPCSNA.....AA..TS.R..L..LIC........SRLNALV.PE..GA...EqLC......-ALEGL.EVVD-....-AEAG................ATLC--yd..............................................................
A0A2Y9IFY1_NEOSC/31-206              ...........................................................VCMDA....KHHKEK.PSPED.....QLH.KQ.........................C.SP.WKKN...............................SCCFPNTS.QE.AH...K.DI.........SY...LY.KFNWDH..C..............G..H.....M...TP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.DVP..LC....KE....DCQQWWQDCRT.S.....YTCK...S...NW.....HR.G.WN..........................WTSGY.....NQ..CP.V..G..AAC........LPFHFYF.PT..SA...A.LC......REIWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A485PAY6_LYNPA/27-159              ..........................................................f-C---....GGSRPL.PALSR.....RHH.RL.........................A.TD.FGTV...............................QLHLAEMD.TP.EA...L.DP.........GA...VP.----ER..C..............G..E.....P...SP..........GCE.SFL...GHL..QAALQSRF.RLLLL...gIRQ...........................................----..---.AQP..LC....SE....LCDVWFATCES.D.....ITC-...-...--.....GP.T.WL..........................PFPEK.....RG..C-.-..E..PGC........ATYEQVS.L-..--...-.--......------.-----....-----................------rqrvrvrd........................................................
F7C8X8_HORSE/36-211                  ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCSVNTS.RE.LH...K.DT.........SL...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.DVP..LC....KE....DCQRWWEDCRT.S.....YTCK...T...NW.....HK.G.WN..........................WTSGF.....NQ..CP.V..E..AAC........HPFDFYF.PT..PE...A.LC......NEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
U3IR18_ANAPP/35-217                  ...........................................................RCLNG....TPPRRL.KKRDR.....RLL.APeapg................ggeamC.RG.LYPR..............................lSCCPRADT.PG.LL...H.AD.........TK..iLS.------..-..............V..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETSE..REL.TLP.yLC....KD....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A2Y9EKS1_PHYMC/54-204              ..........................................................a-C---....GGSHPL.PARSQ.....RHH.RL.........................A.TN.LGTS...............................QLHLAEMN.TP.EA...S.DP.........GI...VS.----GR..C..............G..E.....L...SP..........RCE.SFL...GHL..QVALRSRF.HLLLL...gVRQ...........................................----..---.TQP..LC....SE....LCDAWFATCES.D.....IIC-...-...--.....SP.T.WL..........................PLLEK.....RG..C-.-..E..PGC........TTYGQTF.AD..GA...E.LC......RTFLGY.AVPVA....--DPG................SGHCLN................................................................
A0A3Q1NCZ3_BOVIN/84-202              .........................................qlgakalehpdlsvlsls-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...MS..........RCE.SFL...VHL..QAALRSRF.HLVLL...gVRQ...........................................----..---.TQP..LC....SE....LCDAWFATCES.D.....VIC-...-...--.....SP.T.WL..........................PLLEK.....RG..C-.-..E..PGC........TTYRQTF.AD..GA...E.LC......RSLLGD.ALPVA....--DPG................SGHCLN................................................................
A0A665UJL7_ECHNA/38-210              ..............................................chpqcldykppfe-----....------.--PQQ.....PLV.F-.........................C.KE.YSKF...............................GCCDLEKD.EQ.IS...V.RF.........YS..iME.N--FDH..S..............G..F.....-...-I..........TCG.KYI...RNI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.ILP.gLC....GD....YCYNYWHQCRY.T.....LSLL...L...EN.....MG.S.PQ..........................QLSNL.....TA..AI.E..E..DRR........RFCDLLE.LK..DK...Q.YC......------.-----....-----................------ypnvltnaelnanlglmredpegcle......................................
A0A2K6AU51_MACNE/36-211              ...........................................................VCMNA....KHHKAQ.PSPED.....ELY.GQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..ACLYECSP.NLGPW....IRQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGI.....NE..CP.A..R..ALC........RTFESYF.PT..PA...A.LC......EGLWSH.SFKVS....NYSGG................SGRCIQ................................................................
A0A672UZV8_STRHB/28-203              ...........................................................VCMDA....KHHKTE.PGPEG.....ELF.GQ.........................C.SL.WKDN...............................ACCTANTS.VE.AH...L.DQ.........SY...LY.SFNWDH..C..............G..V.....M...PA..........KCK.RHF...IQD..TCLYECSP.NLGPW....IEEad.......................................tsWRRQ..RVL.HVP..LC....RE....DCEQWWEDCQD.T.....FTCK...V...NW.....HK.G.WN..........................WTSGT.....NR..CP.Q..G..SQC........RRFAAVF.GS..AA...A.LC......EQVWSH.SYRYT....EYERG................SGRCIQ................................................................
A0A2I3GPA3_NOMLE/47-113              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.D-.........................-.QV.WLEY...............................ACCTASTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACE.LFT...Q--..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------lga.............................................................
A0A091F5K7_CORBR/21-188              ..........................................................g-CLEG....DTQKPK.PSPEP.....NMQ.E-.........................C.TL.YSKS...............................SCCYADFT.EQ.LA...H.SP.........VI..kVS.NSFWNR..C..............G..Q.....L...SK..........SCE.DFT...KKI..ECFYRCSP.HAARW....IHP...........................................NDTA..AIQ.GVP..LC....QS....FCDDWYEACKD.D.....SICV...R...NW.....LT.D.WE..........................WDESG....kNH..C-.-..K..DKC........TPYSEIY.AN..GT...D.MC......QSMWGE.SFKVS....---KS................SCLCLQ................................................................
A0A2K5Q8K8_CEBCA/37-193              ..........................................................a-C---....GGSRPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagPCCPSEMD.TT.ET...S.GP.........RT...--.--YPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.HLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A2U1MUM5_ARTAN/54-202              ................................................tiqgkpprrvs-----....------.--KGP.....TDL.TL.........................C.RL.FRKN...............................TCCDVTQT.HP.AL...L.AI.........RR...LA.S-----..T..............G..E.....A...SD..........ECL.HLW...ELL..ECSI-CDP.HVG--....VQP...........................................----..---.GSP.vIC....AS....LCDRIYDACSN.A.....YFAM...D...AK.....NQ.V.--..........................--LAP.....CG..I-.S..D..TVC........GRASEWV.SN..GT...E.LC......KAT-GF.SVKAS....SD---................------fkdsfcyg........................................................
A0A493T565_ANAPP/35-217              ...........................................................RCLNG....TPPRRL.KKRDR.....RLL.APeapg................ggeamC.RG.LYPR..............................lSCCPRADT.PG.LL...H.AD.........TK..iLS.------..-..............V..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETSE..REL.TLP.yLC....KD....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
M7BZS7_CHEMY/26-201                  ...........................................................MCMDA....KHHKTQ.PGPEG.....ALH.GQ.........................C.VL.WKDN...............................ACCTANTS.ME.AH...Q.DQ.........SY...LY.SFNWDH..C..............G..V.....M...PD..........KCK.QHF...IQD..TCLYECSP.NLGPW....IQQad.......................................tsWRRE..RIL.NVP..LC....KE....DCELWWEDCKD.A.....ITCK...E...NW.....HK.G.WN..........................WTSGT.....NQ..CP.R..G..SMC........QPFKYVF.PQ..PA...D.LC......EKIWSN.SYKYT....LEHRG................GGRCIQ................................................................
A0A096NJQ0_PAPAN/20-181              ..................................................qcldfrppf-----....------.--RPP.....QLL.RL.........................C.AQ.YSDF...............................GCCDEGRD.AE.LT...R.RF.........WD...LAsRV----..D..............A..A.....E...WA..........ACA.GYA...RDL..LC-QECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRG.L.....FHHL...S...T-.....--.-.--..........................-DQEL.....RA..L-.E..G..NRA........RFCRYLS.LD..DT...D.YCf....pYLLVNK.NLNSNl..gHVVAD................AKGCL-q...............................................................
A0A3P4M4I9_GULGU/27-164              ...........................................................VCMNT....KHHKRE.PGPED.....RLY.KE.........................C.NP.WQGN...............................ACCRAGTS.LD.AH...L.DL.........PL...LY.NFSLHH..C..............G..V.....M...PP..........DCE.KHF...LQA..ICFYQCSP.NLGPW....IQKld.......................................sgAPGE..RIL.EAP..LC....RE....DCEQWWEDCRT.S.....YTCT...A...DW.....-H.G.WD..........................RSGGK.....C-..--.-..-..---........-------.--..--...-.--......------.-----....-----................------rslsrap.........................................................
L5K4Y9_PTEAL/31-165                  ...........................................................VCMDA....KHHKEK.PSPED.....KLH.MQ.........................C.SP.WKKN...............................ACCSVNTS.EE.AH...K.DI.........SN...LY.KFNWDH..C..............G..Q.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.DVP..LC....KE....DCQSWWEDCRS.S.....YTCK...S...NW.....HK.G.WN..........................WTSGS.....NQ..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------p...............................................................
A0A4U1FIT9_MONMO/26-201              ...........................................................ICVNA....KPHKPA.PSPEA.....KLH.EE.........................C.IP.WKDN...............................ACCTANTS.WE.AH...L.DV.........SL...LY.NFSLVH..C..............G..L.....M...MP..........DCQ.KHF...LQA..ICFYECSP.NLGPW....IQRld.......................................prGQAE..RIL.DAP..LC....WE....DCEQWWADCRT.S.....YTCK...S...NW.....HG.G.WT..........................WSRGK.....PR..CP.A..R..ALC........HPFLHYF.PT..PA...D.LC......EKIWSN.SFKAS....PEHRT................SGRCLQ................................................................
A0A485MES2_LYNPA/31-206              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.TP.WRKN...............................ACCSHNTS.QE.LH...K.DP.........SL...LY.NFNLDH..C..............G..K.....I...EP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQQWWEDCRT.S.....YTCK...N...NW.....HK.G.WD..........................WSSGS.....NK..CP.A..G..ATC........RTFETYF.PT..PA...A.LC......EGIWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A6G1B006_CROCR/33-208              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.TP.WKKN...............................ACCSLNTS.QE.LH...Q.DP.........SL...LY.NFNLDH..C..............G..K.....M...EP..........TCR.RHF...VQD..NCLYECSP.NLGPW....IQEvk.......................................qsWRKE..RFL.DVP..LC....KE....DCQQWWEDCRT.S.....HTCK...N...NW.....HR.G.WN..........................WSSGF.....NK..CP.A..G..ATC........RTFESYF.PS..PA...A.LC......EGIWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A1L8HLT8_XENLA/38-218              ...........................................................RCLNG....SPPSRV.KKRHR.....KLQ.TLdlgg.................agegC.GG.FYPR..............................lSCCPKPDI.PG.MP...M.DN.........KI...LS.------..-..............V..A.....N...NT..........ECA.KLV...EEI..QCAH-CSP.HAQNL....FHAsd.......................................ksETPE..KQL.FLP.aLC....KD....YCKEFYYTCRG.H.....IPG-...-...-L.....IQ.T.SA..........................DEFCF....yHG..IK.D..S..GLCf.....pdFPRKQIR.GP..AS...N.YL......NQMEDY.DKVEEi..sSKHKH................NCYCIQ................................................................
A0A2G2XX60_CAPAN/38-189              ..................................................rfsnegkpp-----....----RK.VKKGP.....RDL.NL.........................C.RV.FRGK...............................TCCDVTQT.HP.AL...I.SI.........RR...LA.-----S..T..............G..E.....A...SQ..........ECL.HLW...EML..ECSI-CDP.RVG--....VQA...........................................----..---.GPP.vLC....TS....FCDKVYQACSN.A.....YFAI...D...AK.....-T.Q.VL..........................AP---.....CA..I-.N..D..FVC........GRASEWI.SN..GT...E.LC......HV-AGF.SVKSM....SDDPE................EASCY-g...............................................................
A0A4U1FLC1_MONMO/31-192              ......................................................qcldf-----....--RPPF.RPPQP.....LR-.-F.........................C.AQ.YSAF...............................GCCAPEQD.AA.LA...R.RF.........GA..lAA.RV----..D..............A..A.....I...WA..........ECA.GYA...LDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDLWQSCRG.L.....FRHL...S...PD.....RE.L.WT..........................LEGNR....aKF..--.-..-..--C........RYLS---.LD..DT...D.YCf....pHLLVNE.NLNSNl..gRVVAD................AMGCL-q...............................................................
A0A2K6BLU8_MACNE/56-238              ...........................................................ICMNA....KHHKRV.PGPED.....KLY.EE.........................C.IP.WKDN...............................ACCTLTTS.WE.AH...L.DV.........SP...LY.NFSLFH..C..............G..L.....L...MP..........GCR.KHF...IQA..ICFYECSP.NLGPW....IRPvgslg................................weeapsGQGE..RVM.NAP..LC....QE....DCEEWWEDCRL.S.....YTCK...S...NW.....RG.G.WD..........................WSQGK.....NR..CP.K..G..AQC........LPFSHYF.PT..PA...D.LC......EKTWSN.SFKAS....PERRN................SGQCLQ................................................................
A0A3Q7XHD9_URSAR/1-120               ...........................................................-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....M...EP..........ACR.RHF...IQD..NCLYECSP.NLGPW....IREvn.......................................qsWRRE..RFL.HVP..LC....KE....DCQRWWEDCRT.S.....YTCK...A...NW.....HR.G.WD..........................WTSGI.....NK..CP.A..K..TTC........RTFEAYF.PT..PA...A.LC......EGLWSH.SYQAS....NYSRG................SGRCIQ................................................................
A0A2I2U806_FELCA/26-201              ...........................................................VCMNT....KHHKRE.PGPED.....QLY.DE.........................C.TP.WKDN...............................ACCTASTS.WE.AH...L.DV.........SL...LY.NFSLIH..C..............G..L.....M...MP..........GCE.KHF...IQA..ICFYECSP.NLGPW....IRKmd.......................................laGPGE..RIL.DVP..LC....QE....DCEQWWEDCRT.S.....YTCK...S...NW.....HG.D.WD..........................WSRGK.....NR..CP.A..R..AVC........HPFPHYF.PT..PA...D.LC......EKIWSN.SFKAS....PEGRN................SGRCLQ................................................................
A0A6Q2YSL3_ESOLU/34-195              ..................................................qcldfkppf-----....------.KPQ--.....EDL.QF.........................C.TM.YGTF...............................GCCDSVKD.QE.LM...T.KF.........YN..iMD.NFD---..-..............Y..Y.....G...YA..........NCA.GYV...QDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PTR.TIP.gLC....PD....YCSQFWSKCRS.T.....ITLL...S...DQ.....PQ.H.AE..........................TEQDQ....vRF..C-.-..-..---........---QN--.--..--...-.--......------.-----....-----................------lqledpdycyphilrneqltqnlgrvvanpegclq.............................
A0A444UJL7_ACIRT/29-190              ..........................................................q-CL--....DYKPPF.KPPEP.....LTF.--.........................C.TE.YSQF...............................GCCDSEQE.QL.IM...R.RY.........YR...VM.DF-FDY..-..............-..S.....G...YV..........ACG.KYI...QSI..LC-QECCP.YAAHL....YDA..........................................eDANT..PMR.ELP.gLC....GE....YCTDFWHRCRS.T.....LSLL...M...ED.....DE.M.IE..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------iegdrdkfcafmelkdpeycypnvltnaelnadlgavrtdpegclq..................
H0XSY6_OTOGA/30-205                  ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WRKN...............................ACCSVNTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RFL.DVP..LC....KD....DCQQWWEACRT.S.....YTCK...S...NW.....HK.G.WD..........................WSSGV.....NK..CP.A..G..TTC........RTFESYF.PT..PA...A.LC......EGLWSH.SYKVS....NYSQG................SGRCIQ................................................................
A0A3Q2VNP5_HAPBU/23-175              ...........................................................MCMDA....KHHKTE.PGPEG.....QLY.QQ.........................C.SP.WRDN...............................ACCTANTS.AE.AH...D.DA.........SY...LY.NFNWNH..C..............G..T.....M...SK..........ECK.KHF...IQD..TCFYECSP.HLGPW....IQPvd.......................................qsWRKE..RIL.DVP..LC....KE....DCETWWEDCKN.D.....FTCK...T...NW.....HK.G.WD..........................WSSGG.....AH..TW.K..-..---........-------.--..--...-.--......------.-----....-----................------skagmhvcacislinhs...............................................
A0A2Y9ID55_NEOSC/36-211              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.GQ.........................C.TP.WKDK...............................ACCSASTS.QE.LH...K.DI.........SL...LY.NFTVDH..C..............G..K.....M...EP..........TCK.RHF...IQD..NCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.HVP..LC....KE....DCQQWWQDCRT.S.....YTCK...S...NW.....HR.G.WN..........................WTSGI.....NQ..CP.T..G..TTC........RTFETYF.PT..PA...A.LC......EGLWSH.SYKLS....NYRRG................SGRCIQ................................................................
F6WFD9_CIOIN/35-207                  ...........................................................TCLSS....KHHKTQ.PGPED.....NLF.K-.........................C.SA.WLNN...............................SCCTNYTA.QY.VH...G.DG.........QP...LY.NLNFSH..C..............A..P.....M...SD..........KCR.NHF...TNN..NCFYECSP.YLGPW....ITPqk.......................................lsYRHE..RMY.KVP..LC....AS....QCNAWWQDCKD.E.....STCV...E...NW.....ST.G.FK..........................WDKSG.....NH..CP.R..N..TVC........RPFTSVY.HN..AS...H.FC......ETVWGPdDFVVT....---PD................HNYCM-k...............................................................
D7U9Y5_VITVI/37-188                  .................................................pfssegkppk-----....-----K.VSKGP.....KDL.TL.........................C.RV.FRRK...............................TCCDVSQT.HP.AL...L.SI.........RR...LA.S-----..T..............G..E.....A...SQ..........ECL.QLW...ELL..ECSI-CDP.HVG--....VQP...........................................----..---.GPP.vIC....TS....LCDKVFQACSN.A.....YFSM...D...AK.....-R.Q.VL..........................APCGV.....--..--.G..D..FVC........GRASEWI.SN..GT...D.LC......HAV-GF.SVKPS....DAGME................ETSC--yg..............................................................
A0A383WEW0_TETOB/10-182              .........................scccwitatepvckqqgllmldephppyrvrlpf-----....------.-----.....---.--.........................C.DK.YR-C...............................SCCNASHA.LA.IQ...R.SV.........AP..lLA.D-----..-..............E..E.....L...GL..........ACK.AGL...VAL..ACRL-CDP.RVGVG....--N...........................................----..---.VTT..VC....ES....MCDRVYEACSE.D.....YFAF...D...ES.....-S.G.L-..........................VTPCT.....GQ..QG.G..S..LVC........SQLQQVV.PS..GA...D.FC......RAA-GY.T----....-----................------psesssisssssssvgsvacfd..........................................
A0A2K5Y2E9_MANLE/37-193              ..........................................................a-C---....GGSHPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagTCCPSEMD.AT.EI...S.GP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
M3W6W1_FELCA/36-211                  ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.TP.WRKN...............................ACCSHNTS.QE.LH...K.DP.........SL...LY.NFNLDH..C..............G..K.....I...EP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQQWWEDCRT.S.....YTCK...S...NW.....HK.G.WD..........................WSSGS.....NK..CP.A..G..ATC........RTFETYF.PT..PA...A.LC......EGIWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A5N3X8E8_MUNRE/31-192              ......................................................qcldf-----....--RPPF.RPPQP.....LR-.-F.........................C.AQ.YSAF...............................GCCTPEQD.AA.LA...R.RF.........GA..vAA.RVD---..-..............A..A.....M...WA..........ECA.GYA...LDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDLWQTCRG.L.....FRHL...S...PD.....RE.L.WA..........................LEGNR.....A-..--.-..-..KLC........RSLSL--.-D..DT...D.YCf....pRLLVNE.NLNSNl..gRVVAD................AEGCLQ................................................................
A0A1W0A3G6_9STRA/3-151               ............................................crsvgtikfdpssvp-----....------.--MQQ.....RVM.EH.........................C.SK.YHKS...............................SCCNATHN.VP.LK...R.LI.........LE..pIA.------..-..............A..N.....V...NV..........KCQ.QFH...EEL..ACSA-CHP.HVGTS...rIE-...........................................----..---.--R..IC....PD....LCDEWYDACKD.E.....FYMS...G...N-.....--.H.HL..........................APCYG.....NA..L-.-..-..-IC........SRLKDIV.PT..GK...G.FC......RMM-GY.T----....-----................------pgkatdtegidcfd..................................................
A0A2B4SL49_STYPI/31-197              ..........................................................k-CIDG....PYHKQR.PTAEG.....ANY.VE.........................C.HP.WKEK...............................TCCTADFT.AQ.LN...K.SN.........VE..vLY.NFSWHH..C..............G..N.....L...SK..........ECE.RYI...KNE..ECFYSCEP.SLIKW....HT-...........................................-SKG..GVK.GVP..IC....AD....YCDKWFDACKN.D.....MTCA...E...DW.....LE.D.FN..........................FTSSQ.....YS..CR.S..N..SQC........RKFSELY.KD..GK...G.LC......NKMWGQ.SFTYE....----K................SDNCM-v...............................................................
C3Y1A9_BRAFL/1018-1187               ..........................................................g-CLGD....RKHKRT.PGPEP.....DLQ.V-.........................C.SE.YSMN...............................SCCSAEFD.QQ.LR...M.SP.........VV..kID.QFYMNR..C..............G..T.....M...SP..........RCE.QFR...LAM..NCHYHCDP.MIYRY....GKR...........................................GHPW..AVQ.NIP..IC....SS....FCDDFFDACRD.D.....LTCA...E...SQ.....AT.D.WY..........................YSPEG....iNN..CR.P..D..SKC........RTFAEVY.VD..GR...G.LC......NNIWSD.SYVYT....---ED................DDTCI-n...............................................................
A0A6I8QVG0_XENTR/19-181              ..................................................qcldyappf-----....------.KPP--.....AHL.EF.........................C.SQ.YETF...............................GCCDQDRD.NA.IA...E.KY.........WS..iMD.YFD---..-..............L..N.....G...YH..........TCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eDPHT..PLR.IIP.gLC....FN....YCSEFHLKCQS.S.....VTLL...T...E-.....--.-.--..........................DKQIR.....ES..C-.N..K..GRD........LFCNLLN.LP..DE...D.YCf....pN-----.-----....-----................------vlhntdlnnnlgsvvedpegcmk.........................................
A0A2K5VIZ1_MACFA/34-204              ...........................................................VCMNA....KQHKAQ.PSPED.....ELY.G-.........................-.--.-QKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.CHF...IQD..TCLYECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGI.....NE..CP.A..R..ALC........RTFESYF.PT..PA...A.LC......EGLWSH.SFKVS....NYSGG................SGRCIQ................................................................
A0A643CFX6_BALPH/30-205              ...........................................................VCMDA....KHHKIK.PGPED.....KLH.DQ.........................C.IP.WKKN...............................ACCSAKVS.QE.LH...R.DT.........SS...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RVL.NVP..LC....KE....DCQSWWEDCRT.S.....YTCK...T...NW.....HK.G.WN..........................WTSGS.....NK..CP.T..G..TTC........GTFEFYF.PT..PA...A.LC......EGLWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A6I8PEH6_ORNAN/27-202              ...........................................................VCMDA....KHHKTE.PGPED.....DLH.QQ.........................C.SP.WRDN...............................ACCTKNTS.HA.AH...Q.DG.........SY...LY.NFNWQH..C..............A..N.....M...TP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQKvd.......................................asWRRE..RIL.NVP..LC....KE....DCELWWKDCQT.S.....YTCK...S...NW.....HK.G.WD..........................WSSGQ.....NR..CP.V..Q..EAC........HPFPFYF.PT..PA...D.LC......QRIWSN.SYRIS....NESRG................SGRCIQ................................................................
A0A091HRR1_CALAN/31-206              ...........................................................ICMDA....KHHKTK.PGPEG.....MLH.DQ.........................C.SP.WKDN...............................ACCTANTT.SE.AH...R.DQ.........SN...LY.NFNWNH..C..............G..L.....M...PP..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQvd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKD.C.....VTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFSQVF.PH..PK...D.LC......EKIWSN.SYRYT....TEHRG................SGRCIQ................................................................
A0A3Q7ST53_VULVU/31-206              ...........................................................VCMDA....KHHKEK.PSPED.....GLH.KQ.........................C.SP.WKKN...............................SCCFANTS.RE.AH...K.DI.........SY...LY.RFNWNH..C..............G..S.....M...TP..........ACK.KHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.HVP..LC....KE....DCELWWQDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGY.....NQ..CP.E..G..AAC........HPFHFYF.PT..SA...A.LC......SEIWSH.SYKVS....NYSXG................SGRCIQ................................................................
W5PV41_SHEEP/44-193                  ...............................................qcldyrppfqpl-----....------.-----.....QHL.EF.........................C.SD.YESF...............................GCCDQGKD.HR.IA...A.RY.........WD...IM.DYFD--..-..............L..K.....G...HE..........LCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....SD....YCSAFHSNCHS.A.....IALL...T...ND.....RR.-.LQ..........................E----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------spgkdgarfchllnlpdkdycfpnilrsdhlnrn..............................
A0A665U4E2_ECHNA/17-192              ...........................................................MCMDA....KHHKTE.PGPEG.....ELY.LQ.........................C.SP.WRDN...............................ACCTANTS.VE.AH...E.DN.........SY...LY.NFNWNH..C..............G..I.....M...SP..........KCK.KHF...TQD..ACFYECSP.NLGPW....IQQvd.......................................qsWRKE..RII.DVP..LC....ME....DCHDWWEDCKN.D.....YTCK...S...NW.....HK.G.WD..........................WSSGV.....NK..CP.E..G..SRC........RIWTEVY.PT..PK...S.MC......EQIWSS.SYLYT....TLPKS................SGRCMQ................................................................
A0A452J254_9SAUR/5-158               ..............................hyfkesfcirqgsrscvhlslvcglqifs-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............V..T.....N...NT..........ECV.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgEASE..REL.ALP.fLC....KD....YCKEFYYTCRG.Q.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2K6M560_RHIBE/36-211              ...........................................................VCMNA....KHHKAQ.PSPED.....ELY.GQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DI.........SR...LY.NFNWDH..C..............G..K.....M...QP..........ACK.RHF...IQD..ACLYECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCEHWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGI.....NE..CP.A..G..ALC........RTFESYF.PT..PA...A.LC......EGLWGH.SFKVS....NYSGG................SGRCIQ................................................................
G3H9G2_CRIGR/35-217                  ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggeilC.GG.FYPR..............................vSCCLQSDS.PG.LG...R.LE.........NK..iFS.------..-..............S..T.....N...NT..........ECG.KLL...EEI..KCAP-CSP.HSQSL...fCSPe.........................................rEVLD..GDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-L.....LQ.T.TA..........................DEFCF....yYS..RK.D..G..GSCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.EKVEEl..sRKHKH................NCFCVQ................................................................
A0A3M6UQR0_9CNID/23-165              ..................................................cfaqrqics-----....YYGSER.KPKEA.....YSL.SN.........................C.TW.YRES...............................SCCTRTEV.TS.SF...L.GM.........PH...LA.------..-..............-..T.....S...SD..........DCR.NRM...NYM..MC-YFCSP.DQYKW....LKE...........................................----..--G.KVH..IC....KS....FCDDIYTHCKD.A.....KYDG...N...SI.....GT.K.--..........................YSNGK.....HF..CE.A..-..---........-------.--..--...-.--......------.-----....-----................------qffqvvdedcfefdeeifangslh........................................
G5C7E9_HETGA/38-220                  ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggevpC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECE.KLL...EEI..KCAF-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.fLC....KD....YCKELFYTCRS.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCS....yYA..RK.D..G..GLCf.....pdFPRKQMR.GP..AS...N.SL......DQMEEY.NKVEEi..sRKHKH................NCFCVQ................................................................
A0A5A7PJ56_STRAF/40-188              ...................................................pfsnegkp-----....---PKK.ATKGP.....RDL.TL.........................C.RV.FRRN...............................TCCDVTQT.HP.AL...L.SI.........RR...LA.S----S..S..............G..E.....G...SQ..........ECL.DLW...ELL..ECSV-CDP.RVG--....VQP...........................................----..---.GPP.rVC....AS....LCDRVYEACST.A.....YFAI...D...A-.....KT.Q.V-..........................---LS.....PC..GP.S..D..FVC........GRASEWV.SN..GT...E.LC......RAS---.GFSVK....-----................------psgeescyg.......................................................
A0A2K5U044_MACFA/47-110              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...DA..........---.---...---..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------tlsrt...........................................................
A0A337S480_FELCA/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FNSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A7RFR7_NEMVE/32-212                  ...........................................................VCIDS....KHHKEK.PGPEV.....DYF.HH.........................C.TP.WKDH...............................ACCKSNTT.KH.IE...S.DG.........TI..tLY.RMRWDQ..Cp...........qkR..A.....M...SA..........KCK.RFF...EMD..TCFYECSP.YLRPWi..eVDPhs.......................................kvTRRE..RFT.NVP..LC....SS....DCDAWFEACKF.D.....YTCS...N...NWg...dME.T.WN..........................WTKNG.....ND..C-.-..K..MEC........KTFKDYF.GS..PA...N.FC......NRLFNY.SFKYI....-SGKA................GEDCM-v...............................................................
A0A0A0LIV4_CUCSA/61-218              .........................................vciskggrfapfslegkp-----....----PS.KVSKV.....QDL.TL.........................C.RV.FRKR...............................TCCGVAQT.HP.AL...L.SV.........RR...LA.S-----..T..............G..E.....A...NH..........ECL.QLW...ELL..ECSI-CDP.QVG--....VQP...........................................----..---.GPP.lIC....AS....FCDRVFKACSD.A.....YFSV...D...A-.....KT.Q.VL..........................APCGV.....ND..F-.-..-..-VC........GRASEWV.SN..GT...D.LC......NAA-GF.TIKIS....-----................------deesscyg........................................................
A0A2K6AU68_MACNE/42-105              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...DA..........---.---...---..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------tlsrt...........................................................
A0A091RJ07_9GRUI/21-188              ..........................................................e-CLEG....GTHKPK.PSPEP.....YMR.E-.........................C.TL.YSKS...............................SCCYADFT.EQ.LA...H.SP.........VI..kVN.NSYWNR..C..............G..Q.....L...SK..........SCE.DFT...KKI..ECFYRCSP.HAARW....IHP...........................................NYTA..AIQ.SVP..LC....QS....FCDDWYEACKD.D.....SICV...R...NW.....LT.D.WE..........................WDESG....eNR..C-.-..K..NKC........IPYSEMY.AN..GT...D.MC......QNMWGQ.SFKVS....---ES................SCLCLQ................................................................
A0A1U7U5A7_CARSF/1-120               ..........................................................m-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...AP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCQQWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGN.....NE..CP.V..G..SAC........YSFHFYF.PT..PE...A.LC......NEIWSH.SYKVS....NYSRG................SGRCI-e...............................................................
A0A671EZ04_RHIFE/3-164               .....................................................paakep-----....------.-----.....---.-Q.........................C.IP.WKEN...............................ACCSVSTS.QE.LH...K.DN.........SL...LY.NFNWEH..C..............G..K.....M...EP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCESWWEDCRT.S.....YTCK...R...NW.....QQ.G.WN..........................WTSGS.....NK..CP.A..K..AVC........RTFESYF.PT..PA...A.MC......EGLWSH.SYKVS....QYSRG................SGRCIQ................................................................
A0A2K6FL00_PROCO/44-200              ..........................................................v-C---....AGSHPL.HARSR.....GHH.GL.........................E.AD.LGTSqlh.........................lagSCCPSEMD.TP.ET...P.GP.........GI...FP.----ER..C..............G..A.....S...SP..........GCE.SFL...GHL..QLALRSRF.RLLLL...gVRQ...........................................----..---.AQP..LC....AE....LCQAWFAACEN.D.....VTC-...-...--.....GP.T.WL..........................PIPEK.....RS..C-.-..E..PSC........RTYGQTF.TD..GA...N.LC......RSVLDH.TLPVA....--GPG................TRHCLN................................................................
A0A4D8YN41_SALSN/47-195              ....................................................snvgkpp-----....----KK.ASKGP.....RDL.TL.........................C.RV.FRKK...............................TCCDVTQT.YP.AL...L.SI.........RR...LA.S-----..S..............G..E.....A...SQ..........ECL.NLW...EFL..ECSV-CDP.RVG--....VQR...........................................----..---.GPP.nIC....AS....FCDRIYEACSS.A.....YFAM...D...GK.....-T.Q.VL..........................A-PCG.....--..-Q.G..D..FVC........GRASEWV.SN..GT...E.LC......SAA---.GFSVK...pLDEPG................EFPC--yg..............................................................
A0A3P8SEP0_AMPPE/35-196              ..................................................qcldfkppf-----....------.--RPR.....RDL.EF.........................C.VM.YKEF...............................GCCDYEKD.QE.LM...T.KY.........YQ..iMD.NFD---..-..............Y..H.....G...YA..........NCA.SFV...LEL..LC-QECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....PD....YCSQFWRKCSI.I.....IPLL...S...DD.....-P.H.I-..........................-----.....AK..I-.R..E..NQT........HLCQYLE.LD..DV...D.YCy....pHLLSNQ.KLSQHl..gRVQSD................SYGCL-q...............................................................
A0A0R0EQG0_SOYBN/26-187              ..........................................vcvsqggrfppfksegg-----....-----A.PKNGP.....KDL.TL.........................C.RI.FRKK...............................TCCDVTHT.HP.AL...L.SV.........RK...LA.S-----..T..............G..E.....A...TQ..........ECL.HLW...ELL..ECSI-CDP.RVG--....TQP...........................................----..---.GPP.lIC....AS....LCERIYEACSN.A.....YFSM...-...DV.....KT.Q.IL..........................APCGV.....ND..F-.-..-..-VC........GRAAEWV.SN..GT...D.LC......LAA---.-----....-----................------gfrvkpsdivdiaseetscyg...........................................
A0A6I8NRH3_ORNAN/22-189              ...........................................................TCLPG....KYHKPS.PGPEP.....NMK.A-.........................C.TL.YLKN...............................SCCPANFT.EL.LA...Q.SP.........VI..gVS.DTYWNR..C..............G..T.....L...SK..........KCE.EYM...KKL..ECFYQCSP.AAAHW....KDP...........................................KNNL..GMK.FVP..LC....QN....FCDDWFEACKL.D.....HTCS...R...DW.....LT.D.WA..........................VDEKG....kKI..C-.-..Q..SQC........LPYSEVY.KN..GT...D.LC......ESMWGQ.SFRAI....---SR................SCRCL-e...............................................................
A0A2R8ZNL9_PANPA/59-197              ..........................................................a-C---....GGSRPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagPCCPSEMD.TT.ET...S.GP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQAG.--..--...-.--......------.-----....-----................------vqwrdlssm.......................................................
L8GFZ8_ACACA/30-205                  ..........................................................q-CP--....YQNEEApHKPQP.....PIT.-T.........................C.SS.YADN...............................ACCDHRDT.ND.LI...R.WL.........YV...-S.Q---KR..G..............G..Qd...gT...NG..........ECL.SLL...HIM..RCGLLCSP.AQADF....VEKtnpmqs..............................ssklklaASPQ..MPY.TYR..LC....SS....FCDRLYAACSD.E.....GMRE...V...EEa..eaGP.T.WDaa......................mtWDSEH.....SS..TA.A..E..EFC........KS-----.--..--...-.--......------.-----....-----................------mapsdveivvvediptksgdgh..........................................
A0A392N8U3_9FABA/1-121               .................................................hthpallsvr-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.--KLAS..G..............G..E.....A...SQ..........ECL.HLW...ELL..ECAI-CDP.RVG--....TQP...........................................----..---.GPP.lIC....AS....LCERIYDACSN.A.....YFSM...-...DV.....KT.Q.VL..........................APCGV.....ND..F-.-..-..-VC........GRAAEWV.SN..GT...D.LCla..agFQVKSS.DIV--....HVASE................ETFC--yg..............................................................
A0A2Y9GB37_NEOSC/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................EEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A445D0E6_ARAHY/64-227              ............................................dsrapftlnktlgfc-----....------.-----.....---.--.........................-.-P.YNGS...............................TCCNSTQD.AQ.IQ...K.QF.........QA...MK.------..-..............-..V.....S...DT..........ACA.SVL...KSL..LCAR-CDP.FSAELy..tVQSsprsvp..............................vlcnstvPANS..SQS.KAA..AV....ED....FCSQVWDTCQT.V.....YITN...S...PF.....AP.S.LQ..........................GQAGG.....PQ..I-.-..K..ANA........TKLTNLW.QS..KT...D.FC......SAFGGT.STNTS....-----................------vcfegep.........................................................
FOLR3_HUMAN/36-211                   ...........................................................VCMNA....KHHKTQ.PSPED.....ELY.GQ.........................C.SP.WKKN...............................ACCTASTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........TCK.RHF...IQD..SCLYECSP.NLGPW....IRQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGI.....NE..CP.A..G..ALC........STFESYF.PT..PA...A.LC......EGLWSH.SFKVS....NYSRG................SGRCIQ................................................................
G3WEP7_SARHA/38-221                  ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQldsls...............gaeavC.GA.FYPR..............................lSCCSRIDS.QS.LL...H.ME.........SK...IF.S-----..-..............V..T.....N...NT..........ECM.KLL...EEI..RCAH-CSP.HSQNL....FHSpe.......................................rgEASE..RDL.ALP.lLC....ED....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.SA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..TS...N.YL......DQMEEY.DKVDEi..sRKHKH................SCFCAQ................................................................
A0A0J8CL77_BETVU/39-188              ......................................................pflse-----....----GK.PPRST.....RDL.TL.........................C.RM.YKRN...............................TCCDVSHT.HS.AL...L.SI.........RK...LA.S-----..T..............G..E.....A...NQ..........ECL.HLW...EVL..ECSL-CDP.DVG--....VKP...........................................----..---.GPP.vIC....AS....FCERVFRACAD.A.....YFSM...D...A-.....--.-.IN..........................QVLSP.....CG..V-.G..D..FVC........GRASEWL.HN..GT...E.LC......RAA---.-----....-----................------gfsvktirdaglsvegascy............................................
A0A5G2R9U0_PIG/28-189                ..........................................................q-CL--....DFRPPF.RPPQP.....LHF.--.........................C.AQ.YSAF...............................GCCAPEHD.AA.LA...R.RF.........GA..lAA.RVD---..-..............P..A.....L...WA..........ECA.GYA...LDL..LC-QECSP.YAAHL....YDA..........................................eDPAT..PLR.TVP.gLC....ED....YCLDMWQTCRG.L.....IRHL...S...PD.....RE.L.WA..........................LEGNR....aKF..C-.-..-..---........RYLS---.LD..DV...D.YCf....pRLLVNE.NLNSNl..gRVVAD................AKGCL-q...............................................................
A0A091SR61_PELCR/3-129               ........................................................lsv-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETPE..REL.TLP.yLC....KD....YCKELYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
M3WR11_FELCA/79-254                  ...........................................................VCMDA....KHHKEK.PSPED.....ELH.EQ.........................C.RP.WKKN...............................SCCFANTS.RE.AH...K.DI.........SY...LY.RFNWDH..C..............G..Q.....M...AP..........ACK.QHF...IQD..TCLYECSP.NLGPW....IQQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCQQWWEDCRT.S.....YTCK...S...NW.....HK.G.WD..........................WSSGH.....NR..CP.V..G..AAC........HHFHFYF.PT..PA...A.LC......EGIWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A5D2U2D7_GOSMU/43-194              ............................................cvsqggrfppfsseg-----....------.KPPQRvgkghKDL.TL.........................C.RV.FRKK...............................TCCDAAQA.HP.AL...L.SI.........RR...LA.------..-..............-..-.....-...--..........---.-LT...ELL..ECSI-CDP.RVG--....VQP...........................................----..---.GPP.lIC....TS....FCDRVFRACSN.A.....YFSM...D...A-.....KT.Q.VL..........................APCGA.....ND..F-.-..-..-VC........GRASEWA.SN..GT...E.LC......LA----.-----....-----................------agfrveqsvgmhggieevscy...........................................
A0A2K5HJX9_COLAP/3-164               ......................................................paame-----....------.-----.....---.VQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.HLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....RTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........LTFESYF.PT..PV...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A6A4KDL5_APOLU/9-171               .................................................eeillyhldp-----....------.-----.....---.QK.........................C.SKlFGNN...............................SCCSDETA.DH.IQ...S.GE.........NR...FN.NFVGRV..Ivn..........lsY..S.....Q...TN..........ECE.NLF...ERL..ACLIECSP.NFKNI....SLP...........................................----..--K.EIP..LC....KN....TCELLYSACSP.V.....TTCS...G...DW.....GA.A.ME..........................--NET.....FD..CT.D..Y..VHVsl...tkqENLHSIV.KS..PE...D.FC......MMLRGS.RFF--....-----................------nvtdfnvdcyd.....................................................
A0A2R2MMB2_LINUN/30-196              ...........................................schpqcldsrppfepg-----....------.-----.....SRL.GF.........................C.PE.YTDF...............................GCCTPAQD.KE.LG...D.FY.........KQ..vVQ.KLN---..-..............N..N.....G...LG..........ACV.DFA...KQI..LC-QKCSP.YAAHL....YDA...........................................ETKL..IPR.SMP.gMC....TS....YCQQFYSKCRD.S.....VKYL...T...SD.....KE.V.LA.........................tLDSAN.....NF..C-.N..K..MSL........FDVD--Y.CY..PD...L.LT......NSVLNS.DIVSA....FRNEE................DCLCL-e...............................................................
A0A673UEP0_SURSU/50-186              ..........................................................a-C---....GGSRQL.PALTW.....RHH.RL.........................A.TH.LSTGqqhl......................ppsawSCCPSEMD.TP.EA...P.GP.........GT...--.--APER..C..............G..E.....P...SP..........GCE.SFL...GHL..RVALHSRF.HLLLL...gIRQ...........................................----..---.QQP..LC....SE....LCDVWFATCKS.D.....VTC-...-...--.....GP.T.WL..........................PFPET.....RR..C-.-..E..PDC........TTYEQV-.--..--...-.--......------.-----....-----................------sfsfp...........................................................
A0A1S4E7H0_DIACI/30-203              ..........................................................w-CLDG....KFHKSL.PGPED.....ELH.SQ.........................C.TP.WKSF...............................SCCTHNIS.KT.LH...-.-Y.........GN...LY.NFDLNH..Ca...........hiK..P.....M...SM..........GCK.RHF...IQD..SCFYECEP.NVRPW....AVRvn.......................................mtDRKE..RFY.KVP..LC....QS....DCEAWYRACEN.D.....YTCA...K...NW.....VT.D.FK..........................WGPGG.....NK..C-.S..N..SKC........ITFREMFqNS..SK...K.FC......EGIWDD.AWEET....---DD................TKPCM-r...............................................................
F7CGN2_XENTR/68-243                  ...........................................................VCMDG....KHQKVE.PGKED.....ALH.GQ.........................C.TP.WKDK...............................SCCTANTS.QE.AH...N.DQ.........SY...LY.NFNWDH..C..............G..I.....M...AP..........ACK.THF...IQD..TCFYECSP.NLGPW....IQKvd.......................................ssWRKE..RIL.DVP..LC....RE....DCDGWYNDCKL.E.....YTCM...E...NW.....HK.G.WN..........................WTSGT.....NQ..CP.N..G..TKC........RRVFEVF.PS..AA...D.FC......EKIWSN.SYKYS....DERRG................SGRCMQ................................................................
A0A5A7U399_CUCME/8-165               ...........................................vcisqggrfapfsseg-----....--KPPS.KVSKA.....QDL.TL.........................C.RV.FRKR...............................TCCGVAQT.HP.AL...L.SV.........RK...LA.S-----..A..............G..E.....A...NH..........ECL.QLW...ELL..ECSI-CDP.QVG--....VQP...........................................----..---.GPP.lIC....AS....FCDRVFKACSD.A.....YFSV...D...A-.....KT.Q.VL..........................APCGV.....ND..F-.-..-..-VC........GRASKWV.SN..GT...D.LC......NAA-GF.SVKIS....-----................------deetscyg........................................................
A0A091VTR1_NIPNI/3-165               ..............................................qcldygppfqppf-----....------.-----.....-HL.EF.........................C.SA.YETF...............................GCCDQERD.NS.IA...A.KY.........WD...IM.DYID--..-..............P..Q.....G...RK..........MCG.TYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....FD....YCSEFHFNCHS.A.....ISLL...-...--.....--.-.-T..........................SDKHI.....QE..CC.K..T..NKT........RFCSLLH.LH..DE...D.YCf....pNVL---.-----....-----................------kntalnrnlglvledregclq...........................................
A0A493TNU4_ANAPP/26-142              ...........................................................VCMDA....KHHKTK.PGPEG.....TLH.GQ.........................C.AP.WKDN...............................ACCTANTS.SE.AH...R.DQ.........SY...LY.NFNWNH..C..............G..V.....M...PP..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQ...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------mwfdpakgnpnvvvakhpsshagapshlfscct...............................
A0A663DRU7_AQUCH/29-190              ....................................................qcldfkp-----....----PF.RPPRG.....LA-.-F.........................C.RR.YADF...............................GCCDPRRD.RA.LL...Q.RF.........YR...LS.---ARL..D..............G..P.....T...YA..........ACA.GHL...QDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCLQVWQKCRS.I.....FRYL...S...ED.....QE.L.IA..........................LENNM....aKF..C-.-..-..---........---HYLS.LE..DT...D.YCf....pHLL---.-----....-----................------anqnlnqnlglvtadaegclq...........................................
A0A4S2LXB9_OPIFE/95-265              ...........................................................ICING....THHKKA.PSPEP.....TDD.HI.........................C.TD.WASM...............................SCCEHKTM.RS.VQ...-.-D.........SL...LY.GFNHSH..C..............K..P.....M...SQ..........KCI.NMF...KRE..LCFYECSP.HVGPW...lV-Ktq.......................................slRRRE..RSY.LVP..LC....EE....DCNKWYEACKN.E.....ETCV...R...DW.....SV.E.FE..........................WSEGM.....NV..CP.A..D..SSC........ELFSNVY.KD..AS...D.FC......HAIWDG.GWKVE....-K---................APRC--mhf.............................................................
A0A287BLX2_PIG/123-298               ...........................................................VCMDA....KHHKPK.PSPED.....KLH.DQ.........................C.SP.WRKN...............................SCCSVNTS.LE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qkWRRE..RIL.NVP..LC....KE....DCQIWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGY.....NQ..CP.V..S..AAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SFEVS....SYSRG................SGRCIQ................................................................
A0A2Y9EA12_TRIMA/27-167              ........................................................acg-----....-GSPPI.RARPW.....GHH.RL.........................A.AN.LGTG...............................QLHLAEID.TP.EA...S.GP.........GT...VP.----ER..C..............G..A.....L...SP..........RCK.SFL...EHL..QDALRS--.---H-....---...........................................----..--F.LLP..LC....AE....LCEGWFTTCEA.D.....ITC-...-...--.....GP.T.WL..........................S-LPE.....RS..C-.-..E..PGC........RTYAQTF.AD..GA...D.LC......RSVLGH.TLPLA....--APG................SRHCLN................................................................
A0A3N7FTV4_POPTR/97-260              ........................................vclskggrfppytsegkpp-----....----KK.VSKGA.....KDL.TL.........................C.RV.FRKK...............................TCCDVAQT.YP.AL...L.SV.........RR...LA.S-----..T..............G..E.....A...SQ..........ECL.QLW...ELL..ECSI-CDP.QIG--....VQP...........................................----..---.GPP.lIC....AS....FCDRVYQACAN.A.....YFSM...D...AN.....--.-.--..........................KRVIA....pCG..V-.N..D..FVC........GQAAEWV.SN..GT...E.LC......HAA-GY.AVKLS....D----................------dayvgaeeascy....................................................
E9PXB4_MOUSE/3-172                   ..........sncretsvrlfslgkqliefplsghpqssvlpsypriqvpgsqtppvpv-----....------.-----.....---.--.........................-.--.----...............................PCCTAEID.RP.ES...-.--.........--...--.--LLES..C..............G..A.....P...SP..........ECE.FFL...GQL..QGALRDRF.HPQLF...gARP...........................................----..---.VQP..LC....PE....LCQIWFTTCQA.D.....FIC-...-...--.....GP.T.WL..........................QSSGE.....RG..C-.-..E..PSC........RTYGQTF.AN..AT...D.LC......HSVLGH.VLRVA....--APG................SSHCLN................................................................
A0A3P9PHL6_POERE/26-201              ...........................................................VCLQD....GKHKAT.PGAEP.....HLS.E-.........................C.GL.YADN...............................SCCTEEDI.QD.IA...Y.VP.........SD..sNK.NEPWDK..C..............G..P.....L...SA..........ECE.GYL...KRV..SCFYRCSP.DASRW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRM.D.....ITCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GTC........VQYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDDQQeagen......gaegrPCGCL-t...............................................................
A0A1S4CM70_TOBAC/41-192              ..................................................rfsnegkpp-----....----RK.VKKGP.....REL.NL.........................C.RI.FRGK...............................TCCDVTQT.HP.AL...L.SI.........RK...LA.S-----..T..............G..E.....A...SQ..........ECL.HLW...EML..ECSI-CDP.RVG--....VQA...........................................----..---.GPP.vLC....TS....FCNKVYQACSN.A.....YFSM...D...A-.....KT.Q.VL..........................APCGV.....ND..F-.-..-..-VC........GRASQWI.SN..GT...E.LC......RV-AGF.SVKSL....SDDPE................EVSCY-g...............................................................
A0A0E0K1U5_ORYPU/51-203              .............................................fssegkrpgraakg-----....------.----R.....RDL.AL.........................C.RI.FRQN...............................TCCDVSQT.FS.AL...L.SV.........RK...LA.S-----..T..............G..E.....G...SQ..........ECL.HLW...ELL..ECSI-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFKACSE.A.....YFAI...-...D-.....VK.T.QA..........................LSPCG.....--..L-.G..D..ILC........GKAHKWV.SN..GT...Q.LC......RSA---.-----....-----................------gfsvqalestsggvddtfcy............................................
A0A096N631_PAPAN/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............agemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A504YI37_FASGI/1-136               ......................................................mqkly-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.-K.........RI...VY.SFDHSH..C.............nR..T.....M...SE..........KCE.AMF...MRD..LCFYQCSP.NLGPW...iIRSe........................................rkIGTE..RMY.AAP..LC....MS....DCNEWWEACRH.E.....QTCV...E...NW.....SY.E.FD..........................WSTGR.....NS..CP.E..G..RDC........LSFEQVF.GN..AS...R.FC......HAVWDG.AWTAT....----N................SSQCL-h...............................................................
A0A067EYB3_CITSI/29-191              .............................................vcvsqggrfapfss-----....----EG.KPPERaskgrSDL.TL.........................C.RV.FRKK...............................TCCDAAQT.HP.AL...L.SI.........RK...LA.S-----..T..............G..E.....A...SQ..........ECL.HLW...ELL..ECSI-CDP.NVG--....VQP...........................................----..---.GPP.lIC....AS....FCERVYQACSN.A.....YFSM...D...A-.....KT.Q.VL..........................APCGV.....ND..F-.-..-..-VC........GRAAEWV.SN..GT...E.LC......HAA---.-----....-----................------gfavklpddryidgeetsc.............................................
A0A5F8GQW3_MONDO/29-205              ...........................................................VCMDG....KHHKYK.PGQED.....NLH.QQ.........................C.SP.WKKR...............................ACCTANTS.IA.AH...E.DA.........SH...LY.KFNFNH..C..............G..M.....L...TP..........ACK.RHF...VQD..LCLYECSP.NLGPW....IQPvn.......................................ssWRKE..RVL.NIP..LC....KE....DCNMWWEDCKT.S.....YTCK...E...NW.....HK.G.WN..........................WSSGI.....NE..CP.V..K..AAC........HPFSFYF.PT..PT...S.LC......ENIWSR.SYNAS...hSYGRG................SGKCIQ................................................................
A0A2K5JC57_COLAP/26-208              ...........................................................ICMNA....KHHKRV.PGPED.....KLY.EE.........................C.IP.WKDN...............................ACCTLTTS.WE.AH...L.DV.........SP...LY.NFSLFH..C..............G..L.....L...MP..........GCR.KHF...IQA..ICFYECSP.NLGPW....IRPggslg................................weeapsGQGE..RVV.NAP..LC....QE....DCEEWWEDCRM.S.....YTCK...S...NW.....RG.G.WD..........................WNQGK.....NR..CP.K..G..AQC........LPFSHYF.PT..PA...D.LC......EKTWSN.SFKAS....PERRN................SGQCLQ................................................................
F1N9X0_CHICK/32-207                  ...........................................................VCMDA....KHHKTK.PGPEG.....MLY.GQ.........................C.AP.WKDN...............................ACCTANTS.SE.AH...R.DQ.........SY...LY.NFNWNH..C..............G..V.....M...PP..........KCK.RHF...IQD..MCLYECSP.NLGPW....IDQad.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKD.Y.....VTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFTQVF.PS..PK...D.LC......EKIWSN.SYKYT....TERRG................SGRCIQ................................................................
S4RV82_PETMA/14-175                  .................................................qcldyrppfq-----....------.-PSS-.....-PL.HL.........................C.TE.YSSF...............................GCCDAERD.LQ.IY...R.RF.........WE..vMG.HMD---..-..............G..G.....G...YR..........LCA.SFI...KNL..LC-QECSP.YAAHL....FDA..........................................eDLST..PVR.TLP.gLC....PD....YCRSFYYQCGS.T.....LSLL...T...DD.....KE.V.RR..........................LETDG....eRL..C-.-..-..---........---KRLV.LE..DE...D.YC......------.-----....-----................------ypavlespdlnaelgvvqagedgcmq......................................
A0A667YFE1_9TELE/20-182              ................................................qcldfqppfkp-----....------.--PW-.....-HL.EF.........................C.TQ.YEQF...............................GCCDQKTD.NS.IA...E.RY.........WD...II.----DI..L..............G..L.....P..gYE..........LCG.DIL...KEI..MC-QECSP.YAAHL....YDA..........................................eDPYT..PVR.ELP.gLC....FG....FCSEFHAKCRH.L.....VKY-...-...LT.....GN.K.VL..........................QEASE.....RD..M-.-..T..TFC........SMVD---.LA..DQ...D.YC......------.-----....-----................------ypnvlkntglndnlgkvvedrrgclq......................................
A0A341AA89_NEOAA/34-134              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCSVNTS.QE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...KP..........ACK.HHF...IQD..TCLYECSP.NLGPW....IQE..........................................vWKR-..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------hrplgrciqmwfd...................................................
C3Y0S5_BRAFL/9-176                   ..............................................cldfmppfepaep-----....------.-----.....--L.SL.........................C.QE.YSKF...............................GCCTREQD.HE.LK...K.QY.........DE..iLR.SL----..P..............Q..N.....S...RT..........KCE.KHV...MNI..LC-QECSP.YASHL....YDL...........................................ETTQvsVKK.PLP.gLC....PK....YCSSIPSECIN.A.....LLST...T...IDp..svRK.T.LS..........................PSDPQ.....KF..C-.-..-..---........---ESTK.IT..DM...D.YCy....pDIITNE.QF---....-----................------sndiqkaiqgtggeeclcfk............................................
A0A662YLC5_9STRA/28-163              ..............................akasdvcrsagalkfdqdthpmqrvrqhq-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.KIREPV..V..............A..K.....F...GR..........QCQ.QLT...EEM..ACSS-CHP.LLGTW...qIRN...........................................----..---.---..VC....PR....LCDDWYAACKD.E.....YYSY...-...-G.....GA.G.TL..........................APCYG.....NA..L-.-..-..-VC........SPLSSIA.DS..GA...D.FC......IHM---.GFHVG....-----................------sdadvegtecfd....................................................
A0A671G8K6_RHIFE/27-186              ..........................................................a-C---....GGSRPH.PLRSQ.....RHY.SL.........................A.EN.LGTGqlql......................fsspwPCCPSEMD.TP.EA...S.DP.........GI...LP.----ER..C..............G..Q.....P...SP..........GCE.SFL...EHL..QVALRARF.HFLLL...gL--...........................................----..-LQ.TQP..LC....AE....FCDAWFATCES.D.....ITC-...-...--.....GP.T.WL..........................PLLEK.....RN..C-.-..D..PGC........STYGQTF.AD..GL...D.LC......RSVLSY.GLRVA....--VPG................AGHCLN................................................................
A0A3Q1M7F5_BOVIN/1-167               .........................................................ml-----....------.PAPRC.....QQC.CR.........................C.IP.WKDN...............................ACCTASTS.WE.AH...L.DV.........SL...LY.NFSLVH..C..............G..L.....M...MP..........DCQ.RHF...LQA..ICFYQCSP.NLGPW....IQQvd.......................................prWQAE..RVL.DAP..LC....LE....DCERWWADCRT.S.....HTCK...S...NW.....LG.G.WA..........................WSRGK.....PR..CP.E..W..EPC........RPFPHHF.PT..PA...D.LC......ERIWSG.SFRAS....PERRG................SGRCLQ................................................................
A0A267FFW1_9PLAT/45-230              ..........................................................l-CMMG....RLHKAE.PGPEP.....GLT.TG........................pC.IG.YSDS...............................SCCTAEVG.SR.LG...S.ND.........EF..aQA.AFRLDH..C..............G.rR.....L...SA..........ECE.KWF...ERS..RCLYECSP.NLGPW....LVKvs......................................gysWRTE..RAY.GVP..LC....HS....QCQAWYAACAA.D.....LSCV...P...NW.....SS.G.FRwi.....................rqaNGSGY....vNV..CP.D..GglAQC........RSIAQLHnHK..AE...Q.FC......ETVWDG.EFKVV....---PD................GSPCFQ................................................................
A0A0R3VYB7_TAEAS/36-176              ...........................................................MCPDS....HHLKDR.PSPEP.....DLE.E-.........................C.RE.WKDR...............................ACCPPETA.VQ.IA...-.-N.........AA...LH.GFSFEF..C..............G..G.....M...SK..........TCR.DYF...HHD..YCLIKCSP.DLGPW....IVKlt.......................................ssRFKE..RAF.RVP..LC....ES....DCNAWYDACKS.D.....KACS...T...NW.....RSgG.FD..........................WSEGE.....K-..--.-..-..---........-------.--..--...-.--......------.-----....-----................------lsksafffeal.....................................................
A0A093C9R5_9AVES/3-165               .............................................qcldygppfqppfq-----....------.-----.....--L.EF.........................C.SA.YENF...............................GCCDQEKD.NS.IA...A.KY.........WD...IM.DYIDP-..-..............-..R.....G...HR..........LCG.TYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....FD....YCSEFHFNCRS.A.....ISLL...-...--.....--.-.-T..........................TDKHI.....QE..CC.E..T..NKT........RFCNLLH.LH..DE...D.YCf....pNVLKNT.ALNRNl..gSVVED................HKGCL-q...............................................................
A0A2R5G9A8_9STRA/95-248              ....................................................vchlqyd-----....DYSHDV.PQTDR.....QLP.E-.........................C.HP.WNDN...............................SCCTPDIV.QS.PE..yM.RE.........AY...GA.EFNWNR..C..............Q..T.....L...SQ..........QCE.RFF...VQE..YCFYECDV.NAGLFr..kYAPhedh..................................tgnpdFNQW..EME.KMP..IQ....AD....YCDSWFEACQN.D.....LFIT...C...KD.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------ddgevsgnwfscpsltpeveeeke........................................
A0A0E0DQT1_9ORYZ/69-169              ...............................................rfpafssevrkl-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.----AS..T..............G..E.....G...SL..........ECL.HLW...ELL..ECSI-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFEACSE.A.....YFAI...-...DV.....KK.Q.C-..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------kylqelktrfhaminsgnigekrlicsvs...................................
A0A484GSX4_SOUCH/169-344             ...........................................................VCMNA....KHHKEK.PGPED.....KLH.EQ.........................C.SP.WKKN...............................ACCSVNTS.QE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...KP..........ACK.HHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.NVP..LC....KE....DCQIWWEDCRT.S.....YTCK...T...NW.....HK.G.WN..........................WTSGY.....NQ..CP.V..R..AAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SYKVS....NYGRG................SGRCIQ................................................................
D3ZWD2_RAT/27-208                    ..........................................................t-C---....GGSHPL.QARSW.....GHP.GL.........................A.AN.VSTGqlqlaghpqssvppsypriqvpssqtpatpePCCTADID.RP.EA...S.NP.........ES...LL.----AS..C..............G..A.....P...SP..........ECE.FFL...GHL..QRALRGRF.HPLLF...gVRR...........................................----..---.MQP..LC....ME....LCQIWFTTCQA.D.....FIC-...-...--.....GP.T.WL..........................QSSGK.....RG..C-.-..E..PSC........RTYGQTF.AN..AT...D.LC......HSALGH.ALRVA....--APG................SSHCFN................................................................
C3Z5S2_BRAFL/245-319                 ........................................ivavligfyrkfpdhvynd-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....--Sd........................................pnHNKW..QME.GMP..IR....AD....YCDAWFRACRY.D.....RFCA...A...DS.....--.-.GS..........................YSSC-.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------areyakvdntgdn...................................................
A0A2K5U025_MACFA/36-211              ...........................................................VCMNA....KHHKAQ.PSPED.....ELY.GQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........LTFESYF.PT..PV...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A673BKX6_9TELE/28-209              ...........................................................VCLQD....GKHKDV.PSPEP.....HLR.E-.........................C.GL.YADN...............................SCCTEEHI.QD.IS...H.IP.........SV..iNK.NEPWDK..C..............G..P.....L...SQ..........ACE.GFL...KRV..SCFYRCSP.DAARW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRM.D.....LTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GTC........IQYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDEPE................------evaevgeagaegdgahpcgclt..........................................
A0A328E3Y7_9ASTE/36-187              ...............................................rfsnegrpprkv-----....------.-NKGP.....RDL.NL.........................C.RV.FRGK...............................TCCDISQT.HP.TL...L.SI.........RR...LS.-----S..A..............G..E.....A...SQ..........ECL.HLW...ELL..ECSI-CDP.YVG--....VQP...........................................----..---.GPP.lIC....AS....LCDRVYQACSN.A.....YFAV...D...T-.....KT.Q.VL..........................APCGV.....ND..F-.-..-..-VC........GRASEWI.SN..GT...E.LC......-RIAGF.SVKSV....YDDPE................EVTC--yg..............................................................
A0A1I8HSL7_9PLAT/30-182              ...............................kaaqqeedqkthkstkskctffagtrys-----....------.-VPES.....SLV.N-.........................C.YW.YNRN...............................ACCKRIEV.TS.VF...S.SL.........--...LS.KL----..-..............E..G.....Q...SR..........RCY.DML...RYL..LC-YFCSP.EQHFW....FRD...........................................----..--N.KVF..VC....KS....FCDDIYSHCRS.A.....VMNG...L...EF.....GK.A.FK..........................N----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------gedfcrgnnfavqednvacfafdptqfdg...................................
A0A2K6BUN2_MACNE/59-198              ..........................................................a-C---....GGSHPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagTCCPSEMD.TT.EI...S.SP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QHALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQAG.VQ..WH...N.LC......S-----.-----....-----................------lq..............................................................
A0A2K5MD83_CERAT/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2Y9NAF4_DELLE/31-192              ......................................................qcldf-----....--RPPF.RPPQP.....LR-.-F.........................C.AQ.YSAF...............................GCCAPEQD.AA.LA...R.RF.........GA..lAA.RV----..D..............A..A.....I...WA..........ECA.GYA...LDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDLWQSCRG.L.....FRHL...S...PD.....RE.L.WT..........................LEGNR....aKF..--.-..-..--C........RYLS---.LD..DT...D.YCf....pHLLVNE.NLNSNl..gRVVAD................AMGCL-q...............................................................
A0A5N5P693_PANHP/30-191              .....................................................qcldyk-----....---PPF.QPQEP.....LR-.-F.........................C.KE.YAKF...............................GCCDLEQD.KQ.IS...Y.RF.........EQ...IM.DY-FDH..S..............G..F.....M...--..........VCG.KYI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.ELP.gLC....RD....YCSEYWHHCRY.T.....LSLL...T...DN.....NI.T.AI..........................I----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------eedldkfcdylelkdqeycypnvlssdelnanlgsvqadpkgciq...................
A0A2I3GFZ2_NOMLE/22-183              ...................................................qcldfrpp-----....-----F.RPPQ-.....-PL.RL.........................C.AQ.YSDF...............................GCCDEGRD.AE.LT...R.RF.........WA...LAsRVD---..-..............A..A.....E...WA..........ACA.GYA...RDL..LC-QECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRG.L.....FRHL...S...TD.....QE.L.WA..........................LEGNR....aRF..C-.-..-..---........RY---LS.LD..DT...D.YC......------.-----....-----................------fpyllvnknlnsnlghvvadakgclq......................................
A0A5A9NR22_9TELE/48-212              ............................................ahpqcldyqppfkpl-----....------.-----.....YHI.EF.........................C.NQ.HGDF...............................GCCDQQTD.NR.IG...M.RY.........WD...IM.DL---I..G..............D..E.....A...YE..........ACG.DLV...KDI..MC-QECSP.YAAHL....FDA..........................................eDPYT..PVR.HIP.gLC....SA....YCSEFHSKCHF.V.....VKYL...T...NS.....--.-.--..........................-RTLL.....EA..C-.-..E..KDG........SHFCNIIdLP..DQ...D.YCf....pNVLRNN.DLYSN...lGKVED................PKGCLQ................................................................
A0A3Q1AZX0_AMPOC/26-207              ...........................................................VCLQD....GKHKAT.PSPEP.....HLT.E-.........................C.GL.YADN...............................SCCTEEHI.QD.IS...Y.VP.........SA..sSK.NEPWDK..C..............G..R.....L...SP..........ECE.GFL...KRV..SCFYRCSP.DAARW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRM.D.....LTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GTC........VQYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDEPE................------evgeageigsegdgsrpcgclt..........................................
A0A5F8GLA1_MONDO/29-205              ...........................................................VCMDG....KHHKYK.PGQED.....NLH.QQ.........................C.SP.WKKR...............................ACCTASTS.IA.AH...E.DA.........SH...LY.KFNFSH..C..............G..M.....L...TP..........ACK.RHF...VQD..LCLYECSP.NLGPW....IQPvn.......................................ssWRKE..RVL.NIP..LC....KE....DCNMWWEDCKT.S.....YTCK...E...NW.....HK.G.WN..........................WSSGI.....NE..CP.V..K..AAC........HPFSFYF.PT..PT...S.LC......ENIWSR.SYNAS...hSYGRG................SGKCIQ................................................................
A0A091MV43_9PASS/1-139               .........................................................fg-----....------.-----.....---.--.........................-.--.----...............................-CCDHRRD.RA.LL...Q.RF.........YR...LS.---ARL..D..............G..P.....T...YD..........TCA.GHL...QDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCMQVWQNCRS.I.....FRHL...S...AD.....RE.L.IA..........................LENNM....aKF..C-.-..-..---........---HYLA.LE..DT...D.YCf....pHLLANQ.NLNQNl..gLVTAD................SEGCL-q...............................................................
A0A5D6Y0E7_9STRA/31-182              ..............................................tcrsvgtlkfdad-----....----QR.PKQRT.....KGL.DV.........................C.TK.YKRN...............................TCCNSSHA.QA.LR...L.KL.........RE...P-.-----A..V..............A..K.....F...ND..........RCQ.KIT...EEM..VCSS-CHP.LVGTW....Q--...........................................----..---.MKT..VC....PR....LCSDWFSACQS.E.....FYSY...-...-G.....GS.G.TL..........................APCYG.....NA..L-.-..-..-IC........SPLSSIA.AS..GA...E.FC......AKMGFH.VGAE-....-NDSE................GDECF-d...............................................................
A0A3Q2X1N8_HAPBU/46-208              ................................................qcldfkppfkp-----....------.--PW-.....-HL.EF.........................C.NQ.YEQF...............................GCCDQGTD.NM.IA...E.RY.........WD..iIE.QLE---..-..............A..A.....G...HE..........LCT.DML...KEI..MC-QECSP.YAAHL....YDA..........................................eDPYT..PVR.EIP.gLC....FN....YCSEFHSKCRH.V.....LKYL...-...-T.....VN.Q.LL..........................LYAAE.....RD..V-.-..T..TFC........SMV---D.LP..DQ...D.YC......------.-----....-----................------yptvlkssdlnsnlgqvvedprgclq......................................
T1HFT3_RHOPR/43-223                  ...........................................................ICLQS....TTHKEA.PGAEK.....NLT.DE.........................C.SP.WKDN...............................ACCTPDTA.IK.AL...-.-S.........FT...LY.SLNYDM..Cp............qK..R.....M...SE..........QCK.KHF...IRD..TCFYECSP.NIGPW....KEQie.......................................saSRSQ..RFR.HVP..LC....KS....ECQDWFNACAD.D.....YTCS...D...NW.....SK.S.YDns.....................lvnNSTNG....tHI..CE.RdpS..ERC........KPFKDVF.ET..AE...N.FC......EKIWDH.SWSVV....---DD................SEPCM-k...............................................................
A0A0M0K6C0_9EUKA/52-218              ...........................................................TCGLS....YFHKDF.PGPES....dSNF.SE.........................C.YP.WHAN...............................ACCQQETT.AT.TT...Q.LR.........NS..yGP.GYEWDR..C..............G..P.....L...SH..........ACE.SFF...VME..ACFYECEV.NTGFY....-RKytddqynfccqgwnc............ntgtynatlnytctgnENQW..QLH.AMP..IK....AS....FADSWYRACAE.D.....YFCG...T...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------gdyfscatdyhseqarlaal............................................
A0A2K5J707_COLAP/36-211              ...........................................................VCMNA....KHHKAQ.PSPED.....ELY.GQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DI.........SR...LY.NFNWDH..C..............G..K.....M...QP..........ACK.RHF...IQD..ACLYECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCEHWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGI.....NE..CP.A..G..ALC........RTFESYF.PT..PA...A.LC......EGLWSH.SFKVS....NYSGG................SGRCIQ................................................................
I7MLY4_TETTS/44-200                  ..........................................tntqnctansplhklky-----....---NTT.KVNDV.....KFA.DF.........................C.TD.YSSR...............................TCCTNDNF.NQ.LR...I.QF.........YR..qVY.NN----..-..............Q..D.....L...SL..........DCQ.QVL...QKL..IC-YDCDG.DVGLG....FRK...........................................----..---.--G..LC....AP....QCESIYEQCKN.D.....YFII...D...QN.....-T.Q.L-..........................---LK.....VC..SR.Q..D..ILC........SKLHQIV.SQ..KT...D.FC......KLL-GH.EV---....-----................------ndyqdyeewf......................................................
D4A700_RAT/43-205                    ...............................................qcldygppfrpp-----....------.-----.....LHL.EF.........................C.SD.YDSF...............................GCCDRRKD.RR.IA...A.RY.........WD...IM.NYFD--..-..............L..K.....G...HE..........LCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHHNCHS.A.....ISLL...T...ND.....-R.G.LQ..........................ESHGK.....DG..A-.-..-..---........RFCHLLN.LP..DE...D.YCf....pNVLRND.QLN--....-----................------rnlgvvaedhqgclq.................................................
A0A369RYD5_9METZ/32-204              ...........................................................TCIAS....SYHKKV.PTPEQ.....DLV.E-.........................C.KP.WKAR...............................SCCTPATV.KE.LS...L.TA.........NQ..vLY.NFRWDH..C..............G..N.....L...SS..........QCY.RYM...VQD..SCFYECSP.NVGPW....IVNas.......................................ssRRSE..RFM.HVP..IC....AS....FCDNWFAACEN.D.....KTCS...G...DW.....RY.D.WK..........................WINRS.....NH..CK.A..N..NTC........KTFGQIF.KT..SK...G.FC......EGLWHY.SFKYQ....---SD................DKPCM-k...............................................................
A0A1E5WI79_9POAL/16-169              ..................................................fssegkppg-----....------.RAPKG....rRDL.AL.........................C.RI.FRQN...............................TCCDVTQT.FP.AL...V.SV.........RN...LA.L-----..T..............G..E.....G...SQ..........ECI.HLW...ELL..ECSI-CDP.RVG--....VRP...........................................----..---.GPP.vVC....AS....FCDMVFKACSE.S.....YFSV...-...-D.....MK.T.QA..........................LSPCG.....--..L-.G..D..ILC........GKAHKWV.SN..GT...E.LC......RLA-GF.SVQVS....ETS--................------sggvddtfcyg.....................................................
M7B581_CHEMY/175-231                 ..................................................scsvfagea-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................--TGT.....NR..CP.H..G..STC........QPFKYVF.PR..PA...D.LC......EKIWSN.SYKYT....LEHRG................SGHCIQ................................................................
A0A6I8RL10_XENTR/5-139               .................................................sswtykriis-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............V..T.....N...NT..........ECA.KLV...EEI..RCAQ-CSP.HAQNL....FHAse.......................................rsETSE..KQL.FLP.aLC....KD....YCKEFYYTCRG.Q.....IPG-...-...-L.....LQ.T.SA..........................DEFCF....yHG..MK.D..S..GLCf.....pdFPRKQMR.GP..AS...N.YL......DQMEDY.DKVEEi..sRKHKH................NCYCIQ................................................................
A0A226P2F6_COLVI/61-236              ...........................................................VCMDA....KHHKTK.PGPEG.....TLH.GQ.........................C.AP.WKDN...............................ACCTANTS.SE.AH...K.DQ.........SY...LY.NFNWNH..C..............G..V.....M...PS..........KCK.RHF...IQD..TCLYECSP.NLGPW....INQvd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKD.Y.....VTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFTQVF.PR..PK...D.LC......EKIWSN.SYKYT....TERRG................SGRCIQ................................................................
A0A4W2CG31_BOBOX/30-205              ...........................................................VCMDA....KHHKAE.PGPED.....KLH.NQ.........................C.TP.WKKN...............................ACCSARVS.QE.LH...K.DT.........SS...LY.NFTWDH..C..............G..K.....M...EP..........ACQ.RHF...IQD..NCLYECSP.NLGPW....IQEvn.......................................qkWRKE..RFL.NVP..LC....KE....DCQSWWEDCRT.S.....YTCK...S...NW.....HR.G.WD..........................WTSGS.....NK..CP.T..G..TIC........RTFEAYF.PT..PA...A.LC......EGLWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A151PFV0_ALLMI/250-413             .......................................................vktk-----....------.-----.....QIW.EK.........................C.TP.WKVN...............................ACYTGNTS.TE.AH...R.DQ.........SY...LY.RFNWNH..C..............R..V.....M...PH..........KCK.HHF...IQD..TCLYKCPP.NLGPW....IVKtd.......................................ssWRQE..RIL.HVP..LC....KE....DCEEWGEDCKD.Y.....VTCK...E...NW.....HK.G.WN..........................WATGM.....NH..CP.W..G..TVC........RPFKQVF.LR..AA...D.LR......KKIWSD.SYKYT....TAPRG................SGRCMQ................................................................
A0A433SXA2_ELYCH/50-186              ......................................................kcsyf-----....-YNERS.PTNEG.....GLV.N-.........................C.TW.YKTK...............................ACCKRTEV.TS.VF...A.AM.........DP...LY.------..-..............-..G.....A...TK..........LCR.NYI...NYL..MCFF-CSP.DQGKF....YKS...........................................----..--N.KVN..VC....LD....YCESLYEECKN.A.....GFSN...M...LI.....GE.A.YA..........................--NGT.....SF..CE.-..-..---........-------.--..--...-.--......------.-----....-----................------aqnfevvenadcfkfdpnvfgssvk.......................................
A0A1L8GMA4_XENLA/21-187              ...........................................................QCLGG....PHHKST.PSSET.....NFQ.E-.........................C.LL.YAES...............................SCCHANFT.EK.LS...R.SP.........MI..eVN.NYYYNR..C..............G..N.....L...SK..........TCE.DYM...KKT..ECFYHCSP.LASHW....IHP...........................................NFSE..AIQ.HVP..VC....QS....FCDNWFDACHS.D.....LTCT...Y...NW.....IS.D.WE..........................FDETG.....NH..C-.-..K..NDC........IPFHKMY.AN..GT...D.LC......LNAWGV.SFVTS....---SS................PCRCL-d...............................................................
A0A2K6V1S4_SAIBB/2-158               .......................................................rppf-----....------.--RPQ.....QLL.AL.........................C.SR.YSVF...............................GCCDEKRD.AE.LT...S.RF.........WA...LA.NR---M..L..............A..A.....E...WA..........DCA.GYA...REL..LC-QECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....QD....YCLTMWQKCRR.L.....LRHL...S...T-.....--.-.--..........................-DKEL.....RA..L-.E..D..NRD........KFCHHLS.LD..DT...D.YCy....pNLMVNK.SLNSDl..gHMVAD................ATGCLQ................................................................
A0A5E4AP06_MARMO/30-191              ......................................................qcldf-----....--RPPF.RPPQP.....LR-.-F.........................C.AQ.YSAF...............................GCCAPEQD.AA.LA...H.RF.........GA..lAA.RVD---..-..............A..P.....M...WA..........ACA.GYA...LDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRG.L.....FRHL...S...PD.....RE.L.WA..........................LEENR....aKF..C-.-..-..---........RYL---S.LD..DT...D.YCf....pRLLVNE.NLNLNl..gRVAAD................AKGCLQ................................................................
A0A091M6T4_CARIC/31-206              ...........................................................ICMDA....KHHKTQ.PGPEG.....MLH.DQ.........................C.AP.WKDN...............................ACCTANTS.SE.AH...K.DQ.........SN...LY.NFNWNH..C..............G..L.....M...PT..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQad.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKD.Y.....VTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFSHVF.PQ..PK...D.LC......EKIWSN.SYKYT....TEHRG................SGRCIQ................................................................
E4WTN8_OIKDI/39-242                  ................................................lipqkhdhmgr-----....------.-----.....---.YE.........................C.TA.HRDH...............................SCCDAETN.RE.AY...T.RPidkigmwsfGQc.nAN.PWKNEE..C..............N..S.....V...SD..........TCS.EMI...QSF..VSEIRCSP.NLFPW....QKNfppnvgn.............................vinrdplLSDY..ELE.NVP..IC....AD....WCAEFYDHCKW.E.....NVCL...D...V-.....DP.F.YStsppigg...........tapdpqifFGQNW.....NC..GT.G..S..DKC........KTFESVI.KT..GR...D.FC......EQFFPN.PKLIS...vPNAGT................NDMCI-r...............................................................
A0A2I3G994_NOMLE/47-159              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.D-.........................-.QV.WTPP...............................ACTTLTGI.TV.AR...W.--.........--...--.------..-..............-..-.....-...SP..........PAS.ATS...SRD..TCLYECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTS--.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------aa..............................................................
A0A444SGI4_ARMVU/28-213              ..........................................................w-CIDS....KHHKTE.PGPEG.....ALF.GQ.........................C.TP.WKER...............................ACCTSNTT.KN.IH...E.NK.........EA...IY.NFDFNH..C..............S..E.....MkplSA..........ECL.KHF...NQD..HCFYECSP.NIGPW....VVKee.......................................rsWRKE..RYF.KVP..LC....AS....DCDVWYEACKN.D.....FTCT...D...NW.....SQ.N.FDwktv.................eceqgGGTCK....rNV..CP.A..D..SEC........QTFQRIF.GN..AK...N.FC......ERVWDH.AWEYT....---SS................ETYCM-r...............................................................
A0A2I4B6U9_9TELE/23-198              ...........................................................MCMDG....KHHKTE.PGPEG.....QLY.SQ.........................C.TP.WRDN...............................ACCTANTT.EE.AH...E.DN.........SY...LY.NFNWNH..C..............G..A.....M...SP..........QCK.KHF...IQD..TCFYECEP.HLGPW....IQLad.......................................esWRKE..RML.DVP..LC....KE....DCEQWWNDCKD.D.....LTCK...T...NW.....HK.G.WD..........................WTSGT.....NK..CP.K..D..SKC........RKWTEVF.PT..PK...S.MC......EQIWSQ.SYMYT....TYTKG................SGRCMQ................................................................
A0A2I0MGT7_COLLI/32-165              ..................................................veapkkils-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............V..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETPE..REL.TLP.yLC....RD....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A093P1V9_PYGAD/34-216              ..........................................................r-CRNG....TPPRRL.KKRDR.....RVL.SPeapg................ggeamC.RG.LYPR..............................lSCCSRTDA.QG.LL...H.AE.........AK..iLS.------..-..............V..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETPE..REL.TLP.yLC....KD....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A0C2MP69_THEKT/16-194              ...........................................................RCLKT....GHHKVV.HSPEN....vDDM.GL.........................C.KP.WSEN...............................SCCSAEAA.KF.IS...N.PG.........DY..yIH.NVLFNQ..Cp...........shG..N.....L...SD..........ECK.LYF...MLD..SCFYHCGS.IFLPW....TTQfs......................................ynnSITE..VLR.GIP..LC....SS....DCDSWYDACKN.D.....YTCS...T...TW.....YS.N.SF..........................GTVNG....tPV..C-.-..Q..MEC........KRFKDYH.PN..SK...Q.FC......ESIFQG.MFKYS....--NGG................DRCCM-k...............................................................
A0A1Z5K2Q1_FISSO/84-223              ..........................................................e-CNVQ....YFHKQV.PSPEG.....DDM.GE.........................C.HP.WKQR...............................SCCHGETV.GS.VE...-.EM.........KA...LY.GSSWDR..C..............G..T.....M...SE..........ACE.RFF...VFE..LCFYECEP.SVGLFr..rFNDsqt....................................dhpdFNTW..QLY.QMP..MK....KS....YCDAWFDACKN.D.....FFSE...E...R-.....FS.T.IK..........................EEKE-.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------vnklgvs.........................................................
F6TAH8_HORSE/47-209                  ...............................................qcldygppfkpp-----....------.-----.....LHL.QF.........................C.SD.YESF...............................GCCDQRKD.HR.IA...A.RY.........QD...IM.DYFD--..-..............L..K.....G...HE..........LCG.RYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....SD....YCSAFHSNCHS.A.....ISLL...T...ND.....-R.R.LQ..........................ESHEK.....NG..A-.-..-..---........HFCHLLN.LP..DK...D.YC......------.-----....-----................------fpnilrndhlnrnlglvtedrqgclq......................................
A0A4S4CYA7_CAMSI/146-297             ...................................................fanegkpp-----....----SK.VSKGR.....KDL.TL.........................C.RV.FRKK...............................TCCDVAQT.HP.AL...L.SI.........RR...LA.L-----..T..............G..E.....A...SQ..........ECL.QLW...ELL..ECSI-CDP.HVG--....VQP...........................................----..---.GPP.lMC....AS....LCDRVYKACSN.A.....YFSM...D...A-.....MT.Q.VL..........................VPCGV.....--..--.G..D..FVC........GRASEWT.SN..GT...E.LC......RAAGFA.VKPSY....DHDME................ETSC--yg..............................................................
A0A5A9NA98_9TELE/27-196              ...........................................................ACLED....GHHKAT.PGPEP.....HLQ.E-.........................C.SL.YRDN...............................SCCSQSHV.QD.LS...G.SV.........--...-E.KSVWDK..C..............G..L.....L...SP..........PCE.SFL...KRV..VCFHRCSP.DAARW....PHP...........................................QRDS..SLK.AVP..LC....HS....FCRDWFEACKA.D.....MTC-...-...--.....AR.D.WT..........................ADPRG.....LN..C-.-..T..GGC........VPYQQMY.QH..GR...D.LC......ESLWGD.AFVMV....EDDPGeedg........veghSCGCL-t...............................................................
A0A4U5VGQ2_COLLU/38-199              ..................................................qcldfkppf-----....------.--QSQ.....REL.TF.........................C.VM.YKEF...............................GCCDYEKD.QQ.LM...A.KY.........YQ..iMD.NFD---..-..............Y..Y.....G...YA..........NCA.GFV...LEL..IC-QECSP.YAAHL....FDA..........................................eDPHT..PVR.TIP.gLC....PD....YCSQYWKKCRD.T.....IPLL...S...D-.....HP.H.IA..........................KVKED.....--..--.Q..T..NLC........RYLE---.LG..DI...D.YCy....pHLLSNQ.KLTQNl..gRVHSD................SDGCL-q...............................................................
A0A093ICM0_DRYPU/34-213              ..........................................................r-CLNGtpprRLKKRG.LSPEPp...gGGE.AM.........................C.RG.LYPR..............................lSCCSRTDA.QG.LL...H.AE.........AK..iLS.------..-..............V..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETPE..KEL.TLP.yLC....KD....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DVFCF....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A087WYI3_HUMAN/36-178              ...........................................................VCMNA....KHHKTQ.PSPED.....ELY.GQ.........................C.SP.WKKN...............................ACCTASTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........TCK.RHF...IQD..SCLYECSP.NLGPW....IRQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGI.....NE..CP.A..G..ALC........STF----.--..--...-.--......------.-----....-----................------................................................................
A0A3Q1HYP2_ANATE/38-208              ..........................................chpqcldykppfgprqp-----....------.-----.....--L.AF.........................C.KE.YSKF...............................GCCDLKKD.GE.IS...V.KF.........DT..iME.NFD---..-..............Y..S.....G...YI..........TCG.KYI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.ILP.gLC....GD....YCSEYWQHCRY.T.....L---...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------sllledlgsppqfanltagieedrrkfcdflelkdkqycypnvlsneelnanlgvvsedptgc.
A0A401PDQ3_SCYTO/118-173             ...........................................................TCPAT....GSHKAV.PSPEP.....ELY.D-.........................C.PL.YLKN...............................ACCTVNIK.DK.VN...T.SP.........EA...E-.--PWNR..C..............G..H.....L...ST..........---.---...---..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------k...............................................................
T1F9I2_HELRO/85-230                  ...................................................fcsffnnr-----....-----A.-PQEQ.....LAL.KN.........................C.TW.YSKN...............................SCCLQHEI.DV.SF...S.RV.........KS...LI.------..-..............-..G.....A...SE..........DCQ.KYT...NYL..MC-YVCSP.DQNLF....YKK...........................................----..--E.RLT..VC....EP....FCDLLYEACKF.A.....YLKG...Y...QI.....AD.L.YStg.....................kefCLSRR.....FL..VE.Y..R..HDC........FNMHDVN.FE..AM...K.FS......------.-----....-----................------sssssspin.......................................................
A0A673WG94_SALTR/29-207              ...........................................................ACLQD....GRQKAT.PSQEP.....HLK.E-.........................C.TI.YAEN...............................ACCSEDDI.QD.LH...P.MT.........SE...-K.NSPWDK..C..............G..K.....L...SP..........KCE.DFL...KRV..TCFYRCSP.DAARW....PHS...........................................HLQS..SMQ.AVP..LC....HS....FCRDWYEACRM.D.....MTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GNC........VPYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDEEE................------ereggesisngnggrpcgclt...........................................
L9JAA1_TUPCH/41-180                  ........................................mtvhvrpgqpsgrsvrvhi-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.-----H..P..............G..Q.....P...SA..........RCR.FKThlpERL..LYRQECSP.YAAHL....YDA..........................................eDAAT..PLR.TVP.gLC....ED....YCLDMWQTCRG.L.....FRHL...S...PD.....RE.L.WA..........................LEHNR....aKF..C-.-..-..---........---HYVS.LD..DT...D.YCf....pRLLVNE.NLNLNl..gRVVAD................AQGCLQ................................................................
A0A078G1F5_BRANA/41-174              .......................................................vcii-----....--SKKG.KLPKP.....SDL.NM.........................C.NA.FHGK...............................TRCSASSA.LQ.N-...-.--.........--...LA.TY----..-..............G..E.....A...SK..........DCL.YLF...ELL..ECS-----.DVGP-....---...........................................----..---.-LR..IC....AS....FCDRVFEACSD.A.....YFST...S...G-.....--.-.AS..........................NQVIV....pCG..AS.N..G..IIC........VKVSKWG.TN..GT...S.FC......EAVGFT.VVQ--....-----................------taddsacyg.......................................................
A0A4W4FYV8_ELEEL/26-188              .....................................................pqcldy-----....--KPPF.QPQEP.....LAF.--.........................C.KE.YAKF...............................GCCDQERD.TQ.IS...R.QF.........YE...IM.GY-FDS..S..............G..-.....-...FM..........ACG.KYI...RSV..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.DLP.gLC....RG....YCTDFWLQCRY.T.....LSLL...T...NN.....NI.T.AT..........................IEEDR....kKF..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------dylelkdpeycypnvltsdelnanlgsvkaepngclq...........................
A0A287DAZ0_ICTTR/26-163              ...........................................................VCMNA....QHHKRE.PGPED.....ELY.VE.........................C.IP.WKDN...............................ACCTATTS.WE.AH...L.EV.........SP...LH.NFTLVH..C..............G..L.....L...TP..........SCQ.KHF...IQA..ICFYQCSP.NLGPW....IQLvg.......................................psGQGE..RIV.GVP..LC....WE....DCEEWWADCRT.S.....YTCK...S...NW.....YS.S.WH..........................WSQVG.....N-..--.-..-..---........-------.--..--...-.--......------.-----....-----................------ligtir..........................................................
A0A0C2MMB1_THEKT/25-202              ...........................................................YCIKT....TEHKSL.PGSEN....aEEM.GI.........................C.KP.WSHE...............................SCCDTKTA.QK.IT...T.LD.........RF..yIP.GVPLNQ..Cp............dH..T.....L...SA..........KCK.QYF...QYD..LCLYQCGS.MFLPW....VQSvi......................................ngkTRKE..RLR.GIP..LC....SN....DCDSWFEACRD.D.....YTCS...S...TW.....YP.N.SF..........................TTQEG....qPV..C-.-..V..DQC........KTFKDYH.QN..SK...Q.FC......ETIFKG.SFKYS....--RTG................DKCCM-k...............................................................
A0A402FJS7_9SAUR/51-226              ...........................................................VCMNA....KHQKAK.PGPED.....ALH.RQ.........................C.SP.WKDN...............................ACCTANTS.QA.AH...E.SQ.........SY...LY.NFSWDH..C..............G..S.....M...SQ..........KCK.EHF...IQD..TCLYECSP.NLGPW....INPad.......................................tsWRKE..RIL.NVP..LC....RE....DCEQWWEDCKE.D.....ITCK...E...NW.....HK.G.WD..........................WSTGT.....NR..CP.H..G..ASC........LPWSLVF.PH..PK...D.LC......EKIWSN.SYQYT....TFSRG................SGRCIQ................................................................
G3GRC1_CRIGR/155-317                 ...............................................qcldygppfrpp-----....------.-----.....LHL.EF.........................C.SD.YDSF...............................GCCDQRKD.HR.IA...A.RY.........WD...IM.NFFD--..-..............L..K.....G...HE..........LCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHHSCHS.A.....ISLL...T...SD.....RS.-.--..........................----L.....HE..SQ.E..K..DGA........RFCHLLN.LP..DE...D.YCf....pNVLRNS.QLNRNl..gVVAED................HKGCL-q...............................................................
A0A226NM25_CALSU/21-80               ..........................................................g-CLEG....DTHKEK.PSPEP.....NMH.E-.........................C.TL.YSES...............................SCCYANFT.EQ.LA...H.SP.........VI..kVS.NSYWNR..C..............G..Q.....L...SK..........---.---...---..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------s...............................................................
A0A094KZT5_PODCR/6-165               .................................................dygppfqpsf-----....------.-----.....-HL.EF.........................C.SA.YENF...............................GCCDQERD.NS.IA...A.KY.........WD...IM.DYIDP-..-..............-..R.....G...HK..........LCG.TYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....FD....YCSEFHFNCRS.A.....ISLL...-...--.....--.-.-T..........................SDKHI.....QE..CC.E..T..NRT........HFCNLLH.LH..DE...D.YCf....pNVLKNT.ALNRNl..gSVVED................RKGCL-q...............................................................
A0A2R6Q6Z9_ACTCC/41-189              ....................................................asegkpp-----....----RK.VSKGP.....KDL.TL.........................C.RL.FRKK...............................TCCDVAQT.HL.AL...L.SV.........RR...LA.I-----..T..............G..E.....A...SQ..........ECL.QLW...ELL..ECSI-CDP.HIG--....VQP...........................................----..---.GPP.lIC....DS....LCDRVYKACSN.A.....YFSM...-...DV.....KT.Q.VL..........................AP---.....CG..V-.S..D..FVC........GRASEWT.SN..GT...E.LC......RAA---.GFAVE...pSHHIE................ETSC--yg..............................................................
A0A0W8DQ05_PHYNI/33-184              ..............................................tcrsagvlkfdpe-----....----TH.PMQRT.....KGM.EV.........................C.SK.YRKS...............................TCCNATHA.HA.LR...L.KI.........RE..pVV.------..-..............A..K.....F...SR..........KCQ.ALT...EEM..ACSS-CHP.LMGTW...eMK-...........................................----..---.--N..VC....PS....LCNDWYDACKD.E.....YYAY...-...-G.....GA.G.TL..........................APCYG.....NA..L-.-..-..-VC........SPLKSIA.NS..GA...D.FC......VHM---.GFHVG....-----................------sdsdaegidcfd....................................................
A0A2I3GJ26_NOMLE/36-182              ...........................................................ICMNA....KHHKEK.PGPED.....KLH.EQ.........................C.RP.WRKN...............................ACCSTNTS.QE.AH...K.DV.........SY...LY.RFNWNH..C..............G..E.....M...AP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQ...........................................----..---.---..VC....MA....SCR-------Y.K.....-TYG...S...VW.....--.V.WN..........................W----.....-N..CP.V..G..AAC........QPFHFYF.PT..PT...V.LC......NEIWTH.SYKVS....NYSRG................SGRCIQ................................................................
A0A663EJZ9_AQUCH/21-188              ..........................................................g-CLEG....DTHKLK.PSREP.....NMH.E-.........................C.TL.YSKS...............................SCCYVDFT.EQ.LA...H.SP.........VI..kVN.NSYWNR..C..............G..Q.....L...SK..........SCE.DFT...KKI..ECFYRCSP.HAARW....IHP...........................................NDTA..AIR.SVP..LC....QS....FCDDWYEACKD.D.....SICV...H...NW.....LT.D.WE..........................WDESG....eNR..C-.-..K..NKC........IPYSEMY.AN..GT...D.MC......QNMWGE.SFKVS....---ES................SCLCLQ................................................................
A0A5E4EAZ1_PRUDU/27-188              .....................................ctsqggrfppfssegkpprrvn-----....------.--KGP.....KDL.TL.........................C.RV.FRKK...............................TCCDVSQT.HP.AL...V.SV.........RK...LA.S-----..T..............G..E.....A...NP..........ECL.QLW...ELL..ECSI-CDP.RIG--....VQP...........................................----..---.GPP.vIC....AS....FCDRVFKACAE.A.....YYST...-...DA.....IT.Q.VL..........................APCGV.....ND..Y-.-..-..-VC........GRASEWI.VN..GT...E.FC......HAA---.-----....-----................------gfavkdditvrkreafcyg.............................................
A0A553NMB8_9TELE/105-266             .................................................qcldfkppfq-----....------.--PQQ.....EL-.QF.........................C.QM.YRNF...............................GCCDFARD.QD.LM...A.KY.........YR..iME.NYD---..-..............Y..Y.....G...YS..........NCA.AYV...QDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PLR.TIP.gLC....PD....YCTEFHSKCRS.F.....LTLL...S...DD.....QR.I.AE..........................LEHDQ.....--..--.-..R..KLC........RYLQ---.LD..DP...D.YCy....pHLLNNE.LLNKNl..gRTAAD................SQGCLQ................................................................
A0A674F4Z3_SALTR/34-195              ..................................................qcldfkppf-----....------.KPQ--.....EDL.QF.........................C.AM.YRNF...............................GCCDSAKD.QE.LM...A.KF.........YK..iVD.NFD---..-..............N..Y.....A...YA..........NCA.GYV...QDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PIR.TLP.gLC....PD....YCSQFWLKCRS.T.....ITLL...S...DD.....LQ.L.AQ..........................AKPDQ....vHF..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------qhleledpdycyphllsnqqltqnlghvradpegclq...........................
A0A3Q7UL67_VULVU/38-220              ...........................................................RCLNG....NPPKRL.KRRER.....RLM.SQlells...............ggealC.GG.FYPR..............................lSCCLRSDS.AG.LG...R.PD.........TK...IF.S-----..-..............M..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.YSQSL....FHSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRS.H.....IPG-...-...-F.....IQ.T.TA..........................EEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A433T103_ELYCH/56-152              ........................................drerwkefvaaliangkkg-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............S..K.....P...RK..........RCL.APF...PAL..TCQI----.KLLQD....VRK...........................................IRRE..RFK.EVP..LC....KP....VCDNWYEACKD.D.....LTCT...D...EW.....AE.N.FD..........................WSSD-.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------iveedelrli......................................................
A0A0D9QVZ8_CHLSB/36-211              ...........................................................VCMNA....KHHKAQ.PSPED.....ELY.GQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..GCLYECSP.NLGPW....IRQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGI.....NE..CP.A..R..ALC........RTFESYF.PT..PA...A.LC......EGVWSH.SFKVS....NYSGG................SGRCIQ................................................................
A0A091MM92_9PASS/3-129               ........................................................lsv-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgEAPE..REL.TLP.yLC....KD....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCY....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A2Y9DWW6_TRIMA/35-210              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WRKN...............................ACCSVNTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EL..........DCK.RHF...IQD..TCFYECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.NVP..LC....KE....DCQRWWEDCRT.S.....YTCK...T...NW.....HK.G.WN..........................WSSGI.....NE..CP.V..K..AAC........HTFEFYF.PT..PA...D.LC......EGLWSH.SYKVS....NYSQG................SGRCIQ................................................................
A0A2G9IAB8_9LAMI/30-190              ..........................................vcisqggrfppfanegk-----....--PPKK.ASKGP.....RDL.TL.........................C.RV.FRRR...............................TCCDVSQT.HP.AL...L.TI.........RR...LA.S-----..S..............G..E.....A...SQ..........ECL.QLW...ELL..ECSI-CDP.RVG--....VQR...........................................----..---.GPP.rIC....AS....FCDRVYEACSA.A.....YFAM...D...AK.....-T.Q.VL..........................APCG-.....--..L-.A..D..FVC........GRASEWI.SN..GT...E.LC......HAAGFS.VTQFE....--DPE................EAQC--yg..............................................................
H2Y7Z2_CIOSA/28-200                  ...........................................................TCLDG....KHHKTQ.PGPED.....NLF.Q-.........................C.NA.YVNN...............................SCCTNYTA.KY.LH...G.DG.........HS...LY.NFNYSH..C..............A..P.....M...SD..........KCR.QHF...TMN..NCFYECSP.NLGPW....VKTqk.......................................isYRSE..RIY.KVP..LC....AS....ECQSWWNDCRD.E.....RTCV...E...NW.....SF.G.FV..........................WNKNG.....NH..CP.K..N..SRC........KYFHEVY.HN..ST...Y.FC......EKLWGPdDFMVV....---DD................ADYCM-k...............................................................
A0A4U5VGG8_COLLU/57-219              ..............................................qcldfeppfkpvw-----....------.-----.....-HL.EF.........................C.TQ.YEEF...............................GCCDQKTD.NV.IA...E.RY.........WD..iIE.QVE---..-..............V..A.....G...HD..........LCE.DML...KEM..MC-QECSP.YAAHL....YDA..........................................eDPYT..PVR.ELP.gLC....FG....YCSEFHSKCRH.V.....VKYL...T...EN.....-Q.R.LK..........................D---A.....SE..LD.A..S..TFC........SMVD---.LS..DQ...D.YCy....pN-----.-----....-----................------vlktpdlnsnlgqvvedprgclq.........................................
K7F9U1_PELSI/34-216                  ..........................................................k-CLNG....NPPRRL.KKRDR.....RMM.FLepas................egemmC.RG.FYPR..............................lSCCSRTDS.QG.LL...H.FE.........NK...IF.S-----..-..............V..T.....N...NT..........ECV.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgEASE..REL.ALP.fLC....KD....YCKEFYYTCRG.Q.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYT..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCLQ................................................................
A0A484CFE8_PERFV/28-214              ...........................................................VCLQD....GKHKAT.PGPEP.....QLR.E-.........................C.GL.YADN...............................SCCTEEDI.QD.IS...H.VP.........SA..sNK.NDPWDK..C..............G..P.....L...SS..........ECE.GFL...KRV..SCFYRCSP.DAARW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRM.D.....MTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GTC........VQYQQMY.QN..GR...D.LC......ESLWGD.AFMTV....EDEPE................------dvgeagevgaggggggvsggrpcgclt.....................................
A0A452R4D9_URSAM/2-160               .................................................dfrppfrppq-----....------.-----.....-PL.RF.........................C.AQ.YSAF...............................GCCTPEQD.AA.LA...R.RF.........GA...LAaRVD---..-..............A..A.....E...WA..........ACA.GYA...LDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRG.L.....FRHL...S...PD.....RE.L.WA..........................LEGNR....aKF..--.-..-..--C........RYLS---.LD..DT...D.YCf....pRLLVNE.NLNSNl..gRVVAD................AKGCLQ................................................................
A0A1S3JEC0_LINUN/32-206              ...................................................kcvtlpve-----....GASKTR.PSPEP.....GLE.--.........................C.PS.FRKR...............................SCCNVNAV.AN.LL...E.NH.........VW...NG.IVTYLH..Cp...........qkP..R.....L...SP..........ECE.RLT...FEQ..SCFYACSP.NLGPW....IYR..........................................yLYLD..VGY.NVP..LC....AS....QCNKWWEACKE.E.....YTCH...R...NW.....LA.D.MD..........................WSPEG....lNT..CK.E..G..SVC........RKYTEVY.NS..SI...D.FC......STVFNG.AYKVV....---PD................SEPCI-v...............................................................
A0A3Q1IZL8_ANATE/4-165               .................................................cldfeppfkp-----....------.---Q-.....WHL.EF.........................C.EQ.YEEF...............................GCCDQKTD.NM.IA...E.RY.........WD..iID.QLE---..-..............V..A.....G...YE..........LCT.DLL...KEI..MC-QECSP.YAAHL....FDA..........................................eDPYT..PVR.ELP.gLC....FG....YCSEFHSKCRH.V.....VKY-...-...LT.....RN.K.LL..........................QDTAE.....RD..M-.-..S..TFC........SMVE---.LS..DR...D.YCy....pDVLKNT.DLNSNl..gQVVED................PEGCL-q...............................................................
A0A673TB19_SURSU/38-200              ..............................................qcldygppfqppl-----....------.-----.....-HL.DF.........................C.SD.YESF...............................GCCDQHKD.RR.LA...A.RY.........RD...IM.DY-LD-..-..............L..R.....G...HA..........QCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....AD....YCSAFHSNCHS.A.....ISLL...T...ND.....R-.-.--..........................---RL.....RE..TH.D..K..DGA........HFCHLLN.LP..DK...D.YCf....pN-----.-----....-----................------vlrndhlnrnlgvvaqdhrgclq.........................................
A0A3B1ILS7_ASTMX/7-179               ...........................................................ACLQD....GRHKAT.PSPEP.....YLK.E-.........................C.TM.YMEN...............................ACCSEQDI.TD.LT...A.PP.........AG...DD.GTPWDR..C..............G..T.....L...SP..........VCD.AFL...KRV..VCFYRCSP.HAAHW....PHP...........................................QRNS..FLK.AVP..LC....TS....FCRDWYEACKS.D.....LTC-...-...--.....AR.D.WA..........................GDPRG.....LN..C-.-..T..GSC........VPYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDEAGeedg........veghGCGCL-t...............................................................
A0A2K5NV62_CERAT/59-198              ..........................................................a-C---....GGSHPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagTCCPSEMD.AT.EI...S.GP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.RLRLL...gVRH...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQAG.MQ..WH...N.LC......S-----.-----....-----................------lq..............................................................
M3XXW1_MUSPF/44-206                  ...............................................qcldygppfqpp-----....------.-----.....VHL.EF.........................C.SD.YESF...............................GCCDQHKD.RR.LA...A.RY.........KD...IM.DYFD--..-..............L..R.....G...HE..........LCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....SD....YCSAFHSSCHS.A.....ISLL...T...ND.....-R.H.LQ..........................GSH--.....--..--.E..K..DGA........HFCHLLN.LP..DE...D.YCf....pN-----.-----....-----................------vlrndhlnrnlgvvaedqqgclq.........................................
A0A452DRC1_CAPHI/39-221              ...........................................................RCLNG....NPPKRL.KKKDR.....RMM.SQpells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........SK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAA-CSP.HSQSL...fYSPe.........................................rEALE..RDL.VLP.fLC....KD....YCKEFFYTCRG.H.....IPG-...-...-L.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2Y9KGJ5_ENHLU/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEALE..RDL.ALP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................EEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A4W5NXQ7_9TELE/33-194              ..........................................................q-CL--....DYKPPF.QPREP.....LVF.--.........................C.KE.YAKF...............................GCCDLEKD.DK.IS...Q.NF.........YK...IM.DY-FDY..-..............-..S.....G...YV..........TCA.KYI...RTI..LC-QECSP.YSAHL....YDA..........................................eDANT..PMR.ELP.gLC....GD....YCSEFWHECRY.T.....ISLL...T...DN.....NA.T.VG..........................IEEDR....nKF..C-.-..-..---........NF---LE.LK..DR...E.YC......------.-----....-----................------ypnvlsddklnanlgdvradpegclq......................................
A0A3Q0GJ09_ALLSI/26-189              ...........................................................TCLPG....GKHKAR.PSPE-.....SSL.GL.........................C.QA.YAHN...............................ACCSPETA.AE.IS...T.TG.........AR...--.DVAWDC..C..............G..P.....L...SS..........SCA.RYL...QQL..ECFYRCSP.GAAHW....LHP...........................................ERPA..ALH.RAP..LC....RD....FCQQWYDACRD.D.....LTCA...R...DW.....VR.D.WR..........................WGPEG.....NN..C-.-..T..GGC........TPYSQMY.RD..GQ...D.LC......ETIWGD.AFVTE....---DP................PCPCL-t...............................................................
A0A2K5XL08_MANLE/3-164               ......................................................paame-----....------.-----.....---.VQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..APC........RTFESYF.PT..PV...A.LC......EGLWSH.SYKVS....NYSRG................SGCCIQ................................................................
C0PIQ9_MAIZE/45-197                  ..................................................fssegkppg-----....------.RAPKG....rRDL.AL.........................C.RI.FRQK...............................TCCDVMQT.FP.AL...V.SV.........RN...LA.-----L..A..............G..E.....G...SQ..........ECI.HLW...ELL..ECSI-CDP.RVG--....IRP...........................................----..---.GPP.vVC....AS....FCDMVFKACSE.S.....YFS-...-...--.....ID.T.KT..........................QALSP.....CG..L-.D..D..ILC........GKTHKWV.SN..GT...E.LC......RLA-GF.SVQI-....-----................------setssggvghtfcy..................................................
C3XUF6_BRAFL/6-176                   ...........................................................RCMDG....RHHKTQ.PGPEG.....SLY.NQ.........................C.AP.WKDR...............................ACCRASTT.EQ.LH...Q.PL.........--...WL.NFDWHH..C..............G..Q.....L...SE..........SCE.RHF...KQD..LCFYECSP.NVGPW....LVPvn.......................................mqIRNE..RFA.GVP..LC....AT....DCNRWWTACKD.D.....MTCS...G...NW.....GV.S.WN..........................WTSGQ.....NT..CP.H..G..AEC........RTFQDYF.GT..PS...N.FC......RNIWNG.SFEVV....---DD................SAPC--ft..............................................................
I3JBR0_ORENI/37-208                  .................................................chpqcldykp-----....----PF.EPRQP.....LA-.-F.........................C.KE.YSKF...............................GCCDVEKD.EE.IS...G.RF.........YT..iME.N--FDH..S..............G..-.....-...YA..........ACG.KYV...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.VLP.gLC....GD....YCSDYWRQCRY.T.....LGL-...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------lledvgnsqqfanltatieedhrrfceflvlkdkeycypsvltnaelnanlgllnedpegcl..
A0A3P8Y484_ESOLU/29-207              ...........................................................ACLQD....GRPKAT.PSPEP.....HLK.E-.........................C.TI.YAEN...............................ACCSESDI.QD.LG...P.TA.........NE...KS.-NPWDK..C..............G..K.....L...SP..........TCE.SYL...KRL..ACFYRCSP.DAARW....PHP...........................................RRQS..SMQ.AVP..LC....HS....FCRDWYEACRM.D.....MTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GNC........VLYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDEED................------eregsegnshgsggrpcgclt...........................................
G3VZT1_SARHA/24-186                  ...............................................qcldygppfkpp-----....------.-----.....VHL.EF.........................C.SD.YETF...............................GCCDQSKD.RR.IA...A.RY.........WD...IM.EYL-D-..-..............L..R.....G...PE..........LCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNSQT..PLR.NLP.gLC....SD....YCSAFHSNCHS.A.....ISLL...T...ND.....RH.I.WA.........................sQEKNG....aHF..C-.-..-..---........---HLLN.LP..DQ...D.YC......------.-----....-----................------fpnvlrndhlnrnlgavvedrkgclq......................................
M3WCE9_FELCA/27-177                  ..........................................................f-C---....GGSRPL.PALSR.....RHH.RL.........................A.TD.FGTV...............................QLHLAEMD.TP.EA...S.DP.........GA...VP.----ER..C..............G..E.....P...SP..........GCE.SFL...GHL..QAALQSRF.RLLLL...gIRQ...........................................----..---.TQP..LC....SE....LCDVWFATCES.D.....ITC-...-...--.....GP.T.WL..........................PFPEK.....RG..C-.-..E..PGC........ATYEQTF.AD..GA...D.LC......RSVLGY.VLPVA....--APG................ADHCLN................................................................
A0A4S8J3I9_MUSBA/44-195              ..................................................stdgkpprk-----....------.VNKGP.....KDL.TL.........................C.RI.FRQN...............................TCCDVAQT.YP.AL...L.LI.........RR...LA.S-----..A..............G..E.....G...SQ..........ECL.HLW...ELL..ECSI-CDP.RIG--....VQP...........................................----..---.GPP.iVC....AS....FCDMVFQACSS.A.....YFSI...D...AK.....--.T.QA..........................L--SP.....CG..L-.S..D..TIC........GRATEWA.SN..GT...E.LC......HF----.-----....-----................------agfavqpdrqsieghdepfcy...........................................
P79388_PIG/30-205                    ...........................................................VCMDA....KHHKVE.PGPED.....ELH.DQ.........................C.VP.WKKN...............................ACCSARVS.HE.LH...R.DK.........SS...LY.NFSWEH..C..............G..R.....M...EP..........ACK.RHF...IQN..NCLYECSP.NLGPW....FQEvn.......................................qkWRKE..RFL.NVP..LC....KE....DCLDWWEDCRT.S.....YTCK...S...SW.....HK.G.WN..........................WSSGS.....NQ..CP.T..G..TTC........DTFESFF.PT..PA...A.LC......EGIWNH.DYKFT....NYSRG................SGRCIQ................................................................
A0A485MHM4_LYNPA/48-223              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.TP.WRKN...............................ACCSHNTS.QE.LH...K.DP.........SL...LY.NFNLDH..C..............G..K.....I...EP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQQWWEDCRT.S.....YTCK...N...NW.....HK.G.WD..........................WSSGS.....NK..CP.A..G..ATC........RTFETYF.PT..PA...A.LC......EGIWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A166I3N8_DAUCS/42-190              ...............................................tikgkpprrvnk-----....------.---GP.....KDL.TL.........................C.RM.FRKR...............................TCCDVTQT.HP.AF...L.TI.........RK...LA.S-----..T..............G..E.....A...SE..........DCL.QLW...ELL..ECSV-CDP.EVG--....VRS...........................................----..---.GPP.lVC....ST....FCDRVYEACSN.A.....YFSM...-...DV.....ST.Q.VL..........................APCGV.....ND..F-.-..-..-VC........GRASEWI.SN..GS...E.LC......RAS---.GFSVK...pLYDKQ................ERSC--yg..............................................................
A0A1Z5KKE7_FISSO/84-234              ..........................................................e-CGLQ....YFHKDE.PTPED.....DGM.KE.........................C.QP.WKQR...............................SCCNSSIV.AS.ME...K.LK.........ES..yGE.EYHWDR..C..............G..P.....M...TP..........ACE.RFF...VYE..SCFYECEP.SAGLFr..kY-Ndsqs...................................hleeFNTW..QMH.KMP..IK....KS....FCDSWFDACKT.D.....LFCG...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------dgdffscaaryqannpedeikkerdtn.....................................
A0A672Z5J9_9TELE/37-210              ..................................................schpqcldy-----....--KPPF.EPRQP.....LVF.--.........................C.KE.YSKF...............................GCCDLERD.EE.IS...V.RF.........YS..iMD.NF--DH..S..............G..F.....-...-V..........TCG.KFI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.LLP.gLC....GD....YCTDYWHQCRY.T.....LSLL...L...ED.....LG.N.PQ..........................QFANM....tAG..L-.-..E..EDS.......rRFCDFLE.LK..DR...Q.YCy....pNVMTNE.DLNANl..gSVRED................ATGCL-e...............................................................
A0A674BA40_SALTR/17-178              .................................................qcldfkppfk-----....------.--PQ-.....DDL.QF.........................C.AM.YRNF...............................GCCDSAKD.KE.LM...A.KF.........YK..iMD.NFD---..-..............Y..Y.....G...YA..........SCA.GYV...QDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PIR.TLP.gLC....PD....YCSQFWLKCRS.T.....ITLL...S...DD.....PQ.L.AE..........................AEPDQ....dRF..C-.-..-..---........---QHLE.LE..DP...D.YC......------.-----....-----................------yphlvsneqltqnlgrvradpegclq......................................
F6VRR1_CALJA/3-164                   .....................................................paatev-----....------.-----.....---.-Q.........................C.SP.WRKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..R.....M...EP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........RTFESYF.PT..PA...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A6A5DXL6_PERFL/36-198              ..............................................qcldfeppfkpsw-----....------.-----.....-HL.EF.........................C.TQ.YEQF...............................GCCDQKTD.NL.IA...E.RY.........WD..iID.QLE---..-..............A..A.....G...HE..........LCA.DTV...KEI..MC-QECSP.YAAHL....YDA..........................................eDPYT..PVR.ELP.gLC....FG....YCSEFHGKCRH.V.....VKY-...-...LT.....GN.Q.LL..........................WDTSG.....RD..V-.-..S..TFC........SMVDL--.-S..DQ...D.YCy....pNVLKSP.DLNSNl..gQVAED................PRGCLQ................................................................
A0A091FGB2_9AVES/29-204              ...........................................................ICMDA....KHHKTK.PGPEG.....NLH.DQ.........................C.AP.WKDN...............................ACCTANTS.SE.AH...K.DQ.........SY...LY.KFNWNH..C..............G..R.....M...PL..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQvd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKD.Y.....VTCK...E...NW.....HK.G.WN..........................WATGT.....NL..CP.W..G..AMC........RPFSQVF.PR..PK...D.LC......EKIWSN.SYKYT....TEHRG................SGRCIQ................................................................
A0A2U3WRC2_ODORO/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................EEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2Y9MH67_DELLE/34-209              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCSLNTS.QE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...KP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.NVP..LC....KE....DCQIWWEDCRT.S.....YTCK...I...NW.....HK.G.WN..........................WTSGY.....NQ..CP.V..R..AAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SYKVS....NYGRG................SGRCIQ................................................................
A0A4W4HCU6_ELEEL/57-220              ..............................................pqcldyqlpfkpf-----....------.-----.....AHL.EF.........................C.NQ.YEKF...............................GCCDQKTD.NL.IA...E.RY.........WD...IM.DLL---..G..............D..E.....G...YE..........LCG.NLV...KDI..LC-QECSP.YAAHL....YDA..........................................eDPYT..PVR.HLP.gLC....FT....YCSDFHIKCHF.V.....VKY-...-...--.....--.-.LT..........................DSKIL....lQS..C-.D..Q..DRL........RFCNLIN.LA..DQ...D.YCy....pNVVKNN.DLYSNl..gKVVED................PKGCLQ................................................................
C1EEA4_MICCC/25-217                  ...........................................................VCHLH....YYHKDV.SHAEIw...gSDV.SI.........................C.KE.YEHE...............................ACCTKDTV.KK.ID...V.NS.........KL...YG.DYDLDA..C..............G..-.....L...SS..........SCK.KFF...IEE..SCFYECDR.NVGKW....RKHvdcd...................................dageDNGW..EIK.GMP..VK....AS....YWDAWYEACKD.Q.....YFAW...G...PG.....GS.Y.WDipkft...............tdsyrgT--GH....rGQ..RT.A..Y..TSC........SKFSDTY.KN..GT...M.VA......EVMWGG.AFTYE....KDES-................------kayvmtfpd.......................................................
U6N218_9EIME/24-185                  ..............................................vclrrlsfdgqpp-----....-----Q.-DQRE.....YSF.QS.........................C.TN.HAAN...............................TCCYPQHT.EL.IK...R.RL.........GA...LE.------..-..............-..-.....D...NK..........ECK.KVS...EEV..MCVL-CEP.RFGTG...eFES...........................................----..--K.GNP.vLC....PQ....LCEKWFAACKE.A.....FVSA...S...PS.....GS.S.SA..........................LTFCD.....DN..C-.-..-..LIC........SRLSATL.DN..SL...S.FC......RGMGYE.VLVED....-AS--................------dssegvkqrrracy..................................................
L5LPC5_MYODS/26-201                  ...........................................................VCMKT....KHHKPE.PGPEP.....QLY.DE.........................C.SP.WKGN...............................ACCTTNTS.WE.AH...L.DE.........AV...LY.NFSLIH..C..............G..L.....M...IP..........DCQ.KHF...IQA..KCLHQCSP.NLGPW....IQQva.......................................pcEQEE..RIL.DAP..LC....QE....DCVQWWADCRT.S.....YTCK...S...NW.....LR.G.WD..........................WSRGK.....SR..CP.A..R..ARC........RPFPYYF.PT..PA...A.LC......EKIWGN.SFKAS....PERRN................SGRCLQ................................................................
A0A484GSX4_SOUCH/34-143              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCSVNTS.QE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...KP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.NVP..LC....KE....D----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------wtsmawk.........................................................
F1MI35_BOVIN/31-192                  ......................................................qcldf-----....--RPPF.RPPQP.....LR-.-F.........................C.SQ.YSAF...............................GCCTPEQD.AA.LA...R.RF.........GA..vAA.RVD---..-..............A..A.....M...WA..........ECA.GYA...LDL..LC-QECSP.YVAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRG.L.....FRHL...S...PD.....RE.L.WA..........................LEGNR.....A-..--.-..-..KLC........RSLSL--.-D..DT...D.YCf....pRLLVNE.NLNSNl..gRVVAD................AEGCLQ................................................................
A0A5F8G8G3_MONDO/39-222              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlesls...............gpeavC.GA.FYPR..............................lSCCSRIDS.QS.LL...H.ME.........SK...IF.S-----..-..............V..T.....N...NT..........ECV.KLL...EEI..RCAH-CSP.HSQNL....FHSpe.......................................rvEASE..REL.ALP.lLC....ED....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.AA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..TS...N.YL......DQMEEY.DKVDEi..sRKHKH................SCFCAQ................................................................
A0A2R5G9L0_9STRA/50-184              ...................................................vaawrsgg-----....------.-----.....--L.AL.........................C.SR.FARK...............................TCCSREQA.AA.LY...A.SW.........VG...TQ.R-----..-..............A..G.....F...AP..........RCA.EMF...ETV..MCMP-CDP.EVGLG....RK-...........................................----..---.-RI..IC....KS....TCDAWFDACKD.E.....FFAT...T...SA.....--.-.VA..........................GDTLV.....PC..LQ.D..A..VVC........SQLADFV.PS..GT...A.LC......AT----.-----....-----................------yglslgedfcyd....................................................
D3YZI1_MOUSE/26-143                  ...........................................................VCMNS....KRHKQE.PGPED.....ELY.QE.........................C.RP.WEDN...............................ACCTRSTS.WE.AH...L.EE.........PL...LF.NFSMMH..C..............G..L.....L...TP..........ACR.KHF...IQA..ICFHECSP.NLGPW....IQPvv......................................pngQEEQ..RVW.GVP..LC....QE....DCEDWWRACHS.S.....LTC-...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------................................................................
A0A665TXP7_ECHNA/28-209              ...........................................................MCLQD....GKHKAV.PSPEP.....HLR.D-.........................C.AL.YADN...............................SCCTEEDI.QD.IS...H.VP.........SA..tNK.NEPWDK..C..............G..S.....L...SS..........ECE.GFL...KRV..SCFYRCSP.DAARW....PHP...........................................HRGS..YIQ.AVP..LC....HS....FCRDWFDACRM.D.....LTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..A..GAC........VQYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDDPE................------dvgeageigaegdssrpcgclt..........................................
A0A452STC7_URSAM/31-206              ...........................................................VCMDA....KHHKEK.PSPED.....ELH.KQ.........................C.SP.WKKN...............................SCCFTNTS.EE.AH...K.DI.........SY...LY.KFNWNH..C..............G..H.....M...TP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.DVP..LC....KE....DCQQWWEDCRT.S.....YTCK...S...NW.....HK.G.WD..........................WSSGY.....NR..CP.A..G..AAC........LPFHFYF.PT..SA...A.LC......GEIWSH.SYQAS....NYSRG................SGRCIQ................................................................
A0A218VFA8_9PASE/21-188              ..........................................................g-CLEG....DTQKLK.PGPEP.....NMQ.E-.........................C.TL.YSKS...............................SCCYADFT.EQ.LA...H.SP.........VI..kVS.DSYWNR..C..............G..Q.....L...SK..........SCE.DFT...KKI..ECFYRCSP.DAARW....IHP...........................................NDTA..AIR.AVP..LC....QS....FCDDWYEACKD.D.....SICV...R...NW.....LT.D.WE..........................WDESG....eNH..C-.-..N..NKC........IPYREMY.AN..GT...D.MC......QSMWGE.SFKVS....---ES................SCLCLQ................................................................
A0A2K6LAI1_RHIBE/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A1B0GSV4_MOUSE/29-177              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCSVNTS.QE.LH...K.AD.........SR...LY.-FNWDH..C..............G..K.....M...EP..........ACK.SHF...IQD..SCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RFL.DVP..LC....KE....DCHQWWEACRT.S.....FTCK...R...DW.....HK.G.WD..........................WSSGI.....NK..CP.N..T..APC........HTFEYYF.PT..P-...-.--......------.-----....-----................------................................................................
A0A091CNP1_FUKDA/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggempC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECE.KLL...EEV..KCAF-CSP.HSQSL....FHSp........................................erEVVE..RDL.LLP.fLC....KD....YCKELFYTCRS.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCS....yYV..RK.D..G..GLCf.....pdFPRKQMR.GP..AS...N.SL......DQMEEY.DKVEEi..sRKHKH................NCFCVQ................................................................
M7AZZ7_CHEMY/7-169                   ..............................................qcldygppfqppf-----....------.-----.....-HL.EF.........................C.SA.YETF...............................GCCDQDKD.NS.IA...A.KY.........WE...IM.DYID--..-..............P..Q.....G...HQ..........LCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....FD....YCSEFHFNCRS.A.....ITLL...T...N-.....--.-.--..........................DKHIQ.....EC..C-.E..R..NKT........RFCNLLN.IQ..DQ...D.YCy....pNVLKNT.DLNRNl..gSVVED................PKGCL-q...............................................................
A0A672YCX8_9TELE/32-193              ..............................................qcldfkppfrplr-----....------.-----.....-EL.EF.........................C.VM.YKEF...............................GCCDFQKD.QE.LM...S.KY.........YQ..iMD.NFD---..-..............Y..Y.....G...YA..........NCA.GFV...QEL..LC-QECSP.YAAHL....YDA..........................................eDPST..PIR.SIP.gLC....PD....YCAHFWKKCNS.T.....FPFL...S...DD.....-P.H.I-..........................-----.....TK..V-.Q..H..DQT........RLCRYLE.LD..DT...D.YCy....pHILSNQ.QLTQNl..gRVQSD................SDGCLQ................................................................
A0A4W3I551_CALMI/57-223              ...........................................................RCLVG....NNHKTL.PSPEP.....GMQ.A-.........................C.TK.YSQS...............................SCCYANYT.QQ.LN...V.SP.........LI..kVN.NMYWNT..C..............G..Q.....L...SP..........QCE.QYL...KNV..DCFYHCSP.HAFHW....VNP...........................................NNSY..SII.AVP..IC....RS....YCDDWFTACKN.D.....RTCA...R...NW.....IT.D.WE..........................WNEQG.....NR..C-.-..K..NEC........IPFHQMF.KD..GK...D.LC......ESMWSP.SFNVS....---SS................NCHCL-m...............................................................
E2QXC4_CANLF/31-206                  ...........................................................VCMDA....KHHKEK.PSPED.....GLH.KQ.........................C.SP.WKKN...............................SCCFANTS.RE.AH...K.DI.........SY...LY.RFNWNH..C..............G..S.....M...TP..........ACK.KHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.HVP..LC....KE....DCEQWWQDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGY.....NQ..CP.E..G..AAC........HPFHFYF.PT..SA...A.LC......SEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A673BA80_9TELE/30-205              ...........................................................MCMDA....KHHKVE.PGPEG.....YLY.RQ.........................C.EP.WRDN...............................ACCTSNTS.TA.AH...D.DN.........SY...LY.NFNWNH..C..............G..A.....M...SE..........QCK.KHF...IQD..TCFYECSP.HLGPW....IQQtd.......................................qsWRKE..RIL.DVP..LC....QE....DCHSWWEDCKN.D.....FTCK...T...DW.....HK.G.WD..........................WSSGT.....NK..CP.K..D..SRC........SKWTEIY.PT..PQ...S.MC......EQIWSN.SYRYT....TYSKT................SGRCMQ................................................................
G3V8M6_RAT/34-209                    ...........................................................VCMDA....KHHKEK.PGPED.....KLH.DQ.........................C.SP.WKTN...............................ACCSTNTS.QE.AH...K.DI.........SY...LY.RFNWNH..C..............G..T.....M...TP..........ECK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.DVP..LC....KE....DCVLWWEDCKS.S.....FTCK...S...NW.....HK.G.WN..........................WTSGH.....NE..CP.V..G..ASC........HPFTFYF.PT..PA...V.LC......EKIWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A2K6BUN5_MACNE/27-183              ..........................................................a-C---....GGSHPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagTCCPSEMD.TT.EI...S.SP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QHALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
U3IEN3_ANAPP/21-188                  ..........................................................g-CLEG....DTHKLK.PSPEP.....DMH.E-.........................C.TL.YSES...............................SCCYANFT.EQ.LA...H.SP.........VI..kVN.NSYWNR..C..............G..Q.....L...SK..........SCE.DFT...KKI..ECFYRCSP.HAARW....IHP...........................................SYTA..AIQ.SVP..LC....KS....FCDDWFEACKD.D.....STCV...H...NW.....LT.D.WE..........................WNESG....eNR..C-.-..K..NKC........IPYSEMY.AN..GT...D.MC......QNMWGE.SFKVS....---ES................SCLCLQ................................................................
A0A093IHJ4_FULGA/3-129               ........................................................lsv-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETPE..REL.TLP.yLC....KD....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
C3Y1A9_BRAFL/1229-1397               ..........................................................a-CVRHd..dPHHKEY.PTPEP.....DLQ.V-.........................C.SP.YAYG...............................SCCTVEHD.HH.LA...V.RP.........VP..gVH.NFSWNR..C..............G..T.....L...SP..........QCE.NFM...IDL..ECFNSCSP.DIRRL....SIP...........................................--TD..SGS.AIP..VC....AS....FCDRWFSACRN.D.....VTCV...A...NW.....RS.D.WD..........................MDDNN....rNN..CP.E..G..SSC........KTFDEMY.GD..AQ...T.LC......ETFFGS.EFQYN....S----................------tdkcvd..........................................................
G1LZN7_AILME/31-206                  ...........................................................VCMNT....KHHKRE.PGPED.....KLY.EE.........................C.IP.WQDN...............................ACCTASTS.WE.AH...L.DA.........SL...LY.TFSLLH..C..............G..V.....M...MP..........GCE.KHF...LQA..ICFYECSP.NLGPW....IQKmd.......................................ssGPGE..RIL.DAP..LC....QE....DCEQWWEDCRT.S.....YTCK...S...NW.....HG.D.WN..........................RSGGK.....NR..CP.A..R..AIC........HPFPHYF.PT..PA...D.LC......EKIWNH.SFKAS....PEPRN................SGQCLQ................................................................
A0A452DRC4_CAPHI/39-221              ...........................................................RCLNG....NPPKRL.KKKDR.....RMM.SQpells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........SK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAA-CSP.HSQSL...fYSPe.........................................rEALE..RDL.VLP.fLC....KD....YCKEFFYTCRG.H.....IPG-...-...-L.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A3M0KHC3_HIRRU/30-205              ...........................................................VCMDA....KHHKTE.PGPEG.....QLY.GQ.........................C.VL.WKDN...............................ACCTANTS.LE.AH...Q.DQ.........SY...LY.NFNWDH..C..............G..V.....M...PE..........KCK.RHF...IQD..TCLYECSP.NLGPW....IEQad.......................................tsWRKE..RIR.DVP..LC....QE....DCEQWWEDCQD.A.....VTCK...V...NW.....HK.G.WN..........................WTTGT.....NQ..CP.K..G..AMC........QKFKFVF.PT..AA...V.LC......KQIWSG.SYRYT....SYHRG................SGRCIQ................................................................
A0A4U1ES09_MONMO/123-210             .......................................................lslp-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...MS..........RCE.SFL...GHL..QVALRSRF.HLLLL...gVRQ...........................................----..---.TQP..LC....SE....LCDAWFATCES.D.....TIC-...-...--.....CP.T.WL..........................PLLEK.....RG..C-.-..E..PGC........TTYGQ--.--..--...-.--......------.-----....-----................------ddlevriscpki....................................................
A0A4W2EDW7_BOBOX/44-206              ...............................................qcldyrppfqpl-----....------.-----.....QHL.EF.........................C.SD.YESF...............................GCCDQRKD.HR.IA...A.RY.........WD...IM.EYF-D-..-..............L..K.....G...HE..........LCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....SD....YCSAFHSNCHS.A.....IALL...T...ND.....-R.R.FQ..........................ESPGK.....DG..T-.-..-..---........RFCHLLN.LP..DK...D.YCf....pNIL---.-----....-----................------rsdhlnrnlgtvaedrrgclq...........................................
A0A455C822_PHYMC/44-219              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCSVNTS.QE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RVL.NVP..LC....KE....DCQIWWEDCRT.S.....YTCK...T...NW.....HK.G.WN..........................WTAGY.....NQ..CP.V..R..AAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SYKVS....NYGRG................SGRCIQ................................................................
A0A2K6UFM4_SAIBB/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A5E4BQJ4_MARMO/29-204              ...........................................................VCMDA....KHHKAK.PGPED.....KLH.NQ.........................C.TP.WRRN...............................ACCSVYTS.QE.LH...K.DT.........SH...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RFL.NVP..LC....KE....DCQNWWEDCRT.S.....FTCK...S...NW.....HK.G.WN..........................WTSGV.....NK..CP.V..G..AVC........RTFESYF.PT..PA...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A452QBA6_URSAM/27-202              ...........................................................VCMNT....KHHKRE.PGPED.....KLY.EE.........................C.IP.WQDN...............................ACCTAGTS.WE.AH...L.DA.........SL...LY.TFSLLH..C..............G..V.....M...MP..........GCE.KHF...LQA..ICFYECSP.NLGPW....IQKvd.......................................ssGPGE..RIL.DVP..LC....QE....DCEQWWEDCRT.S.....YTCK...S...NW.....HG.D.WD..........................RSGGK.....NR..CP.A..R..AVC........HPFPHYF.PT..PA...D.LC......EKIWNH.SFKAS....PEPRN................SGQCLQ................................................................
A0A091KUQ7_9GRUI/3-160               ..............................................qcldygppfqppf-----....------.-----.....-HL.EF.........................C.SA.YENF...............................GCCDQERD.NS.IA...A.KY.........WD...IM.DYID--..-..............P..R.....R...HK..........LCG.TYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....FD....YCSEFHFNCRS.A.....ISLL...M...SDk...hIQ.E.CC..........................ETNKT.....HF..C-.-..-..---........NLLHYCF.P-..--...-.--......------.-----....-----................------nvlkntalnrnlgsvvedrkgclq........................................
A0A452HYW3_9SAUR/63-225              ..............................................qcldygppfqppf-----....------.-----.....-HL.EF.........................C.SA.YETF...............................GCCDQDKD.NS.IA...A.KY.........WE...IM.DYI-D-..-..............L..Q.....G...HE..........LCG.EYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....FD....YCSEFHFNCRS.A.....ITLL...T...N-.....--.-.--..........................DKHIQ.....EC..C-.E..R..NKT........RFCNLLN.IQ..DQ...D.YCy....pNVLKNT.DLNSNl..gSVVED................PKGCLQ................................................................
W4YAJ7_STRPU/312-484                 ...........................................................RCLDG....KFHKDK.PGPES.....ALF.SQ.........................C.SA.WKNR...............................SCCTEEIT.ED.LH...I.QP.........I-...WH.DFKWNH..C.............dT..P.....L...ST..........TCE.QWM...RQD..LCFYECSP.NVGPW....LVPhn.......................................isIRNE..RFM.HVP..LC....ES....ECNVWWEACRY.D.....FTCK...D...NW.....AK.G.WD..........................WSSGE.....NE..CP.S..D..ATC........DTFEAKF.GN..AS...N.MC......QTIWNK.SYTVV....---PD................SESCM-v...............................................................
C3YZN7_BRAFL/18-189                  ..........................................................s-CLDG....MHHKQV.PGPEG.....SLY.QQ.........................C.TP.WKDR...............................ACCRGNVT.EK.MH...Q.DQ.........LF...PY.NFQWHH..C..............G..Q.....L...SP..........ACE.RHF...MQD..MCFYECSP.NLGPW....LVKiq.......................................mkIRNE..RFV.NVP..LC....AS....DCNQWWQACKD.D.....MTCS...G...NW.....GK.G.WN..........................WT-SV.....NE..CP.R..G..NQC........KTFKKYF.GD..AT...N.FC......QKIWDG.SFTVV....---AD................TEPCM-t...............................................................
A0A287D157_ICTTR/26-201              ...........................................................VCMNA....QHHKRE.PGPED.....ELY.VE.........................C.IP.WKDN...............................ACCTATTS.WE.AH...L.EV.........SP...LH.NFTLVH..C..............G..L.....L...TP..........SCQ.KHF...IQA..ICFYQCSP.NLGPW....IQLvg.......................................psGQGE..RIV.GVP..LC....WE....DCEEWWADCRT.S.....YTCK...S...NW.....YS.S.WH..........................WSQGK.....NR..CP.A..G..DIC........HPFPHYF.PT..PT...D.LC......EKIWSN.SFKAS....PEHRN................SGRCLQ................................................................
I3MG93_ICTTR/34-209                  ...........................................................VCMDA....KHHKEK.PSPED.....KLH.EQ.........................C.SP.WKKN...............................SCCSFNTS.QE.AH...K.DI.........SY...LY.GFNWDH..C..............G..K.....M...AP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.NVP..LC....KE....DCQRWWEDCQT.S.....FTCK...S...NW.....HK.G.WN..........................WTLGY.....NQ..CP.V..G..TAC........HPFHFYF.PT..PA...A.LC......EEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
F5GZ45_HUMAN/41-180                  ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCTASTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........-------.--..--...-.--......------.-----....-----................------................................................................
A0A673UCW9_SURSU/28-109              .........................................................vf--MDA....KHHKTK.PGPKD.....YVFsTQ.........................C.TP.WKKS...............................ACCSLNTS.QQ.LH...Q.DP.........SL...LY.NFNLDH..C..............G..K.....M...EP..........ACR.RHF...LRS..LCTNTC--.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------llclssa.........................................................
G3NYD9_GASAC/25-200                  ...........................................................MCMDG....KHHKVN.PGPEG.....KLY.LQ.........................C.AP.WREN...............................ACCTANTS.TE.AH...D.DA.........SY...LY.NFNWNH..C..............G..A.....M...SP..........QCK.KHF...IQD..TCFYECSP.HLGPW....IQPvd.......................................qsWRRE..RIL.DVP..LC....NE....DCHSWWEDCKN.D.....FTCK...T...DW.....HK.G.WD..........................WSSGT.....NR..CP.E..G..SKC........RKWTEVY.PT..AK...S.MC......EQIWSN.SYLYT....THPKT................SGRCMQ................................................................
K7EN64_HUMAN/27-130                  ..........................................................a-C---....GGSRPL.QARSQ.....QHH.GL.........................A.AD.LGKGklh.........................lagPCCPSEMD.TT.ET...S.GP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....I---...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------................................................................
R0JTG2_ANAPL/1-98                    ...........................................................-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..----ECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCQQVWQKCRS.I.....FRYL...S...SD.....PE.L.VA..........................L---E.....NN..M-.-..A..KLC........RYLSL--.-E..DT...D.YCf....pHLLTNE.NLNQNl..gLVTAD................AEGCL-q...............................................................
A0A2G5DM75_AQUCA/36-190              .................................................sfssegkppr-----....-----K.VNKGP.....KDL.TL.........................C.RV.FRRS...............................TCCDVTQT.HQ.AL...L.TI.........RR...LA.SV----..-..............G..E.....A...NQ..........ECL.QLW...ELL..ECSI-CDP.LVG--....VQR...........................................----..---.GPP.lIC....SS....LCDRIFQSCSS.A.....YFSM...D...A-.....KT.Q.VL..........................SPCG-.....--..L-.S..D..FVC........GRASEWV.SN..GT...E.LC......QHA-GF.SVKSS...gNG---................------hkgmeetfcyg.....................................................
A0A2K6M558_RHIBE/36-211              ...........................................................VCMNA....KHHKAQ.PSPED.....ELY.GQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DI.........SR...LY.NFNWDH..C..............G..K.....M...QP..........ACK.RHF...IQD..ACLYECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCEHWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGI.....NE..CP.A..G..ALC........RTFESYF.PT..PA...T.LC......EGLWSH.SFKVS....NYSGG................SGRCIQ................................................................
A0A5N3XAW0_MUNRE/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RLM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........SK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL...fYSPe.........................................rEALE..RDL.ALP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-L.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
C1EAB4_MICCC/27-183                  ............................................vcvnhqgvpsfalag-----....-----K.PPAKG.....KGL.TF.........................C.EE.YREE...............................TCCDAKTT.DN.VR...R.VA.........AH...MQ.------..L..............G..G.....F...KI..........QCR.EAW...TQL..ECSI-CDP.RAG--....ITS...........................................----..---.KTK..VC....AH....QCDAIYRACKD.D.....YFTE...D...KL.....--.-.--..........................QR-LT.....PC..RS.S..D..TIC........TKLSEWA.DDmgGG...Q.MC......EDA-GY.EVVSA...gKSKAD................GGWCF-d...............................................................
G3Q9P9_GASAC/34-195                  ..............................................qcldfkppfrplr-----....------.-----.....-EL.EF.........................C.VM.YKEF...............................GCCDYQRD.QE.LM...A.NY.........YH...VM.---GGS..D..............Y..S.....G...YV..........RCA.GFV...LEL..LC-QQCSP.YAAHL....FDA..........................................eDPNT..PVR.TIP.gLC....PD....YCSEFWKKCSS.T.....IPLL...S...ND.....--.T.-L..........................IAK--.....--..L-.K..E..DQT........RLCQYLK.LD..DD...D.YCy....pHLLSNQ.KLTQNl..gTVQSD................SEGCLQ................................................................
K7G8A6_PELSI/63-225                  ..............................................qcldygppfqppf-----....------.-----.....-HL.EF.........................C.TA.YETF...............................GCCDQEKD.NS.IG...A.KY.........WE...IM.DYID--..-..............P..Q.....G...HK..........LCG.GYI...KDI..LCQV-CSP.YAAHL....YDA..........................................eNLQT..PLR.NLP.gLC....FD....YCSEFHFYCRS.A.....ITLL...T...N-.....--.-.--..........................DKHIQ.....EC..C-.E..K..NKT........RFCNLLN.IQ..DQ...D.YCy....pDVLKNT.DLNRNl..gSVVED................PKGCL-q...............................................................
A0A3Q4GF04_NEOBR/57-219              ................................................qcldfkppfkp-----....------.--PW-.....-HL.EF.........................C.KQ.YEQF...............................GCCDQGTD.NM.IA...E.RY.........WD..iIE.QLE---..-..............A..A.....G...HE..........LCT.DML...KEI..MC-QECSP.YAAHL....YDA..........................................eDPYT..PVR.EIP.gLC....FD....YCSEFHSKCRH.V.....LKYL...-...-T.....VN.Q.LL..........................LYAAE.....RD..V-.-..T..TFC........SM---VD.LP..DQ...D.YCy....pNVLKSS.DLNSNl..gQVVED................PRGCL-q...............................................................
A0A267EHC0_9PLAT/23-164              .....................................................yctffg-----....---NRA.PAPQP.....TLH.N-.........................C.TW.YRQH...............................SCCRGEEI.NI.TF...A.SV.........RP...LQ.------..-..............-..G.....A...SR..........SCL.RYF...NSL..MC-YICSP.SQWVF....YRG...........................................----..--E.SLT..VC....RD....FCDKWYQACGS.A.....FIKG...Q...TV.....AS.L.FE..........................--NGY.....KL..C-.-..-..---........DSRQFKV.ST..GK...D.DC......------.-----....-----................------fryvaeegevfaeasgpp..............................................
A0A2K6ALM9_MACNE/47-206              .................................................dygppfqpll-----....------.-----.....-HL.EF.........................C.SD.YESF...............................GCCDQHKD.RR.IA...A.RY.........WD..iME.YFD---..-..............L..K.....R...HE..........LCG.DYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHS.A.....ISLL...T...ND.....-R.G.LQ..........................ESHGM.....DG..V-.-..-..---........RFCHLLD.LS..DK...D.YC......------.-----....-----................------fpnvlrnnylnrnlgmvaqdprgclq......................................
K7F9T5_PELSI/35-217                  ..........................................................k-CLNG....NPPRRL.KKRDR.....RMM.FLepas................egemmC.RG.FYPR..............................lSCCSRTDS.QG.LL...H.FE.........NK...IF.S-----..-..............V..T.....N...NT..........ECV.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgEASE..REL.ALP.fLC....KD....YCKEFYYTCRG.Q.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYT..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCLQ................................................................
A0A3B1J8J3_ASTMX/36-197              .................................................qcldfkppfq-----....------.--PQQ.....EL-.QF.........................C.VM.YKRF...............................GCCDYARD.QE.LM...S.RF.........YK..iMD.NFD---..-..............Y..Y.....G...YA..........NCA.GYV...QDL..IC-QECSP.YAAHL....FDA..........................................eDPST..DLR.SIP.gLC....PD....YCSQFYSKCRS.T.....IPLL...S...DD.....PQ.L.LE..........................LQHD-.....--..--.Q..S..RLC........QRLGL--.-D..DL...D.YCy....pHLLSNE.QLTKNl..gRVTSD................SEGCL-q...............................................................
A0A672V872_STRHB/43-205              ..............................................qcldygppfqppf-----....------.-----.....-HL.EF.........................C.SA.YENF...............................GCCDQERD.NS.IA...A.KY.........WD...IM.DYID--..-..............P..R.....E...HK..........LCG.TYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....FD....YCSEFHSSCHS.A.....ISLL...T...--.....--.-.-S..........................DRHIQ.....EC..C-.E..T..NKT........RFCDLLH.LH..DE...D.YCf....pNVLKNT.ALNHNl..gSVVED................HKGCLQ................................................................
A0A3P9CAW3_9CICH/36-208              .................................................chpqcldykp-----....----PF.EPRQP.....LA-.-F.........................C.KE.YSKF...............................GCCDVEKD.EE.IS...G.RF.........YN..iME.N--FDH..S..............G..-.....-...YA..........ACG.KYV...RSI..LC-QECSP.YAAHL....YDA..........................................eDADT..PMR.ALP.gLC....GD....YCSDYWRQCRY.T.....LSLL...L...ED.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------vgnsqqfanltatieedhrrfceflvlkdkeycypsvltnaelnanlgllnedpegcle.....
A0A485KW75_9STRA/21-173              ...............................................tcrstggikfdp-----....----TE.PSRQQk...qRQL.DH.........................C.SK.YWKN...............................SCCNATHT.LP.LK...R.QI.........ME...PY.------..V..............A..G.....F...NS..........KCQ.ALH...EEL..TCSA-CHP.FVGTG...rMD-...........................................----..---.--R..IC....PD....LCDDWFDACKD.E.....FYS-...-...PD.....GS.H.AL..........................SPCYG.....NA..L-.-..-..-IC........SPLGSIV.ST..GR...E.FC......HKM-GY.-----....-----................------tpgkstdtegvtcfd.................................................
A0A6I8QCV6_XENTR/20-182              ..................................................qcldyappf-----....------.KPP--.....AHL.EF.........................C.SQ.YETF...............................GCCDQDRD.NA.IA...E.KY.........WS..iMD.YFD---..-..............L..N.....G...YH..........TCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eDPHT..PLR.IIP.gLC....FN....YCSEFHLKCQS.S.....VTLL...T...E-.....--.-.--..........................DKQIR.....ES..C-.N..K..GRD........LFCNLLN.LP..DE...D.YCf....pN-----.-----....-----................------vlhntdlnnnlgsvvedpegcmk.........................................
F5H5L8_HUMAN/76-148                  ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCTASTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYE---.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------................................................................
A0A673ULW5_SURSU/31-206              ...........................................................VCMDA....KHHKEK.PSPED.....ELH.EQ.........................C.SP.WKKN...............................SCCFANTS.RE.AH...K.DI.........SY...LY.RFNWDH..C..............G..Q.....M...AP..........ACK.QHF...IQD..TCLYECSP.NLGPW....IQQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCQQWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WSSGY.....NQ..CP.A..G..ADC........HPFHFYF.PT..PA...A.LC......SEIWTH.SYKLS....NYSRG................SGRCIQ................................................................
A0A3M7R1L6_BRAPC/55-197              .....................................................pclyfs-----....--ENRY.SQPES.....SLI.N-.........................C.TW.YKAN...............................ACCKRTEV.AS.VF...E.NM.........FT...LN.------..-..............-..R.....A...SE..........VCM.NMM...NYM..MCFF-CSP.NQYIW....YRE...........................................----..--M.QIF..VC....LR....FCEELVEKCKE.A.....EYNG...N...TI.....GE.I.YKdga....................sfcR----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------aqdfkvipsnhqcfdfdsspfstsnqvsana.................................
A0A4E0S105_FASHE/77-247              ..........................................................l-CPLG....PHHKNE.PSAEP.....GLV.DI.........................C.HE.WAER...............................SCCTADTL.KK.SQ...-.-T.........GL...IY.NFDHSH..C.............nQ..T.....M...SE..........KCE.AIF...KRD..LCFYQCSP.NLGPW...mIRSe........................................rkVGTE..RMY.AAP..LC....MS....DCNEWWEACRH.E.....QTCV...E...NW.....SY.E.FD..........................WSTGR.....NM..CP.E..G..RDC........LSFEQVY.GN..AS...Q.FC......HAVWDG.SWTAT....----S................SSQCL-h...............................................................
A0A3Q4GHF8_NEOBR/11-184              ...............................................lekcvkghlqiq-----....------.---EF.....VHY.YF.........................C.SP.WRDN...............................ACCTANTS.AE.AH...D.DA.........SY...LY.NFNWNH..C..............G..I.....M...SK..........ECK.KHF...IQD..TCFYECSP.HLGPW....IQPvd.......................................qsWRKE..RIL.DVP..LC....KE....DCETWWEDCKN.D.....ITCK...D...NW.....HK.G.WD..........................WSSGI.....NK..CP.E..G..SKC........SKWTDFF.PT..PK...S.MC......EKIWSN.SYIYT....TYTKT................SGKCMQ................................................................
A0A0E0CMR2_9ORYZ/49-201              .............................................fssegkrpgraakg-----....------.----R.....RDL.AL.........................C.RV.FRQN...............................TCCDVSQT.FS.AL...L.SV.........RK...LA.S-----..T..............G..E.....G...SQ..........ECL.HLW...ELL..ECSI-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFKACSE.A.....YFAI...-...D-.....VK.T.QA..........................LSPCG.....--..L-.G..D..ILC........GKAHKWV.SN..GT...E.LC......RSA---.-----....-----................------gfsvqalestsggvddtfcy............................................
A0A452GGX8_9SAUR/41-195              ...........................................................VCMDA....KHHKTK.PGPEG.....ALH.GQ.........................C.AL.WKDN...............................ACCTAETS.TG.AH...Q.DQ.........SY...LY.NFNWNH..C..............G..V.....M...PE..........MCK.RHF...IQD..TCLYECSP.NLGPW....IDQad.......................................tsWRRE..RIL.NVP..LC....KE....DCELWWEACKD.A.....VTCK...E...NW.....HK.G.WN..........................WTS--.....--..--.-..-..---........-------.--..-A...D.LC......EKIWSN.SYKYT....TEHWG................SGRCI-q...............................................................
A0A0L8HL22_OCTBM/38-170              .......................................................ycsf-----....-FSNRA.PSPQP.....TLK.N-.........................C.TW.FQSN...............................SCCMQEEI.AA.TF...G.NV.........KP...LP.------..-..............-..G.....A...NE..........KCQ.NYL...NYL..MC-YICAP.NQNVF....YLR...........................................----..--E.RLT..VC....KE....FCNNFYEACRY.A.....ILKG...S...I-.....-V.G.NL..........................YSNGS.....EF..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------lsrsfkvddagngkcfnhdfqee.........................................
A0A091VRV6_OPIHO/31-206              ...........................................................ICMDA....KHHKTK.PGPEG.....TLH.GQ.........................C.AP.WKDN...............................ACCTANTS.SE.AH...K.DQ.........SN...LY.NFNWNH..C..............G..Q.....M...PP..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQad.......................................ssWRQE..RIL.HVP..LC....KE....DCEEWWEDCKD.Y.....VTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFSHVF.PR..PK...D.LC......EKIWSN.SYKYT....TEPRG................SGRCIQ................................................................
A0A1A6GQV6_NEOLE/38-138              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggeilC.GG.FYPR..............................vSCCLQSDS.PG.LG...R.LE.........NK...IF.S-----..-..............A..T.....N...NT..........ECG.KLL...EEI..KCAP-CSP.HSQSL...fYSP...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------erdvldgdlevv....................................................
A0A0L9TY98_PHAAN/26-186              ...............................................vcvsqggrfppf-----....KSEGSV.PKKGP.....KDL.TL.........................C.RI.FRKK...............................TCCGVTHT.HP.AL...M.SV.........RK...LA.TT----..-..............G..E.....A...NP..........ECL.HLW...ELL..ECSI-CDP.RVG--....TQP...........................................----..---.GPP.lIC....AS....LCERIYEACSN.A.....YFSM...-...DV.....KT.Q.IL..........................APCGV.....ND..F-.-..-..-VC........GRAAEWV.SN..GT...D.LC......VAA---.-----....-----................------gfrvsssdigfiaseeascy............................................
A0A4W4H6D4_ELEEL/54-200              .................................................qcldfkppfq-----....------.--PQQ.....EL-.QF.........................C.VM.YKYF...............................GCCDFARD.QE.LM...T.KF.........YQ..iMD.NFD---..-..............Y..Y.....G...YA..........NCA.GYI...QDL..IC-QECSP.YAAHL....FDA..........................................eDPST..PLR.SIP.gLC....PD....YCSQFYSKCRS.T.....ISLL...S...ED.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------prlselehdqhgfcrylelddpdycyphiltneqlg............................
A0A1V4KC84_PATFA/8-144               ....................................................rcldstf-----....------.-----.....---.--.........................-.--.----...............................--------.--.-H...K.AS.........KR...FY.RLSARL..D..............G..A.....T...YA..........ACA.GHL...QDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCRQVWQKCRS.I.....FRYL...S...TD.....QE.L.IA..........................LENNM....aKF..C-.-..-..---........RYLS---.LE..DT...D.YC......------.-----....-----................------fphllanqnlnqnlgfvtadaegclq......................................
A0A444GDW3_ENSVE/23-188              ..................................................tvgkpprkv-----....------.-NKGP.....KDL.TL.........................C.RI.FRQN...............................TCCDVAQT.YP.AS...L.LI.........RR...LA.S-----..A..............G..E.....G...SQ..........ECL.HLW...ELL..ECSI-CDP.RIG--....VQP...........................................----..---.GPP.lVC....AS....FCDMVFQACSS.A.....YFSI...D...AK.....TQ.V.IFrslcys..............fcfllhQ-ALS....pCG..L-.S..D..TIC........GRATEWA.SN..GT...E.LC......HLA---.-----....-----................------gfavqpdgksieghdepfc.............................................
A0A3S1A5C9_ELYCH/35-126              ...........................................................ICMLG....EHHKGS.PGPEK.....GLT.SK........................iC.SP.WAAR...............................SCCTEETA.LD.IH...T.NS.........TW...L-.NFDWNH..C..............A..P.....L...SA..........QCR.EYF...IMD..SCFYSCSP.NVGPW....LVE...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------vsvilrac........................................................
A0A093CVN4_9AVES/1-98                ...........................................................-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..----ECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCQQVWQNCRS.I.....FRYL...S...AD.....QE.L.IA..........................LENNM....aKF..C-.-..-..---........---HYLS.LE..DT...D.YCf....pH-----.-----....-----................------llanqnlnqnlgfvtadaegclq.........................................
A0A3Q3FZF7_9LABR/27-200              ..................................................cchpqcldy-----....--KPPF.EPRQP.....LVF.--.........................C.KE.YSKF...............................GCCDLEKD.GE.IS...V.RF.........YN..iMA.--NFDH..S..............G..Y.....M...--..........TCG.KYL...RSI..LC-QECSP.YSAHL....YDA..........................................eDANT..HMR.MLP.gLC....PD....YCSEYWNQCRY.T.....LSLL...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------ledfggpqqfanltatieedsrrfcdflelkdkqycypnvltntelnanlgfvsedptgcle..
A0A402EZX3_9SAUR/41-202              ........................................................qcl-----....DFKPPF.KPPRP.....LAF.--.........................C.TQ.YSDF...............................GCCEAQRD.SA.LL...E.RF.........YR...VT.E-HLD-..-..............H..A.....A...YA..........ACA.GHL...QDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PVK.TVP.gLC....PD....YCVQVWQNCRS.M.....FKLL...S...ED.....RE.L.LA..........................LENNM....aKF..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------rylaledadycfphlltnkrltqnlglvtadtegclq...........................
FOLR2_MOUSE/29-203                   ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCSVNTS.QE.LH...K.AD.........SR...LY.-FNWDH..C..............G..K.....M...EP..........ACK.SHF...IQD..SCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RFL.DVP..LC....KE....DCHQWWEACRT.S.....FTCK...R...DW.....HK.G.WD..........................WSSGI.....NK..CP.N..T..APC........HTFEYYF.PT..PA...S.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
K7F2T8_PELSI/26-195                  ...........................................................VCMDA....KHHKTQ.PGPEG.....ALH.GQ.........................C.AP.WKDN...............................ACCTAQTS.TE.AH...K.DQ.........SY...LY.SFNWHH..C..............G..V.....M...PE..........KCR.QHF...IQD..KCLYECSP.NLGPW....IQQad.......................................ssWRRQ..RIL.HVP..LC....KE....DCEQWWEDCKD.A.....RTCK...E...NW.....HK.G.WN..........................WTTGT.....NR..CP.R..G..SRC........RPFWSVF.PR..PA...D.LC......EKIWSN.SYKYT....QEHR-................------g...............................................................
D7L3W2_ARALL/34-192                  .............................................vciskggrflpyet-----....------.PMPSSl..efKDL.NL.........................C.NV.FHGK...............................TCCSASTM.HS.AS...L.AL.........EN...LA.TY----..-..............G..E.....A...TK..........DCL.DLF...ELL..ECSI-YQP.DVG--....IQS...........................................----..--E.PLR..IC....AS....FCDRVFEACSD.A.....YFRR...N...AS.....-N.Q.VI..........................VPCGA.....SE..G-.-..T..IIC........GKASKWE.SS..GT...A.FC......YAL---.-----....-----................------gftvqtagdlteepcyg...............................................
A0A672FTW5_SALFA/23-192              ...........................................................MCMDA....KHHKVE.PGPEG.....QLY.SQ.........................C.AP.WKDN...............................ACCTANTS.QE.AH...E.DH.........SY...LY.NFNWNH..C..............G..P.....M...RE..........ECK.RHF...IQD..TCFYECSP.HLGPW....IQQvd.......................................qsWRKE..RIL.NVP..LC....KE....DCESWWNDCDG.I.....FFPL...-...--.....--.-.LF..........................FLSDG.....NK..CP.S..E..SKC........RKWTEVF.PT..AK...D.MC......EKIWSN.SYLYT....DLNKT................SGLCMQ................................................................
A0A091M764_CARIC/3-129               ........................................................lsv-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgATPE..REL.TLP.yLC....KD....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A1W0XAM9_HYPDU/75-213              ......................................................fcpff-----....--ENRS.PQSQP.....DLR.N-.........................C.TW.YREK...............................SCCRQAEL.ES.IF...K.KV.........KP...LQ.------..-..............-..G.....A...SE..........NCM.RHL...NYM..ICWV-CDP.MQYNF....YLN...........................................----..GWR.RLK..MC....ES....FCDEVLDACRD.A.....KLKG...D...PV.....--.G.LL..........................YKTGS.....EF..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------rsrrfdvnpdtdkscfsynvkkgrpgd.....................................
A0A452FHW0_CAPHI/30-205              ...........................................................VCMNA....RYHKEK.PGPED.....KLH.GQ.........................C.SP.WKNN...............................ACCFVNTS.IE.AH...K.DI.........SS...LY.RFDWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..ICLYECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.NVP..LC....KE....DCESWWEDCRT.S.....YTCK...S...NW.....HR.G.WD..........................WTSGY.....NQ..CP.V..K..VAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SYRAS....NYSRG................SGRCIQ................................................................
A0A0A0AII1_CHAVO/31-206              ...........................................................ICMDA....KHHKTK.PGPEG.....KLH.DQ.........................C.AP.WKDN...............................ACCTANTS.SE.AH...K.DQ.........SN...LY.NFNWNH..C..............G..V.....M...PP..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQvd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKD.Y.....LTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFSNVF.PR..PK...D.LC......EKIWSN.SYKYT....TEHRG................SGRCIQ................................................................
A0A091IPD0_EGRGA/3-165               ..............................................qcldygppfqppf-----....------.-----.....-HL.EF.........................C.SA.YENF...............................GCCDQQKD.NS.IA...A.KY.........WD...IM.DYIDP-..-..............-..R.....G...HK..........LCG.TYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....FD....YCSEFHFNCRS.A.....ISL-...-...--.....--.-.LT..........................SDKHV.....QE..CC.E..T..NKT........RFCNLLH.LH..DE...D.YCf....pNVLKNT.ALNRNl..gSVVED................RKGCL-q...............................................................
A0A1S3JNN2_LINUN/79-248              ..........................................................k-CLEG....PHHKDK.PSPEG.....DGY.VE.........................C.LS.WKQS...............................SCCLANVT.QE.IA...T.HK.........AK..nLY.NYHWDR..C..............G..T.....L...SQ..........ACE.LYI...KDE..ECFYQCEP.ALVRF....PAA...........................................-KKG..YVK.GIP..IC....AK....YCNDWFEACKN.D.....LTCV...V...DW.....LA.D.FN..........................YTTGE.....NH..CP.T..G..SQC........RTFTEVY.KN..GQ...G.LC......ERMWGE.AFTYE....----T................SNNCM-vmk.............................................................
A0A1D1UEU9_RAMVA/47-164              .......................................................fsif-----....------.-----.....---.--.........................-.--.--QN...............................SCCRQVEL.DA.IF...K.DI.........KP...IL.------..-..............-..G.....A...DE..........KCT.KML...NYM..ICWV-CDP.NQHLF....YSS...........................................----..QRQ.ELT..FC....ES....FCDAILSACQT.A.....I-QK...G...EL.....MA.H.F-..........................YQDGR.....QF..CK.N..-..---........-------.--..--...-.--......------.-----....-----................------hnfhvpesssnetcfpsrtlwqq.........................................
A0A3Q3RTD1_9TELE/33-207              ...........................................................MCMDA....KHHKTE.PGPEG.....QLY.SQ.........................C.AP.WRDN...............................ACCTANTT.EE.AH...N.DN.........SY...LY.SFNWNH..C..............G..V.....M...SP..........ECK.KHF...IQD..TCFYECSP.HLGPW....IQKvd.......................................qnWRKE..RIL.DVP..LC....VE....DCHNWWEDCKN.D.....YTCK...T...NW.....HK.G.WD..........................WSSGD.....CK..NM.Q..T..ETF........FTFSYIT.TE..RN...N.TF......TSICIH.K----....-----................------ktlkfmrntmqhsl..................................................
M3YEQ8_MUSPF/43-111                  ...........................................................ICMDV....KPRKEK.PRPEN.....KLH.K-.........................-.--.-RKN...............................PCCFANIT.WE.AQ...K.GI.........SH...LY.RLNWDH..C..............G..Q.....T...AP..........ACS.T--...---..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------ssrtptsmsap.....................................................
A0A5P1FJZ1_ASPOF/843-993             .................................................ssegkppgka-----....------.-SKGP.....KDL.TL.........................C.RV.FRRS...............................TCCDVSQT.YP.AL...L.SI.........RR...LA.S-----..S..............G..E.....A...SQ..........ECL.DLW...ELL..ECSI-CDP.RVGVL....--P...........................................----..---.GPP.lIC....AS....LCDKVLEACGN.A.....YFSI...D...A-.....--.-.KN..........................QVLSP.....CG..L-.S..D..ILC........GRLNEWA.SN..GT...E.LC......H-----.-----....-----................------lsgfsvkqdgisykgpdepfc...........................................
A0A3Q7R261_VULVU/27-177              ..........................................................a-C---....GGSRPL.PALSR.....RHH.RL.........................A.AD.LGTG...............................QLHLAEMD.TP.EA...S.GP.........GM...VS.----EN..C..............G..E.....P...SP..........GCE.SFL...GHL..QVALHNRF.RLLLL...gIRQ...........................................----..---.AQP..LC....SE....LCDIWFASCES.D.....ITC-...-...--.....GP.T.WL..........................PLLEK.....RG..C-.-..E..PRC........TTYEQTF.AD..GA...D.LC......RSVLGY.ALPVA....--APG................ADHCLN................................................................
A0A5E4EQ94_PRUDU/40-197              .........................................lcidsrapstlssplkfc-----....------.-----.....---.--.........................-.-S.YNET...............................ACCNSTED.LQ.IQ...K.QF.........QT...MN.------..-..............-..I.....S...NS..........GCA.SLL...KSV..LCA-RCDP.FSGEL....FTVdsvprpvp..........................llcnstvsaNSSQ..SIQ.EV-..--....ND....FCSNIWDTCQN.V.....SILN...S...P-.....--.-.FA..........................PSLQG....qAG..VP.V..K..SNV........SELTKLW.QS..KA...D.FC......NAFGG-.-----....-----................------assdgs..........................................................
F4K5P7_ARATH/38-198                  ......................................cvskggrfppyelegkppksv-----....------.-GRGS.....KDL.TL.........................C.RV.FRKK...............................TCCSSVQT.NP.AF...V.AV.........RN...LA.TY----..-..............G..E.....A...SQ..........ECL.ELF...ELL..ECSI-CNP.NVG--....IQP...........................................----..---.GPP.rIC....AS....FCDRVFEACKD.A.....YFAS...N...AL.....--.-.--..........................KRVIG....pCG..VN.D..D..IIC........IKASNWE.SN..GT...S.FC......EAA---.GFAVQ...rNDDSR................EKPCY-g...............................................................
A0A1S4CHA6_TOBAC/41-192              .................................................rfsnegkppk-----....-----K.VKKGP.....RDL.NL.........................C.RI.FRGK...............................TCCDVTQT.HP.AL...L.SI.........RK...LA.S-----..T..............G..E.....A...SQ..........ECL.HLW...EML..ECSI-CDP.RVG--....VQA...........................................----..---.GPP.vLC....TS....FCNKVYQACSN.A.....YFSM...D...AK.....-T.Q.VL..........................AP---.....CG..V-.S..D..FVC........GRASQWI.SN..GT...E.LC......RV-AGF.SVKSL....SDDPE................EVSCY-g...............................................................
A0A669EHM8_ORENI/29-201              .................................................chpqcldykp-----....----PF.EPRQP.....LA-.-F.........................C.KE.YSKF...............................GCCDVEKD.EE.IS...G.RF.........YT..iME.N--FDH..S..............G..-.....-...YA..........ACG.KYV...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.VLP.gLC....GD....YCSDYWRQCRY.T.....LGLL...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------ledvgnsqqfanltatieedhrrfceflvlkdkeycypsvltnaelnanlgllnedpegcle..
G1PPC4_MYOLU/31-206                  ...........................................................ICMNA....KHHKEK.PSPED.....KLH.EQ.........................C.SP.WKKN...............................ACCSVNTS.QE.AH...K.DV.........SY...LY.RFNWDH..C..............G..P.....M...KP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.DVP..LC....KE....DCESWWEDCRT.S.....YTCK...A...NW.....HK.G.WN..........................WTSGS.....NK..CP.V..K..AAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
G5AVT7_HETGA/132-307                 ...........................................................VCMDA....KHHKVK.PGPED.....KLH.EQ.........................C.SP.WKKN...............................SCCYANTS.EE.AH...K.NI.........SN...LY.RFNWNH..C..............G..E.....M...EP..........TCK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.NVP..LC....KE....DCQRWWEDCKT.S.....LTCK...S...NW.....HK.G.WN..........................WEKGY.....NE..CP.T..N..AAC........HPFHFYF.PT..PA...D.LC......QEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A4U1EI22_MONMO/38-213              ...........................................................VCMDA....KHHKIK.PGPED.....KLH.DQ.........................C.IP.WKKN...............................ACCSAKVS.QE.LH...R.DT.........SS...LY.NFNWEH..C..............G..K.....M...KP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.NVP..LC....KE....DCQSWWEDCRT.S.....YTCK...T...NW.....QK.G.WN..........................WTSGS.....NK..CP.T..G..TTC........GTFEFYF.PT..PA...A.LC......EGLWSN.SYKLS....NYSRG................SGRCIQ................................................................
A0A087WWY2_HUMAN/47-129              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCTASTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACS.ATS...S--..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------rtpvsmsahqpgaldpa...............................................
A0A671ETX5_RHIFE/30-205              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.IP.WKEN...............................ACCSVSTS.QE.LH...K.DN.........SL...LY.NFNWEH..C..............G..K.....M...EP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCESWWEDCRT.S.....YTCK...R...NW.....QQ.G.WN..........................WTSGS.....NK..CP.A..K..AVC........RTFESYF.PT..PA...A.MC......EGLWSH.SYKVS....QYSRG................SGRCIQ................................................................
F7AHC3_MONDO/30-205                  ...........................................................TCMEG....KHHKKK.PGPEN.....ELH.EQ.........................C.SP.WKDN...............................ACCTHNTS.WD.TH...L.DV.........SL...LY.NFNFGH..C..............G..V.....M...TP..........SCR.RHF...IQV..ACLYECSP.NLGPW....IQKvs.......................................srLGKE..SVL.NVP..LC....WE....DCTEWWEDCRN.S.....YTCT...S...DW.....YS.G.WD..........................WSTGQ.....SH..CP.S..L..SSC........RPFPHYF.PS..PA...D.LC......EKIWRN.SYKAT....KEHRG................KGHCIQ................................................................
A0A1U8CEV7_MESAU/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RVM.SQlells...............ggeilC.GG.FYPR..............................vSCCLQSDS.PG.LG...R.LE.........NK..iFS.------..-..............S..T.....N...NT..........ECD.RLL...EEI..KCAP-CSP.HSQSL...fCSPe.........................................rEVLD..GDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-L.....LQ.T.TA..........................DEFCF....yYT..RK.D..G..GACf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.EKVEEl..sRKHKH................SCFCVQ................................................................
A0A5J5CTA8_9PERO/28-221              ...........................................................VCLQD....GKHKAT.PGPEP.....QLR.E-.........................C.GL.YADN...............................SCCTEEDI.QD.IS...H.VP.........SE..sNK.NDPWDK..C..............G..P.....L...SS..........TCE.GFL...KRV..SCFYRCSP.DAARW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRT.D.....MTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GTC........VPYQQMY.QH..GR...D.LC......ESLWGD.AFLTV....EDEP-................------edvgeagevgevgevgaggagggggvgggrpcgcl.............................
A0A452DRI5_CAPHI/39-221              ...........................................................RCLNG....NPPKRL.KKKDR.....RMM.SQpells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........SK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAA-CSP.HSQSL...fYSPe.........................................rEALE..RDL.VLP.fLC....KD....YCKEFFYTCRG.H.....IPG-...-...-L.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A341AAB3_NEOAA/30-205              ...........................................................VCMNA....KHHKEK.PGPED.....KLH.EQ.........................C.SP.WKKN...............................ACCSVNTS.QE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...KP..........ACK.HHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.NVP..LC....KE....DCQIWWEDCRT.S.....YTCK...T...NW.....HK.G.WN..........................WTSGY.....NQ..CP.V..R..AAC........HRFDFYF.PT..PA...A.LC......DEIWSH.SYKVS....NYGRG................SGRCIQ................................................................
A0A401RF46_CHIPU/9-170               ................................................qcldykppfkp-----....------.--TKP.....--L.AF.........................C.TA.YSSF...............................GCCDARAD.SS.LA...R.RY.........QH...IV.SYLHP-..-..............-..P.....G...VS..........VCG.KYI...QEL..LC-QKCSP.YAAHL....YDA..........................................eDADT..PVR.VLP.gLC....SD....YCAEFWKRCRS.T.....LSLL...T...GD.....TR.T.VD..........................LETDR....gKF..C-.-..-..---........---SYLE.LQ..DP...D.YCf....pNVLSSE.RLQTN....-----................------lgrvqadaegclq...................................................
A0A2K5RKE5_CEBCA/36-211              ...........................................................VCMDA....KHHKEK.PGPED.....KLH.EQ.........................C.SP.WRKN...............................ACCSTNTS.QE.AH...K.DV.........SY...LY.NFDWNH..C..............G..E.....M...AP..........ACR.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.DVP..LC....KE....DCEQWWKDCST.S.....YTCK...S...NW.....HK.G.WN..........................WTSGS.....NK..CP.V..G..AAC........LSFHFYF.PT..PT...D.LC......NEIWSH.SFKVS....NYRRG................SGRCIQ................................................................
C3Y1A9_BRAFL/34-203                  ..........................................................g-CLQG....EKHKDA.PSPES.....GLG.V-.........................C.KD.YSDS...............................SCCSADIG.QQ.LS...V.TP.........IV..kVD.GFRWDN..C..............G..T.....L...SK..........RCQ.DFM...VNV..ECFYRCSP.SLPTW....AAP...........................................-YPS..AVR.GVP..VC....MQ....FCDDWMEACRE.D.....MTCA...D...NW.....IT.G.WK..........................IEDGE....lNK..CR.S..E..ERC........RTFAQVF.RN..GR...G.LC......ESIWGQ.SFTYE....--STP................DTPCL-d...............................................................
M7B581_CHEMY/56-153                  ...........................................................VCMDA....KHHKTR.PGPEG.....ALH.GQ.........................C.AP.WKDN...............................ACCTAETS.TG.AH...Q.DQ.........SY...LY.SFNWAH..C..............R..V.....M...PD..........KCK.WHF...IQD..TCLYECSP.NLGPW....IHQ...........................................DPRE..PGT.NAQ..LC....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------gm..............................................................
V4KLW5_EUTSA/37-198                  ........................................vcvskggrfqpyesegkpp-----....------.---KSvgrgsKDL.TL.........................C.RV.FRKR...............................TCCSSAQT.NS.AF...V.AV.........RN...LA.TY----..-..............G..E.....A...SQ..........DCL.HLF...ELL..ECSI-CNP.NVG--....IQP...........................................----..---.GPP.rIC....AS....FCNKVFEACKD.A.....YFAS...N...AL.....--.-.-T..........................QMIGP.....CG..VN.D..D..IIC........VKASNWE.SN..GT...A.FC......EAA-GF.SVQTN....-DDSR................EEPC--yg..............................................................
A0A674F4Y9_SALTR/30-191              ..................................................qcldfkppf-----....------.KPQ--.....EDL.QF.........................C.AM.YRNF...............................GCCDSAKD.QE.LM...A.KF.........YK..iVD.NFD---..-..............N..Y.....A...YA..........NCA.GYV...QDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PIR.TLP.gLC....PD....YCSQFWLKCRS.T.....ITLL...S...DD.....LQ.L.AQ..........................AKPDQ....vHF..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------qhleledpdycyphllsnqqltqnlghvradpegclq...........................
J3KR13_HUMAN/3-164                   .....................................................paatev-----....------.-----.....---.-Q.........................C.SP.WKKN...............................ACCTASTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........RTFESYF.PT..PA...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A4X2KWF0_VOMUR/23-198              ...........................................................ICMDA....KHHKKK.PGPEN.....KLH.EQ.........................C.SP.WKDN...............................ACCTANTS.WE.VH...M.DV.........SP...LY.NFNFRH..C..............G..V.....M...TP..........SCR.MHF...IQN..ACLSECSP.NLGPW....IQKvs.......................................ssWQKE..RVL.NVP..LC....WE....DCEEWWEDCRT.S.....YTCK...S...DW.....HR.G.WT..........................WRAGK.....NH..CP.P..R..ALC........RPFPHYF.PS..PA...D.LC......EKIWSN.SYKAT....KERRG................SGRCIQ................................................................
A0A091IFN5_CALAN/21-188              ..........................................................g-CLEG....DTHKPK.PSPEP.....NLH.E-.........................C.TL.YSES...............................SCCYANFT.EQ.LA...H.SP.........VI..kVN.NSYWNR..C..............G..Q.....L...SK..........SCE.DFT...KKI..ECFYRCSP.QASRW....INP...........................................NDAA..AIQ.SVP..LC....QS....FCDDWYEACKD.D.....SICV...H...NW.....LT.D.WE..........................WDESG....eNH..C-.-..K..NKC........TPYSEMY.AN..GT...D.LC......QSMWGE.SFKVR....---ES................SCLCLQ................................................................
A0A2R8ZPX1_PANPA/37-193              ..........................................................a-C---....GGSRPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagPCCPSEMD.TT.ET...S.GP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A1U7UUD1_CARSF/44-206              ..................................................qcldykppf-----....------.QPP--.....LHL.EF.........................C.SD.YESF...............................GCCDQYKD.RR.IA...A.RY.........WD..iME.YFD---..-..............L..K.....S...HE..........LCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPHT..PLR.NLP.gLC....SD....YCSAFHSSCHS.A.....ISLL...T...ND.....-R.G.L-..........................QEFQG.....K-..--.-..-..DGA........RFCHLLN.LP..DK...D.YCf....pN-----.-----....-----................------vlrndylnrnlgvvakdhqgclq.........................................
K8EY55_9CHLO/29-238                  ...........................................................VCHVN....YYHKHV.STPTFm...pSDV.NV.........................C.RE.YQYE...............................ACCSLDTV.RK.VP...T.QM.........IS..dLY.GDEYNHglCvdiv......gggfT..A.....M...ST..........GCQ.AYF...DAE..NCFYECDK.NVGKW....RKHsdcnee...............................dadvsnHNAW..QIE.AMP..IR....AS....TADAMYEACKD.D.....FFPD...S...KG.....MW.G.TEagnwad.............awstrvnVDA--.....NG..VN.T.gT..GTC........KKGSEIW.TN..GQ...D.MV......ENVWGT.AFKYE....SDAT-................------ksyvwgfn........................................................
A0A2I3LU31_PAPAN/26-208              ...........................................................ICMNA....KHHKRV.PGPED.....KLY.EE.........................C.IP.WKDN...............................ACCTLTTS.WE.AH...L.DV.........SP...LY.NFSLFH..C..............G..L.....L...MP..........GCR.KHF...IQA..ICFYECSP.NLGPW....IRPvgslg................................weeapsGQGE..RVV.NAP..LC....QE....DCEEWWEDCRL.S.....YTCK...S...NW.....RG.G.WD..........................WSQGK.....NR..CP.K..G..AQC........LPFSHYF.PT..PA...D.LC......EKTWSN.SFKAS....PERRN................SGRCLQ................................................................
A7SH49_NEMVE/214-341                 ..........................................................y-CP--....YFKNRG.PSRQD.....NLR.N-.........................C.TW.YTEN...............................SCCHDSEI.EF.AF...A.QL.........TP...IP.------..-..............-..K.....A...GE..........SCV.KQL...NYL..YC-YICAP.NQNTF....FRR...........................................----..--S.TLT..VC....EE....FCNRIYSACKK.A.....YLKG...M...MI.....GD.M.--..........................YSNGR.....EF..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------egrrfevsdknskqgcfd..............................................
F2U311_SALR5/18-154                  .........................................yfgnrgteplmrpgigdr-----....------.-----.....-NL.-N.........................C.SW.YHDN...............................ACCRANEV.YD.IF...Q.TQ.........RA...LP.------..-..............-..G.....A...DF..........GCQ.IAM...SRL..MCWV-CDP.DQALF....YYN...........................................----..--E.QLH..IC....QS....MCDYVFAACQD.A.....LFQG...R...TL.....RE.Q.F-..........................---GTs...rAL..C-.-..-..-EA........RRFKVVQ.DG..GD...E.--......------.-----....-----................------acfdgalslt......................................................
E2QXF0_CANLF/3-164                   ......................................................paake-----....------.-----.....---.AQ.........................C.TP.WRKK...............................ACCTVSTS.QE.LH...K.DT.........SR...LY.NFTWDH..C..............S..K.....M...EP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.QVP..LC....RE....DCEQWWQDCRT.S.....YTCK...S...NW.....HR.G.WN..........................WTSGV.....NK..CP.A..R..TTC........RTFEAYF.PT..PA...A.LC......EGIWDH.SYKAT....NYRRG................SGRCIQ................................................................
A0A3M0KM39_HIRRU/35-226              ...........................................................RCLNG....TPPRRL.KKRDR.....RVL.SPeapg................ggeamC.RG.LYPR..............................lSCCSRSEA.QG.LP...H.AE.........AK..vLS.------..-..............V..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETPE..KEL.MLP.yLC....KD....YCKEFYYTCRA.H.....IPVQ...A...GL.....AA.K.TE..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------tcyhgtgavcqreetrewliresgkvefaeggigreiqceeqlaantsgerrkhkhncfciq..
A0A3Q3FCG3_9LABR/28-170              ...........................................................VCLQD....GKHKAT.PGPEP.....HLR.E-.........................C.GL.YADN...............................SCCTDENI.QD.IS...H.VP.........AD..tNK.NEPWDK..C..............G..S.....L...SS..........QCE.GFL...KRV..ACFYRCSP.DAARW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRV.D.....MTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GNC........VQYQQVG.LN..PN...H.--......------.-----....-----................------l...............................................................
A0A5F8ADQ8_MACMU/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
E9PXL5_MOUSE/34-160                  ...........................................................VCMDA....KHHKEK.PGPED.....NLH.DQ.........................C.SP.WKTN...............................SCCSTNTS.QE.AH...K.DI.........SY...LY.RFNWNH..C..............G..T.....M...TS..........ECK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.DVP..LC....KE....DCQQWWEDCQS.S.....FTCK...S...NW.....HK.G.WN..........................W----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------................................................................
A0A4E0RH52_FASHE/63-233              ..........................................................l-CPLG....QNHKSG.PSAEP.....NLT.DI.........................C.YN.WAER...............................SCCTADTM.QK.LY...K.--.........RI...VY.SFDHSH..C.............nR..T.....M...SE..........KCE.AMF...MQD..LCFYQCSP.NLGPW...mIRSe........................................rkIGTE..RMY.AAP..LC....MS....DCNEWWEACRY.D.....MTCV...E...NW.....SY.E.FD..........................WSTGR.....NM..CP.E..G..RDC........LSFEQVY.GN..AS...R.FC......HAVWDG.AWTAT....----N................SSQCL-h...............................................................
A0A091G6J4_9AVES/21-188              ..........................................................g-CLEG....DTHKPK.PSPEP.....DLH.E-.........................C.TL.YSES...............................SCCHADFT.AQ.LA...P.SP.........VI..kVQ.NSYWNR..C..............G..Q.....L...SE..........SCE.DFT...KKI..ECFYRCSP.HAAHW....MHR...........................................NRTA..AVQ.SVP..LC....QS....FCDDWYEACKD.D.....SICV...H...NW.....LT.D.WE..........................WDESG....eNR..C-.-..K..DKC........IPYSKMY.AN..GT...D.MC......QNMWGE.SFKVS....---ES................SCLCLQ................................................................
A0A674F6Y5_SALTR/23-184              ..................................................qcldfkppf-----....------.KPQ--.....EDL.QF.........................C.AM.YRNF...............................GCCDSAKD.QE.LM...A.KF.........YK..iVD.NFD---..-..............N..Y.....A...YA..........NCA.GYV...QDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PIR.TLP.gLC....PD....YCSQFWLKCRS.T.....ITLL...S...DD.....LQ.L.AQ..........................AKPDQ....vHF..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------qhleledpdycyphllsnqqltqnlghvradpegclq...........................
A0A060WNV0_ONCMY/1-143               ..........................................................m-----....------.-----.....---.--.........................-.--.YRNF...............................GCCDSAKD.KE.LM...G.KF.........YK..iMD.NFD---..-..............Y..Y.....G...YA..........SCA.GYV...QDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PIR.TLP.gLC....PD....YCSQFWLKCRS.T.....ITLL...S...DD.....PQ.L.AE..........................AEPDQ....dRF..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------qhleledpdycyphllsneqltqnlgrvradpegclq...........................
A0C2I4_PARTE/29-192                  ................................................ecnfknrivyg-----....------.---QQ.....KLH.HLsg....................iyfC.DS.YAKR...............................TCCSQQNL.EE.LK...F.KW.........YR...--.--EQQQ..A..............V..E.....L...TQ..........QCQ.EIF...IKT..ICSD-CDG.DIG--....-QQ...........................................----..--I.RVG..FC....PK....YCSQMYHACQN.D.....LFQY...D...EK.....TQ.K.--..........................LRLCY.....--..-Q.N..D..VFC........SELRNIV.NS..GD...Q.FC......TSL-GY.K----....-----................------vnsysnidewlenkylnlstnplcw.......................................
A0A2C9VH51_MANES/29-193              .......................................qciskggrfppfstegkppk-----....-----K.VSKGS.....KDL.TL.........................C.RV.FRQK...............................TCCDVAQT.HP.AL...L.SI.........RR...LA.S-----..T..............G..E.....A...SQ..........ECL.QLW...ELL..ECSI-CDP.KIG--....VQP...........................................----..---.GLP.lIC....TS....FCDRVYQACAD.A.....YFSM...D...AK.....-T.Q.VV..........................A-P--.....CG..V-.N..D..FVC........GKASQWV.SN..GT...E.LCl....sAGFTVK.SYEAA....EGGTE................EASC--yg..............................................................
A0A2K6UFL6_SAIBB/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A672HFF0_SALFA/20-181              ................................................qcldfkppfrp-----....------.--PA-.....-PL.QL.........................C.VM.YQDF...............................GCCDQQRD.QQ.LL...R.SF.........QR...VM.----DH..P.............dA..P.....G...DP..........ACA.GYV...LEL..LC-QECSP.YAAHL....FDA..........................................eDPST..PVR.TVP.gLC....PD....YCSEFYRRCRS.A.....LPLL...T...DD.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------rhisrlmdnqtgvcrhlelgdmdycyphllsnqrlnqnlgrvqadsdgclq.............
A0A1S3WI24_ERIEU/4-133               .....................................................ehkifs-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............G..T.....N...NT..........ECG.KLL...EEI..RCAL-CSP.NSQSL....FHSp........................................ekEALE..REL.LFP.lLC....KD....YCKEFFYTCRG.Q.....IAG-...-...-F.....LQ.T.TA..........................DEFCF....yHA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEDY.DKGEEi..sRKHKH................NCFCLQ................................................................
A0A2Y9QCS1_DELLE/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........SK...MF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lLC....KD....YCKEFFYTCRG.H.....VPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2K6LAH7_RHIBE/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A1S3W8Y0_ERIEU/35-149              .............................................qcldygppfrsplp-----....------.-----.....--L.DF.........................C.SD.YESF...............................GCCDQHGD.QR.VA...A.RY.........RD...IM.SYLDP-..-..............-..Q.....G...RE..........LCG.GYI...RDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.SLP.gLC....PD....YCAAFQASCG-.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------paarllaprldga...................................................
A0A5N4DN67_CAMDR/30-205              ...........................................................ICMNA....KHHKEK.PGPED.....KLH.EQ.........................C.SP.WRKK...............................ACCSVNTS.LE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...EP..........SCK.RHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.NVP..LC....KE....DCETWWNDCRT.S.....YTCK...T...NW.....HK.G.WN..........................WSSGY.....NQ..CP.V..D..AVC........HRFDFYF.PT..PA...D.LC......NEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A2P6R7B4_ROSCH/26-188              .........................................vcisqgsrfppfssegkp-----....------.--PKRvskgpKDL.TL.........................C.RV.FRKK...............................TCCDVAQT.HP.AL...L.AI.........RK...LA.L-----..A..............G..E.....A...NS..........ECL.QLW...ELL..ECSI-CDP.RIG--....VQP...........................................----..---.GPP.vIC....AS....FCDRVFSACSG.A.....YYST...-...DA.....IT.Q.VL..........................APCGV.....ND..Y-.-..-..-VC........GRASEWI.LN..GT...E.FC......HAA---.GFAV-....-----................------kgdtsesleetfcyg.................................................
A0A402F1K4_9SAUR/20-181              ...........................................................RCLPG....GKHKAS.PSPEG.....HLG.T-.........................C.NL.YREN...............................ACCSPDVI.LD.LS...K.AN.........DI...--.--YWNR..C..............G..G.....L...SS..........RCE.EYL...QRV..ECFYRCSP.IAAQW....PHP...........................................QRPT..AVL.AVP..LC....QN....FCEQWYDACKE.D.....LTCA...R...NW.....LT.D.WH..........................WGPDG.....NN..C-.-..S..QEC........ISYGQMY.KD..GK...E.LC......ETIWDD.SFVAS....---TD................PCECL-t...............................................................
A0A2U3VBB8_ODORO/31-206              ...........................................................VCMDA....KHHKEK.PSPED.....QLH.KQ.........................C.SP.WKKN...............................SCCFANTS.EE.AH...K.DI.........SY...LY.KFNWDH..C..............G..H.....M...TP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.DVP..LC....KE....DCQQWWEDCRT.S.....YTCK...S...NW.....HR.G.WD..........................WTSGY.....NQ..CP.A..G..AAC........LPFHFYF.PT..SA...A.LC......REIWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A674PBF1_TAKRU/32-191              ................................................qcldfkppfrp-----....------.----M.....KEL.EL.........................C.VM.YKDF...............................GCCDYQKD.QE.LL...L.KF.........YH..vME.HFD---..-..............Y..N.....G...YS..........NCA.GYV...LEL..LC-QECSP.YAAHL....FDT..........................................eDTQT..PVR.TIP.gLC....PD....YCEEFWKKCNS.T.....VPLL...-...--.....--.-.--..........................--LGK.....PH..MG.K..Q..QPA........ERCQDLV.LD..DM...D.YC......------.-----....-----................------yprllsnqklnknlgrvqadgdgclq......................................
A0A445IMT1_GLYSO/40-203              ...............................................vcvsqggrfppf-----....KSEGST.PKKGP.....KDL.TL.........................C.RI.FRKK...............................TCCDVTHT.HP.AL...L.SV.........RK...LA.S-----..T..............G..E.....A...SQ..........ECL.HLW...ELL..ECSI-CDP.RVG--....TQP...........................................----..---.GPP.lIC....AS....LCERIYEACSN.A.....YFSM...-...DV.....KT.Q.IL..........................APCGV.....ND..F-.-..-..-VC........GRAAEWV.SN..GT...D.LC......LAA---.GFRVK....-----................------psesdivhiaseetscyg..............................................
A0A672UF50_STRHB/25-186              ....................................................qcldfkp-----....----PF.RPPRG.....LA-.-F.........................C.RH.YAEF...............................GCCDSRRD.RA.LL...Q.RF.........YR...LS.---ARL..D..............G..P.....T...YA..........ACA.GHL...QDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCLQVWQKCRS.I.....FHYL...S...AD.....QE.L.IA..........................LENNV....aKF..C-.-..-..---........RYLS---.LE..DT...D.YC......------.-----....-----................------fphllanqnlnqnlglvtadaegclq......................................
A0A4S2M3S8_OPIFE/1-147               ..........................................................m-----....------.-----.....---.--.........................-.--.----...............................SCCEHKTM.RS.VQ...-.-D.........SL...LY.GFNHSH..C..............K..P.....M...SQ..........KCI.NMF...KRE..LCFYECSP.HVGPW...lV-Ktq.......................................slRRRE..RSY.LVP..LC....EE....DCNKWYEACKN.E.....ETCV...R...DW.....SV.E.FE..........................WSEVSg...mNV..CP.A..D..SSC........ELFSNVY.KD..AS...D.FC......HAIWDG.GWKVE....-KA--................-PRC--mhfv............................................................
S4REP9_PETMA/28-195                  ..........................................................g-CMAG....SKSKPR.PGPEP.....GLQ.A-.........................C.SQ.YNQN...............................ACCTPESV.RQ.LS...Q.SP.........VV..rVD.ELLWDR..C..............G..N.....L...TP..........SCE.SFL...KRV..ECYSRCSP.LASRW....AHR...........................................AHPS..LLH.HVP..VC....SH....FCDSWFDACRE.D.....FTCV...R...NW.....IY.D.WD..........................WSVEG.....NF..C-.-..P..GAC........VPFSQMF.RD..GR...D.LC......EGFWGL.AL---....-----................------lpvahgvepcis....................................................
Q7ZWL5_XENLA/38-218                  ...........................................................RCLNG....SSPRRV.KKRHR.....KLQ.TLdlgg.................agegC.RG.LYPR..............................lSCCPKTDI.PG.MP...M.DS.........KI...LS.------..-..............V..A.....N...NT..........ECA.KLV...EEI..RCAH-CSP.HAQNL....FHAse.......................................rsETSE..RQL.FLP.vLC....KD....YCKEFYYTCRG.Q.....IPG-...-...-L.....LQ.T.SA..........................DEFCF....yHG..MR.D..S..GLCf.....pdFPRKQMR.GP..AS...N.YL......DQMEDY.DKVEEi..sRKHKH................NCYCIQ................................................................
A0A2K5RJT0_CEBCA/3-164               .....................................................paatev-----....------.-----.....---.-Q.........................C.SP.WRKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWEH..C..............G..R.....M...KP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGI.....NK..CP.A..G..ALC........RTFESYF.PT..PA...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A398AQG5_BRACM/10-157              ...................................................vciskrgr-----....PYELEG.KLPKP.....GDL.NL.........................C.NA.SHDK...............................TCWSASLA.LQ.N-...-.--.........--...--.---LAT..H..............G..E.....A...SK..........DCF.YFY...DLL..ECSI-CHP.DVG--....VQS...........................................----..--E.RLR..IC....AS....FCDRVFEACSD.A.....YFST...S...DA.....SN.Q.VI..........................V-P--.....CG..AS.N..G..IIC........VKVFKWG.TN..GT...S.FC......EAV---.-----....-----................------gftvdqtadvsacyg.................................................
A0A3L8RUH4_CHLGU/28-185              ...........................................................VCMDA....KHHKSE.PGPEG.....RLY.EQ.........................C.SP.WKDN...............................ACCTANTS.LE.AH...K.DQ.........SY...LY.NFNWNH..C..............G..V.....M...PP..........KCK.RHF...IQD..TS------.----W....---...........................................-RRE..RIL.HVP..LC....RE....DCEEWWEDCKD.A.....LTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFSQVF.PR..PK...D.LC......EKIWSN.SFRYS....REPRG................SGRCIQ................................................................
A0A383ZAD1_BALAS/27-177              ..........................................................a-C---....GGSHPL.PVRSQ.....RHH.RL.........................A.TN.LGTS...............................QLHLAEMN.TP.EA...L.DP.........GI...VS.----VR..C..............G..E.....L...SP..........GCE.SFL...EHL..QVALRSRF.HLLLL...gVRQ...........................................----..---.TQP..LC....SE....LCDAWFATCES.D.....IIC-...-...--.....SP.T.WL..........................PLLEK.....RG..C-.-..E..PGC........TTYGQTF.AD..GA...E.LC......RSFLGY.AVPVA....--DPG................SGHCLN................................................................
A0A665U4T8_ECHNA/32-207              ...........................................................MCMDA....KHHKTE.PGPEG.....ELY.LQ.........................C.SP.WRDN...............................ACCTANTS.VE.AH...E.DN.........SY...LY.NFNWNH..C..............G..I.....M...SP..........KCK.KHF...TQD..ACFYECSP.NLGPW....IQQvd.......................................qsWRKE..RII.DVP..LC....ME....DCHDWWEDCKN.D.....YTCK...S...NW.....HK.G.WD..........................WSSGV.....NK..CP.E..G..SRC........RIWTEVY.PT..PK...S.MC......EQIWSS.SYLYT....TLPKS................SGRCMQ................................................................
L8Y6R5_TUPCH/159-321                 ...............................................qcldygppfqpp-----....------.-----.....LHL.EF.........................C.SD.YESF...............................GCCDQHKD.ER.IA...A.RY.........WD...IM.DYFD--..-..............L..K.....G...HE..........LCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCYAFHSNCHS.A.....ISLL...T...ND.....-R.G.LQ..........................ESQGK.....DG..S-.-..-..---........RFCHLLN.LP..DK...D.YCf....pN-----.-----....-----................------vlrndhlnrnlgvvaedhqgclq.........................................
A0A099YTJ8_TINGU/21-188              ..........................................................s-CLDG....ETHKLN.GKEN-.....PYC.TI.........................F.VS.FLTA...............................SCCYANFT.EQ.LA...H.SP.........VI..kIN.NSYWNR..C..............G..Q.....L...SK..........SCE.DFT...KKI..ECFYRCSP.HAARW....IHP...........................................NYSA..AIR.SVP..LC....QS....FCDDWYEACKD.D.....SICV...R...NW.....LT.D.WE..........................WDESG....vNH..C-.-..K..NKC........VPYSEVY.AN..GT...D.MC......QSMWGE.SFKVS....---ES................SCLCLQ................................................................
F6TB36_CIOIN/101-235                 ...........................................................YCADG....KYPQEV.KLSTE.....NHG.VM.........................CgKE.YPTL...............................SCCSQHDL.TM.EL...F.GA.........RL...VE.N-----..-..............-..I.....P...EV..........NCA.KLL...MKL..RCAH-CSP.RSWWL....FHAp........................................dkMTPP..HKR.MVP.iLC....PK....FCRQFHQACRE.T.....VAG-...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------lqmenycdyhttdeegpcfpdyevr.......................................
A0A384DKN2_URSMA/2-161               .........................................................vf-----....------.-----.....--P.TQ.........................C.TP.WKEK...............................ACCSASTS.QE.LH...K.DI.........SL...LY.NFTWDH..C..............G..K.....M...EP..........ACR.RHF...IQD..NCLYECSP.NLGPW....IREvn.......................................qsWRRE..RFL.HVP..LC....KE....DCQRWWEDCRT.S.....YTCK...A...NW.....HR.G.WD..........................WTSGI.....NK..CP.A..K..TTC........RTFEAYF.PT..PA...A.LC......EGLWSH.SYQAS....NYSRG................SGRCIQ................................................................
A0A452GAF9_CAPHI/26-201              ...........................................................VCMNA....KPHKPE.PSPEA.....ELY.EE.........................C.IP.WKDN...............................ACCTASTS.WE.AH...L.DV.........SL...LY.NFSLVH..C..............G..L.....M...MP..........DCQ.RHF...LQA..ICFYQCSP.NLGPW....IQKvg.......................................phWQAE..RVL.DAP..LC....LE....DCERWWADCRT.S.....HTCK...S...DW.....LG.S.WA..........................WSRGK.....PR..CP.E..R..APC........RPFPHYF.PT..PA...D.LC......ERIWSG.SFRAS....PERRG................SGRCLQ................................................................
R0LWV5_ANAPL/5-131                   ........................................................lsv-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETSE..REL.TLP.yLC....KD....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A2U9B5E4_SCOMX/23-198              ...........................................................MCMDG....KHHKVE.PGREG.....DLY.KQ.........................C.SP.WRDN...............................ACCTANTS.TE.AH...N.DN.........SY...LY.NFNWDH..C..............G..A.....M...SP..........KCK.NHF...IQD..TCFYECSP.HLGPW....IQKvd.......................................qsWRRE..RIV.NVP..LC....ME....DCHDWWEDCKN.D.....TTCK...T...DW.....HT.G.WD..........................WSSGN.....NK..CP.E..G..SKC........SKWTDVF.PT..PK...S.MC......EQIWSN.SYLYT....TDSKT................SGRCMQ................................................................
A0A096MER3_POEFO/51-213              ................................................qcldfeppfkp-----....------.---Q-.....WHL.EF.........................C.SQ.YEQF...............................GCCDQRTD.NV.IA...E.RY.........WD..vIE.QLE---..-..............T..A.....G...YD..........LCE.DML...KEI..MC-QECSP.YAAHL....YDA..........................................eDPYT..PVR.DLP.gLC....FG....YCSEFHRKCRH.V.....LRYL...T...D-.....-N.Q.LL..........................LDTSG.....RD..M-.-..A..TFC........SLVD---.LS..DQ...D.YCy....pRVLKST.DLNSNl..gQVVED................PKGCL-q...............................................................
A0A2Y9M7R2_DELLE/26-201              ...........................................................ICVNA....KPHKPA.PSPEA.....KLH.EE.........................C.IP.WKDN...............................ACCTANTS.WE.AH...L.DV.........SL...LY.NFSLVH..C..............G..L.....M...MP..........DCQ.KHF...LQA..ICFYECSP.NLGPW....IQRld.......................................prGQAE..RIL.DAP..LC....RE....DCEQWWADCRT.S.....YTCK...S...NW.....HG.G.WT..........................WSRGK.....PR..CP.A..R..ALC........HPFLHYF.PT..PA...D.LC......EKIWSN.SFKAS....PEHRT................SGRCLQ................................................................
W5P256_SHEEP/30-205                  ...........................................................VCMNA....RYHKEK.PGPED.....KLH.GQ.........................C.SP.WKNN...............................ACCFVNTS.IE.AH...K.DI.........SS...LY.RFDWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..ICLYECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.NVP..LC....KE....DCESWWEDCRT.S.....YTCK...S...NW.....HR.G.WD..........................WTSGY.....NQ..CP.V..K..VAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SYRAS....NYSRG................SGRCIQ................................................................
A0A0L0DUQ8_THETB/85-215              ..........................................................g-CAPD....SSHSEP.FKPRR.....KL-.SF.........................C.KE.FSQF...............................GCCDAKDA.KA.IK...A.TV.........DE...LV.---DPK..C..............-..-.....-...-S..........ACH.AII...AQM..KC-SECHP.EAGKF....WLE...........................................----..RFS.SVR..LC....AG....FCRSLFALCAD.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------iplfrdarnddgtsaamfinggdidvdtfcephva.............................
A0A673Y458_SALTR/33-194              ..........................................................q-CL--....DYKPPF.QPREP.....LVF.--.........................C.KE.YAKF...............................GCCDLEKD.DK.IS...Q.NF.........YK...IM.DY-FDY..S..............G..Y.....-...-M..........TCA.KYI...RTI..LC-QECSP.YSAHL....YDA..........................................eDANT..PMR.ELP.gLC....GD....YCSEFWHQCRY.T.....ISLL...T...DN.....NA.T.LG..........................IEEDR....nKF..C-.-..-..---........NF---LE.LK..DR...E.YC......------.-----....-----................------ypnvlsddklnanlgdvradpegclq......................................
A0A673UM86_SURSU/32-103              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.TP.WKKS...............................ACCSLNTS.QQ.LH...Q.DP.........SL...LY.NFNLDH..C..............G..K.....M...EP..........ACR.RHF...SC-..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------lmndf...........................................................
A0A498MI10_LABRO/33-194              ..........................................................q-CL--....DYKPPF.QPPEP.....LLF.--.........................C.KE.YAKF...............................GCCDLDRD.NQ.IS...Q.RF.........YQ...IM.DY-FDH..T..............G..F.....M...--..........ACG.KYI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.ELP.gLC....GN....YCNDFWLHCRY.T.....LSLL...I...NN.....NE.T.YG..........................IEEDQ....sKF..C-.-..-..---........---K---.--..--...-.--......------.-----....-----................------ylelkdpeycypnvlsnddlnanlgdvkadpqgciq............................
A0A3Q7WLE2_URSAR/30-205              ...........................................................VCMDA....KHHKAK.PGPED.....KLH.DQ.........................C.TP.WKEK...............................ACCSASTS.QE.LH...K.DI.........SL...LY.NFTWDH..C..............G..K.....M...EP..........ACR.RHF...IQD..NCLYECSP.NLGPW....IREvn.......................................qsWRRE..RFL.HVP..LC....KE....DCQRWWEDCRT.S.....YTCK...A...NW.....HR.G.WD..........................WTSGI.....NK..CP.A..K..TTC........RTFEAYF.PT..PA...A.LC......EGLWSH.SYQAS....NYSRG................SGRCIQ................................................................
A0A2Y9T990_PHYMC/26-210              ...........................................................ICMNA....KPHKPE.PSPEA.....KLY.EE.........................C.IP.WKDS...............................ACCTANTS.WE.AH...L.DV.........SL...LY.NFSLVH..C..............G..L.....M...MP..........DCQ.KHF...LQA..ICFYECSP.NLGPW....IQRvgrsgr..............................gweldprGQAE..RIL.DAP..LC....RE....DCEQWWADCRT.S.....YTCK...S...NW.....HG.G.WT..........................WRRGK.....PR..CP.A..R..ALC........HPFLHYF.PT..PA...D.LC......EKIWSN.SFKAS....PEHRT................SGRCLQ................................................................
J3LEC8_ORYBR/50-202                  .............................................fssegkppgraakg-----....------.----R.....RDL.AL.........................C.RI.FRQK...............................TCCDVSQT.FS.AL...L.SV.........RK...LA.S-----..T..............G..E.....G...SQ..........ECL.HLW...ELL..ECSV-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFKACSE.A.....YFAI...-...DV.....KS.Q.A-..........................LSP--.....CG..L-.G..D..ILC........GKAHKWV.SN..GT...E.LC......HSA---.G----....-----................------fsvqaseinsggvddtfcy.............................................
A0A1S2XY02_CICAR/50-210              .........................................vcvsqggrfppfkseglp-----....------.PKSGP.....KDL.TL.........................C.RV.FRKK...............................TCCDVSHT.HP.AL...L.SV.........RK...LA.S-----..A..............G..E.....A...SQ..........ECL.HLW...ELL..ECAI-CDP.HMG--....TRP...........................................----..---.GPP.lIC....ES....LCERIYDACSN.A.....YFSM...-...DV.....KT.Q.ML..........................APCGG.....ND..F-.-..-..-VC........GRAAEWV.SN..GT...D.LC......LAA---.-----....-----................------gfrvkqsdvidiaseeifcy............................................
A0A059B6W0_EUCGR/107-259             ................................................asegkppgkvg-----....------.--RGS.....KGL.TL.........................C.RV.FRKK...............................TCCDVSQT.HP.AL...I.AT.........RR...LT.L-----..K..............G..E.....A...SE..........ECV.QLW...ELL..ECSI-CDP.NVG--....VQP...........................................----..---.GPP.lIC....AS....LCDKIFQACSN.A.....YFSM...D...PK.....-T.Q.VL..........................APCGV.....NE..V-.-..-..-IC........ARASECV.SN..GT...E.LC......LAA---.-----....-----................------gfsvkldddryvgseeahcyg...........................................
A0A1S3JEV8_LINUN/34-211              ...................................................mcvilpme-----....GASKTA.PSPEP.....DLE.--.........................C.PS.FREK...............................SCCNTNVT.AD.FL...E.NH.........VW...GT.VVNYVH..Cp...........ekP..R.....L...SP..........KCE.RLT...HQE..MCFFACSP.NLGPW....IAKpy.......................................kyPDIN..HLD.QAP..IC....AS....QCKKWWNACKE.E.....YTCH...K...DW.....IA.D.MD..........................WNVPE....iNS..CK.E..G..SVC........RKYKEFY.SS..AT...D.FC......NTIWHG.AYKVV....---PD................SEPCM-v...............................................................
G3T5H0_LOXAF/38-220                  ...........................................................RCLNG....NPPRRL.KRRDR.....RMM.PQldlls...............ggemlC.GA.FYPR..............................lSCCLRSDS.PG.LG...R.VD.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEV..KCAH-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKAEEi..sRKHKH................NCFCIQ................................................................
A0A090N3T5_OSTTA/66-215              ..........................................tckskraheafaregsa-----....------.PGRG-.....KGM.TF.........................C.DA.HRAK...............................TCCGRAQT.DA.VR...A.KV.........VH...MQ.------..L..............N..G.....F...SE..........TCR.DAW...AAV..ECSV-CDG.RVGTA....--D...........................................----..---.GTP..IC....AS....ACDALYGACRN.D.....FFSE...D...GA.....QR.L.VP..........................CRPGD.....VI..C-.-..T..KLS........EWIGDVK.DK..GA...E.MC......SA----.-----....-----................------agwdpvkpger.....................................................
M3W3V7_FELCA/43-194                  ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.TP.WRKN...............................ACCSHNTS.QE.LH...K.DP.........SL...LY.NFNLDH..C..............G..K.....I...EP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IQE...........................................LAQG..RFL.DVP..LC....KE....DCQQWWEDCRT.S.....YTCK...S...NW.....HK.G.WD..........................WSSGE....gLG..VN.-..-..---........-------.--..--...-.--......------.-----....-----................------ysrgsgrciqmwfdpaqgnp............................................
HHIP_HUMAN/38-220                    ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
#=GR HHIP_HUMAN/38-220         SS    ...........................................................XXXXX....XXXXXX.XXXXX.....XXX.XXXXXXX...............XXXXXX.XX.XXXX..............................XXXXXXXXX.XX.XX...X.XX.........XX...XX.X-----..-..............X..X.....X...XX..........XXX.XXX...XXX..XXXX-XXX.XXXXX....XXXX........................................XXXXXX..XXX.XXX.XXX....XX....XXXXXXXXXXX.X.....XXX-...-...-X.....XX.X.XX..........................XXXXX....XXX..XX.X..X..XXXX.....XXXXXXXXX.XX..XX...X.XX......XXXXXX.XXXXXX..XXXXX-................-BBEEE................................................................
A0A3P8UW36_CYNSE/30-191              ................................................qcldfkppfka-----....------.----H.....KQL.EF.........................C.AM.YKDF...............................GCCDYHRD.QQ.LM...T.EF.........YR..iMN.NFD---..-..............Y..Y.....G...HA..........NCA.GFV...MEL..LC-QECSP.YAAHL....FDA..........................................eDPST..PLR.SIP.gLC....PD....YCFKFWDRCKE.T.....IPLL...S...ED.....--.-.--..........................--SFI.....SK..I-.K..V..NRT........DFCQHVE.PD..DM...D.YCy....pHLLSNQ.NLNMNl..gKVQSN................SDGCLQ................................................................
A0A673W9H9_SALTR/33-194              ..........................................................q-CL--....DYKPPF.QPREP.....LVF.--.........................C.KE.YAKF...............................GCCDLEKD.DK.IS...Q.NF.........YK...IM.DY-FDY..-..............-..S.....G...YV..........TCA.KYI...RTI..LC-QECSP.YSAHL....YDA..........................................eDANT..PMR.ELP.gLC....GD....YCSEFWHQCRY.T.....ISLL...T...DN.....NA.T.AG..........................IEEDR....nKF..C-.-..-..---........N---FLE.LK..DR...E.YC......------.-----....-----................------ypnvlsddklnanlgdvradpegclq......................................
M3XV43_MUSPF/2-158                   ..................................................rppfrppqp-----....------.-----.....--L.RF.........................C.AQ.YSAF...............................GCCTPEQD.AA.LA...G.RF.........GA...LAaRV----..D..............A..A.....E...WA..........ACA.GYA...LDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRG.L.....FRHL...S...PD.....RE.L.WA..........................LEGNR....aKF..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------rylslddvdycfpyllvnenlnsnlgrvvadakgclq...........................
A0A6J3QVW0_TURTR/31-192              ......................................................qcldf-----....--RPPF.RPPQP.....LR-.-F.........................C.AQ.YSAF...............................GCCAPEHD.AA.LA...R.RF.........GA..lAA.RV----..D..............A..A.....I...WA..........ECA.GYA...LDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDLWQSCRG.L.....FRHL...S...PD.....RE.L.WT..........................LEGNR....aKF..--.-..-..--C........RYLS---.LD..DT...D.YCf....pHLLVNE.NLNSNl..gRVVAD................AMGCL-q...............................................................
A0A3Q3KT30_9TELE/57-219              ..............................................qcldfeppfklqw-----....------.-----.....-HL.EF.........................C.TQ.YEQF...............................GCCDQKTD.NM.IA...E.RY.........WG..iID.QLE---..-..............A..A.....G...YE..........LCL.DML...KEI..LC-QECSP.YAAHL....YDA..........................................eDPYT..PVR.EIP.gLC....FG....YCSEFHGKCQH.V.....VKYL...T...--.....EN.K.LL..........................LDSSE.....KD..V-.-..S..TFC........RMVDL--.-S..DQ...D.YCy....pNVLESP.DLNSNl..gQVLKD................PRGCLQ................................................................
A0A1U8BVG3_MESAU/28-189              ........................................................qcl-----....DFRPPF.RPPQP.....LSF.--.........................C.VQ.YSSF...............................GCCTAEQD.AA.LA...R.RF.........RA...LE.T---RL..D..............A..G.....M...WA..........TCA.GYA...LDL..LC-QECSP.YAAHL....YDA..........................................eDPAT..PLR.TVP.gLC....ED....YCLDMWQTCRG.L.....FRHL...S...PD.....RE.L.WA..........................LESNR.....AK..L-.-..-..--C........RYLS---.LD..DT...D.YCf....pSLLVNE.NLNSNl..gRVVAD................AKGCLQ................................................................
A0A2I2YAE8_GORGO/47-123              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCTASTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.---...---..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------pdchppqslqgdgcq.................................................
L8IR26_9CETA/35-210                  ...........................................................VCMDA....KHHKAE.PGPED.....SLH.EQ.........................C.SP.WRKN...............................ACCSVNTS.IE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IREvn.......................................qrWRKE..RVL.GVP..LC....KE....DCQSWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGY.....NQ..GP.V..K..AAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A091QH79_LEPDC/21-188              ..........................................................g-CLEG....DTHKLK.PSPEP.....NMH.E-.........................C.TL.YSKS...............................SCCYADFT.EQ.LA...H.SP.........VI..kVN.NSYWNR..C..............G..Q.....L...SK..........SCE.DFT...KKI..ECFYRCSP.HAARW....IHP...........................................NYTA..AIQ.SVP..LC....QS....FCDEWYEACKG.D.....STCV...R...NW.....LM.D.WE..........................WDESG....eNR..C-.-..K..NKC........IPYSEMY.AN..GT...D.MC......QNMWGE.SFKVS....---ET................SCLCLQ................................................................
A0A1U7SJ35_ALLSI/26-201              ...........................................................VCMDA....KHHKTK.PGPEG.....ELH.NQ.........................C.TP.WKDN...............................ACCTANTS.ME.AH...K.DQ.........SY...LY.SFNWNH..C..............G..G.....M...KD..........KCK.RHF...IQD..TCFYECSP.NLGPW....IVQtd.......................................tsWRRE..RIM.DVP..LC....KE....DCDQWWNDCQD.S.....FTCK...E...NW.....HK.G.WN..........................WTTGS.....NQ..CP.R..G..SEC........RPFKTVF.PQ..PA...D.LC......EKLWSR.SYKYT....TESQG................SGRCMQ................................................................
A0A2K5U042_MACFA/3-164               ......................................................paame-----....------.-----.....---.VQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........LTFESYF.PT..PV...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3Q0FMJ2_ALLSI/1-118               ..........................................................m-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETSE..REL.VLP.yLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A0P7UWH9_SCLFO/36-215              ...........................................................RCFDG....SLPKRL.KKRER.....RVS.LDggg..................spevC.HA.LYPR..............................vSCCPTRKA.AY.QI...L.QR.........RD...TR.IF----..-..............S..T.....N...NT..........ECG.RLL...EEI..KCA-RCSP.HSQVL....FHPpt.......................................teDASH..HES.GLP.rLC....HD....YCREFYYTCRG.H.....VPEL...-...-F.....QA.D.V-..........................DEFCQ....yYG..RR.D..S..GLCf.....pdFHRKQTR.GP..AT...N.YL......DLEDEN.MENIN....RKHKH................NCYCV-r...............................................................
A0A2I0LYY8_COLLI/21-188              ..........................................................g-CLEG....DTHKLE.PSPEP.....KMH.E-.........................C.TL.YFKX...............................SCCYADFT.EQ.LA...H.SP.........VI..kVN.NSYWNR..C..............G..Q.....L...SK..........SCE.DFT...KKI..ECFYRCSP.HAAHW....INR...........................................NNTA..AIQ.SVP..LC....QS....FCDDWYEACKD.D.....STCV...R...NW.....LT.D.WE..........................WDESG....eNI..C-.-..K..NKC........IPYSEMY.AN..GT...D.MC......QSMWGQ.SFKVS....---ES................SCLCLQ................................................................
A0A4W2CG07_BOBOX/35-210              ...........................................................VCMDA....KHHKAE.PGPED.....SLH.EQ.........................C.SP.WRKN...............................ACCSVNTS.IE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IREvn.......................................qsWRKE..RIL.NVP..LC....KE....DCQSWWEDCRT.S.....YTCK...S...NW.....HR.G.WD..........................WTSGY.....NQ..CP.V..K..AAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SYKAS....NYSRG................SGRCIQ................................................................
A0A212D153_CEREH/27-147              ..........................................................a-C---....GGSHPL.PARSK.....RHH.RL.........................A.TN.LGTD...............................QLHLEEMN.PP.EA...S.DP.........GL...VP.----VR..C..............E..E.....L...SP..........RCE.SFL...VHL..QAALRSRF.HLLLL...gVRQ...........................................----..---.TQP..LC....SE....LCDAWFATCES.D.....ITC-...-...--.....SP.T.WL..........................PLLEK.....RG..C-.-..E..PGC........TTY----.--..--...-.--......------.-----....-----................------g...............................................................
A0A0G4E8A7_VITBC/54-214              ..................................................lcsksmdfa-----....---LDV.PRDRR.....GLL.SF.........................C.PE.HEAR...............................TCCQRIHT.DR.IL...S.KL.........VA..aF-.----GD..E..............G..T.....A...SD..........LCK.DAT...SRV..WCAV-CDG.DVGTE....VKT...........................................----..-RN.RVP.lLC....AS....LCDEWYTSCRD.D.....YFSP...A...P-.....--.S.GS..........................AEKLM.....PC..GP.H..H..SVC........SPLQEIT.ST..SD...D.FCr....lSGFEVH.-----....-----................------ssrvrdedsilaal..................................................
F0VK40_NEOCL/2-90                    ........................................................trk-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................----..---.NTP.lLC....RS....FCEQWYKACEN.D.....YFAP...A...PS.....GS.P.LA..........................LTF--.....-C..SP.D..S..VIC........SPLRDVA.AD..GA...A.LC......TKL---.-----....-----................------gfevagfptegdgeerdeeedatqcy......................................
A0A3P8TN64_AMPPE/23-198              ...........................................................MCMDA....KHHKEE.PGPEG.....QLY.LQ.........................C.AP.WRDN...............................ACCKANTT.EE.AH...N.DN.........SY...LY.NFNWNH..C..............G..A.....M...SP..........QCK.KHF...VQD..TCFYECSP.HLGPW....IQLad.......................................esWRKE..RIL.DVP..LC....KE....DCESWWEDCKN.D.....FTCK...T...NW.....HK.G.WD..........................WSSGV.....NR..CP.A..N..TKC........QKWTEVF.PT..PK...S.MC......EQIWSN.SYLYT....TLTKD................SGHCMQ................................................................
A0A2K5J2T1_COLAP/37-193              ..........................................................a-C---....GGSHPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagTCCPSEMD.TT.EI...S.GP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFTNCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A4W2C248_BOBOX/39-221              ...........................................................RCLNG....NPPKRL.KKKDR.....RMM.SQpells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........SK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAV-CSP.HSQSL...fYSPe.........................................rEALE..RDL.VLP.lLC....KD....YCTEFFYTCRG.H.....IPG-...-...-L.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
V4TAS2_9ROSI/29-191                  .............................................vcvsqggrfapfss-----....----EG.KPPERaskgrSDL.TL.........................C.RV.FRKK...............................TCCDTAQT.HP.AL...L.SI.........RK...LA.S-----..T..............G..E.....A...SQ..........ECL.HLW...ELL..ECSI-CDP.NVG--....VQP...........................................----..---.GPP.lIC....AS....FCERVYQACSN.A.....YFSM...D...A-.....KT.Q.VL..........................APCGV.....ND..F-.-..-..-VC........GRAAEWV.SN..GT...E.LC......HAA---.-----....-----................------gfavklpddryidgeetsc.............................................
A0A0D3AFH3_BRAOL/41-180              ........................................................vcv-----....-ISKKG.KLPKP.....GDL.NM.........................C.NA.FHGK...............................TRCSASRM.LS.AS...L.AL.........QN...LA.TH----..-..............G..E.....A...SK..........DCL.YLF...ELL..ECS-----.DVGP-....---...........................................----..---.-LR..IC....AS....FCDRVFEACSD.A.....YFST...S...GA.....--.-.-S..........................NQVMV....pCG..AS.N..G..IIC........VKVSKWG.TN..GT...A.FC......EAVGFT.VVQ--....-----................------taddsacyg.......................................................
U3DHV8_CALJA/30-205                  ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WRKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..R.....M...EP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........RTFESYF.PT..PA...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
D2H3P9_AILME/38-220                  ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggeilC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................EEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCLQ................................................................
A0A2Y9KWZ6_ENHLU/36-216              ...........................................................ICMDA....KHHKTK.PGPED.....KLH.GQ.........................C.TP.WKEK...............................ACCSVSTS.QE.LH...K.DT.........SL...LY.NFTWEH..C..............G..K.....M...EP..........ACK.RHF...IQD..NCLYECSP.NLGPW....TQEvn.......................................qsWRKE..RFL.HVP..LC....KE....DCQQWWEDCRT.StpartYTCK...N...NW.....HR.G.WD..........................WTSGI.....NK..CP.A..G..TTC........RTFETYF.PT..PA...A.LC......EGLWSH.SYQAS....NYSRG................SGRCIQ................................................................
S7MV48_MYOBR/254-429                 ...........................................................VCMDA....KHHKTK.PGPED.....KLH.GQ.........................C.TP.WRKN...............................ACCSVSTS.QE.LH...K.DT.........SL...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvn.......................................dsWRRE..RFR.NVP..LC....KE....DCESWWEDCRT.S.....YTCK...S...DW.....HK.G.WN..........................WTSGS.....NK..CP.A..E..AVC........RTFESYF.PT..PA...A.LC......EGLWSH.SYQVS....QYSRG................SGRCIQ................................................................
A0A673CFT2_9TELE/48-210              ................................................qcldfeppfqp-----....------.--PW-.....-HL.EF.........................C.TQ.YQDF...............................GCCDQRTD.NT.IA...E.RY.........WD..iID.LLE---..-..............A..Q.....G...QE..........LCA.DTL...KEI..MC-QECSP.YAAHL....YDA..........................................eDPYT..PVR.ELP.gLC....LN....FCSEFHSKCRH.V.....LKYL...T...D-.....-N.R.LL..........................QDTCD.....RD..M-.-..S..TFC........SMVD---.LS..DQ...D.YCy....pNVLKTS.DLNGKl..gRVAED................PGGCL-q...............................................................
A0A2I0LJU9_COLLI/25-165              ...........................................................VCMDA....KHHKTE.PGPEG.....QLY.GQ.........................C.SP.WRDN...............................ACCTANTS.LE.AH...R.DQ.........SY...LY.NFNWDH..C..............G..A.....M...SP..........KCK.RHF...IQD..TCLYECDP.NLGPW....IDQsd.......................................tsWRRE..RIL.HVP..LC....RE....DCEQWWDDCQD.S.....ATCK...V...NW.....HK.G.WN..........................WTSGQ.....RG..A-.-..-..---........-------.--..--...-.--......------.-----....-----................------rghphlg.........................................................
A0A0P1A6E2_PLAHL/31-166              ..............................................tcrsagilkfdps-----....----TR.PIQHR.....KRL.EV.........................C.SK.FQKR...............................TCCNATHT.VA.LR...L.KI.........RE..pVV.------..-..............A..K.....F...SR..........KCQ.ELT...EEM..ICSS-CHP.LMGTW...eMK-...........................................----..---.--N..VC....PS....LCNDWFDVCKD.E.....YYAH...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------ggsssltpcygnalvcsplnelnvngiecfdgsv..............................
A0A2I3SDD1_PANTR/59-197              ..........................................................a-C---....GGSRPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagPCCPSEMD.TT.ET...S.GP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQAG.--..--...-.--......------.-----....-----................------vqwrdlssm.......................................................
A0A484GFR9_SOUCH/28-205              ...........................................................ICMNA....KPHKPA.PSPEA.....KLY.EE.........................C.IP.WKDS...............................ACCTANTS.WE.AH...L.DV.........SL...LY.NFSLVH..C..............G..L.....M...MP..........DCQ.KHF...LQA..ICFYECSP.NLGPW....IQRvgr.....................................sgwGWAE..RIL.DAP..LC....RE....DCEQWWADCRT.S.....YTCK...S...NW.....HG.G.WT..........................WSRGK.....PR..CP.A..R..ALC........HPFLHYF.PT..PA...D.LC......EKIWSN.SFKAS....PEHRT................SGRCLQ................................................................
A0A0E0CMR1_9ORYZ/49-201              .............................................fssegkrpgraakg-----....------.----R.....RDL.AL.........................C.RV.FRQN...............................TCCDVSQT.FS.AL...L.SV.........RK...LA.S-----..T..............G..E.....G...SQ..........ECL.HLW...ELL..ECSI-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFKACSE.A.....YFAI...-...D-.....VK.T.QA..........................LSPCG.....--..L-.G..D..ILC........GKAHKWV.SN..GT...E.LC......RSA---.-----....-----................------gfsvqalestsggvddtfcy............................................
A0A091WNI0_OPIHO/3-129               ........................................................lsv-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETPE..REL.TLP.yLC....KD....YCKEFYYTCRG.H.....VPG-...-...-F.....LQ.T.TA..........................DELCF....yYS..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A5N6PRC6_9ASTR/46-195              ...............................................ysiqgkpprrvs-----....------.--KGP.....TDL.TL.........................C.RV.FRKN...............................TCCDVTQT.HP.AL...L.AI.........RR...LA.S-----..S..............G..E.....A...TD..........ECL.HLW...ELL..ECSI-CDP.HVG--....VQS...........................................----..---.GSP.vIC....AS....LCDRIYDACSS.A.....YFAM...-...--.....-D.G.KN..........................Q-VLV.....PC..GN.S..D..TVC........GRASEWV.SN..GT...E.LC......RAS---.-----....-----................------gfsvkpsndfketfcyg...............................................
A0A1U7RC80_MESAU/26-200              ...........................................................VCMKA....KHHKQE.PGPED.....KLF.LE.........................C.SP.WKDN...............................ACCTFSTS.WE.AH...L.DE.........LS...SF.NFSMMH..C..............G..L.....L...TP..........GCH.KHF...IQA..VCLHECSP.NLGPW....IQLvv.......................................pnRQEE..RVW.RVP..LC....WE....DCEEWWEDCSS.S.....YTCK...S...DW.....LS.G.P-..........................DSSRE.....KS..CP.V..P..APC........RPFSDYF.PT..PA...D.LC......EKIWSN.TFKAS....PERRN................SGRCLQ................................................................
A0A1D1UWU8_RAMVA/1-120               ........................................................mqp-----....------.-----.....-DL.RN.........................C.TW.YRER...............................SCCRQAEL.ES.IF...K.KV.........KP...LQ.------..-..............-..G.....A...SE..........NCM.RHL...NYM..ICWV-CDP.LQYNF....YSN...........................................----..GWR.RLK..MC....AS....FCDAVLNACKD.A.....KLKG...-...-D.....YV.G.VL..........................YPTGA.....EF..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------ksrrfdvalndkdcfsyng.............................................
A0A2K5PVM9_CEBCA/26-208              ...........................................................TCMDA....KHHKGR.PGPED.....KLY.DE.........................C.IP.WKDN...............................ACCTFRTS.WE.AH...L.DV.........SP...LY.NFSLFH..C..............G..L.....L...MP..........GCR.KHF...IQA..ICFYECSP.NLGPW....IRPvgslg................................weaapsGQGE..RVV.NAP..LC....QE....DCGEWWEDCRT.S.....YTCK...S...NW.....RG.G.WD..........................WSQGK.....NR..CP.K..G..AQC........LPFSHYF.PT..PA...D.LC......EKTWSN.SFKAS....PERRN................SGRCLQ................................................................
A0A3Q4MBA7_NEOBR/4-188               ..................................ccsikkfkllkimpncktlsnktsv-----....------.-----.....TLL.CF.........................C.SP.WRDN...............................ACCTANTS.AE.AH...D.DA.........SY...LY.NFNWNH..C..............G..I.....M...SK..........ECK.KHF...IQD..TCFYECSP.HLGPW....IQPvd.......................................qsWRKE..RIL.DVP..LC....KE....DCETWWEDCKN.D.....ITCK...D...NW.....HK.G.WD..........................WSSGI.....NK..CP.E..G..SKC........SKWTDFF.PT..PK...S.MC......EKIWSN.SYIYT....TYTKT................SGKCMQ................................................................
A0A2K6RR38_RHIRO/3-164               ......................................................paame-----....------.-----.....---.VQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.HLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........LTFESYF.PT..PV...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3Q2I4K6_HORSE/199-264             ..............................................emsfgprsrmsvp-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.T.LS..........................PPAGS.....NK..CP.A..E..ATC........RTFESYF.PT..PA...A.LC......EELWSH.SYKVS....NYSRG................SGRCIQ................................................................
D4A4S5_RAT/29-204                    ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKRN...............................ACCSVNTS.QE.LH...K.DN.........SR...LY.NFNWDH..C..............G..E.....M...TP..........ACK.RHF...IQD..ACLYECSP.NLGPW....IQQag.......................................qsWRKE..RFL.DVP..LC....KE....DCQEWWEACRT.S.....FTCK...R...DW.....HK.G.WD..........................WTSGI.....NK..CP.D..T..APC........RTFQYYF.PT..PA...S.LC......EGLWSH.SYKVS....NYSRG................SGQCIQ................................................................
A0A452ST55_URSAM/1-159               .......................................................alpg-----....------.-----.....---.--.........................C.TP.WKEK...............................ACCSASTS.QE.LH...K.DI.........SL...LY.NFTWDH..C..............G..K.....M...EP..........ACR.RHF...IQD..NCLYECSP.NLGPW....IREvn.......................................qsWRRE..RFL.HVP..LC....KE....DCQRWWEDCRT.S.....YTCK...A...NW.....HR.G.WD..........................WTSGI.....NK..CP.A..K..TTC........RTFEAYF.PT..PA...A.LC......EGLWSH.SYQAS....NYSRG................SGRCIQ................................................................
A0A5N6QSW7_9ROSI/26-189              ............................................vcvsqggrfppfsse-----....-----G.KPPKKvskgiKDL.TL.........................C.RV.FRRK...............................TCCDVAQT.HP.AL...L.SV.........RR...LA.S-----..T..............G..E.....A...SQ..........ECL.HLW...ELL..ECSI-CDP.RVG--....VQP...........................................----..---.GPP.lIC....SS....FCQRVYETCAN.A.....YFSM...D...AK.....-T.Q.VL..........................AP---.....CG..V-.K..D..FVC........GRASEWV.SN..GT...E.LC......RAA---.-----....-----................------gfavnpsdemyistedtscy............................................
A0A452HZQ9_9SAUR/33-208              ...........................................................MCMDA....KHHKTE.PGPEE.....ALH.GQ.........................C.VL.WKDN...............................ACCTANTS.TE.AH...Q.DQ.........SY...LY.NFNWNH..C..............G..V.....M...PE..........KCK.QHF...IQD..TCLYECSP.NLGPW....IDQad.......................................tsWRRE..RIL.NVP..LC....KE....DCELWWEDCQD.A.....ITCK...E...NW.....HK.G.WN..........................WTSGT.....NR..CP.R..G..FMC........QPFKYVF.PR..PA...D.LC......EKIWSN.SYKYT....MEHRG................SGRCIQ................................................................
S7PK32_MYOBR/1-120                   ...........................................................-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvn.......................................dsWRRE..RFR.NVP..LC....KE....DCESWWEDCRT.S.....YTCK...S...DW.....HK.G.WN..........................WTSGS.....NK..CP.A..E..AVC........RTFESYF.PT..PA...A.LC......EGLWSH.SYQVS....QYSRG................SGRCIQ................................................................
G3TSN2_LOXAF/26-201                  ...........................................................VCMNT....KHHKTE.PSPED.....KLY.EE.........................C.TP.WKDN...............................ACCTANTS.WE.AH...L.DM.........SL...LY.NFSLTH..C..............G..L.....L...TP..........SCQ.KHF...IQA..FCFYECSP.NLGPW....IQQvd.......................................prGQEE..GIV.GVP..LC....WE....DCEQWWDDCRS.S.....YTCK...S...NW.....QG.G.WD..........................WRRGK.....VR..CP.A..G..AHC........LPFPDYF.PT..PA...D.LC......DKIWSN.SYKAS....PERRS................SGRCMQ................................................................
F7CR90_MACMU/47-222                  ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........LTFESYF.PT..PV...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A6G0IVW5_LARCR/32-204              ...................................................chpqcldy-----....--KPPF.EPRQP.....LVF.--.........................C.KE.YTKF...............................GCCDLEKD.EE.IS...V.RF.........YT..iMD.NF--DQ..S..............G..-.....-...FM..........TCG.KYV...RSI..LC-QECSP.YSAHL....YDA..........................................eDANT..PMR.MLP.gLC....GD....YCTDYWNQCRY.T.....LSLL...L...ED.....LG.T.LQ..........................QFANL.....TA..II.E..E..DRR........KFCEFLE.LK..DK...Q.YCy....pNVLTSA.ELNANl..gDVSED................PTGC--le..............................................................
A0A1Z5K2D2_FISSO/85-236              ..........................................................e-CGLQ....YFHKDE.PTPED.....DGM.KE.........................C.QP.WKQR...............................SCCNSSTV.AS.ME...K.LK.........ES..yGE.EYHWDR..C..............G..P.....M...TP..........ACE.RFF...VYE..ACFYECEP.SAGLFr..kY-Ndsqs...................................hledFNTW..QMH.KMP..IK....KS....FCDSWFDACKT.D.....LFCG...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------dgdffscaaryqannpedelkkekdtnk....................................
H2QFH1_PANTR/59-215                  ..........................................................a-C---....GGSRPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagPCCPSEMD.TT.ET...S.GP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
F5H4Z6_HUMAN/30-171                  ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCTASTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........RT-----.--..--...-.--......------.-----....-----................------................................................................
H2Q4K3_PANTR/26-208                  ...........................................................ICMNA....KHHKRV.PSPED.....KLY.EE.........................C.IP.WKDN...............................ACCTLTTS.WE.AH...L.DV.........SP...LY.NFSLFH..C..............G..L.....L...MP..........GCR.KHF...IQA..ICFYECSP.NLGPW....IQPvgslg................................wevapsGQGE..RVV.NVP..LC....QE....DCEEWWEDCRM.S.....YTCK...S...NW.....RG.G.WD..........................WSQGK.....NR..CP.K..G..AQC........LPFSHYF.PT..PA...D.LC......EKTWSN.SFKAS....PERRN................SGRCLQ................................................................
A0A383ZAP8_BALAS/44-203              .................................................dygppfqpll-----....------.-----.....-HL.EF.........................C.SD.YETF...............................GCCDQRKD.HR.IA...A.RY.........WD..iME.YFD---..-..............L..K.....G...HE..........RCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....SD....YCSAFHSNCHS.A.....ISLL...T...ND.....RR.L.QE..........................-----.....--..SH.D..K..DGA........RFCHLLN.VP..DK...D.YC......------.-----....-----................------fpnvlrsdhlnrnlgvvaedprgclq......................................
A0A2K5WWK8_MACFA/22-183              ..................................................qcldfrppf-----....------.--RPP.....QLL.RL.........................C.AQ.YSDF...............................GCCDEGRD.AE.LT...R.RF.........WD...LAsRVD---..-..............T..A.....E...WA..........ACA.GYA...RDL..LC-QECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRG.L.....FRHL...S...TD.....QE.L.WA..........................LEGNR....aRF..C-.-..-..---........RY---LS.LD..DT...D.YC......------.-----....-----................------fpyllvnknlnsnlghvvadakgclq......................................
H3CCK2_TETNG/24-200                  ...........................................................MCMDA....KHHKTV.PGPEG.....QLY.LQ.........................C.AP.WKEN...............................ACCTANTS.AE.AH...E.DN.........SY...LY.NFNWNH..C..............G..A.....M...SN..........RCK.KHF...IQD..TCFYECSP.HLGPW....IQEva......................................nhnWRKE..RIV.DVP..LS....QE....DCHDWWEDCKK.E.....FTCK...S...NW.....HT.G.WD..........................WSSGI.....NK..CP.A..D..KKC........RKWTDVY.PT..PK...D.MC......EQIWSN.SYAYT....SYSKA................SGRCMQ................................................................
A0A445BKX0_ARAHY/45-206              .........................................vcvsqggrfpafksegyp-----....------.PRKGP.....KDL.TL.........................C.RV.FHKI...............................TCCDISHT.HP.AL...L.AV.........RK...LA.ST----..-..............G..E.....A...GH..........ECL.HLW...EML..ECAI-CDP.HVG--....TQP...........................................----..---.GPP.lIC....AS....FCERIYKACSN.A.....YFSM...-...DV.....KT.Q.LL..........................APCGV.....ND..F-.-..-..-VC........GRAAEWV.SN..GT...D.LC......VAA---.-----....-----................------gfrvkpsdmihaaseetlcyg...........................................
A0A667ZF80_9TELE/28-203              ...........................................................VCLQD....GQHKAT.PSPEP.....HLK.E-.........................C.TL.YADN...............................SCCTEEDI.QD.IS...H.VP.........SA..gNL.NSPWDK..C..............G..T.....L...SP..........ACE.GFL...KRV..SCFYRCSP.DAARW....PHP...........................................HSRS..YIQ.AVP..LC....HS....FCRDWFDACRM.D.....LTCA...-...--.....-R.N.WA..........................RDPRG.....HN..C-.-..T..GTC........VQYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDEAE................------eageandggrlcgclt................................................
V3YZA4_LOTGI/28-191                  ....................................................qcldfkp-----....----PF.KPKTN.....HD-.-F.........................C.NQ.YSNF...............................GCCSKSKD.DN.IQ...N.TF.........NS...LR.SL---V..S..............E..G.....T...WN..........KCQ.GTL...KDL..MC-QECSP.YAAHI....YGV...........................................EDTM..GDN.PFP.gLC....KN....YCETLFDSGCM.E.....ITKL...I...DV.....--.-.-N..........................I---T.....AK..VD.L..N..DKT........KFCNHVK.LS..DV...D.YCypellqNDMLNG.NISNV....QITSK................GCL---cle.............................................................
A0A5E4BQB7_MARMO/34-209              ...........................................................VCMDA....KHHKEK.PSPED.....KLH.EQ.........................C.SP.WKKN...............................SCCSFNTS.QE.AH...K.DI.........SY...LY.GFNWDH..C..............G..K.....M...AP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.NVP..LC....KE....DCQRWWEDCQT.S.....FTCK...S...NW.....HK.G.WN..........................WTLGY.....NQ..CP.V..G..TAC........HPFHFYF.PT..PA...A.LC......EEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
G1KAA7_ANOCA/44-206                  ..............................................qcldygppfqppf-----....------.-----.....-HL.EF.........................C.SA.YETF...............................GCCDQDKD.NT.IA...A.KY.........WE...IM.DYV---..D..............P..Q.....A...YK..........LCG.RYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....FD....YCSEFHLYCRS.A.....ITLL...-...--.....--.-.-T..........................DDKNI.....QE..CC.E..K..NKT........RFCNFLN.IQ..DE...D.YCf....pDVLKNT.DLNRNl..gSVVAD................RKGCL-q...............................................................
A0A3B3HVB9_ORYLA/28-206              ...........................................................ACLQD....GKHKAK.PSPEP.....YLT.E-.........................C.GL.YADN...............................SCCTSDDI.QD.IS...H.VP.........SV..sNK.NEPWDK..C..............G..P.....L...SS..........ECE.GFL...KRV..SCFYRCSP.DASRW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRM.D.....MTCA...-...--.....-R.N.WA..........................RDPRG.....HN..C-.-..T..GNC........VQYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDDPQeqgeag...esevegrP-----cgclt...........................................................
A0A340XV58_LIPVE/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........SK...MF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lLC....KD....YCKEFFYTCRG.H.....VPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A1S3JE46_LINUN/5-93                ......................................................geypy-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................--SD..RFN.KLP..VC....AS....QCDKWWNACKE.D.....YTCH...K...NW.....FT.D.PA..........................WDGNG....mNI..CP.K..D..AVC........KKYTEVY.TS..AA...D.FC......NTIWDG.GYHVV....---PD................TEPCM-e...............................................................
A0A3S1A7A7_ELYCH/1-138               ...........................................................-----....------.-----.....---.--.........................-.--.----...............................--CSSVND.QR.LQ...D.EY.........NY...I-.--RSKA..N..............S..R.....L...WG..........RCE.GFV...KEI..LC-QRCSP.HAADI....YGA...........................................GTSS..EPR.SFP.gLC....RG....YCNEFYDKCRS.F.....LWFL...D...PQ.....LA.G.SQ..........................ILSTK....tKF..C-.-..-..---........---NSVS.LD..DS...S.YC......------.-----....-----................------ypdvktnypevaddtqgqvtaapgclclq...................................
C6T7F8_SOYBN/40-203                  ...............................................vcvsqggrfppf-----....KSEGST.PKKGP.....KDL.TL.........................C.RI.FRKK...............................TCCDVTHT.HP.AL...L.SV.........RK...LA.S-----..T..............G..E.....A...SQ..........ECL.HLW...ELL..ECSI-CDP.RVG--....TQP...........................................----..---.GPP.lIC....AS....LCERIYEACSN.A.....YFSM...-...DV.....KT.Q.IL..........................APCGV.....ND..F-.-..-..-VC........GRAAEWV.SN..GT...D.LC......LAA---.GFRVK....-----................------psesdivhiaseetscyg..............................................
A0A2K5QH49_CEBCA/34-199              .......................................................rnyf-----....KLKKTT.HQTES.....HLL.SQ.........................C.HP.WREN...............................ACCSTNTS.QE.AH...K.DI.........SY...LY.NFNWNH..W..............R..E.....M...AP..........AYK.RHF...IQD..TCLYECSP.NLD-W....-HK...........................................---E..RVL.DVP..LC....KE....DCEQWWKDCGT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGS.....NK..CP.V..E..AAC........LPFHFYF.PT..PT...A.LC......NEIWSH.SFKVS....NYRRG................SGRCIQ................................................................
A0A340Y7G3_LIPVE/27-183              ..........................................................a-C---....GGSHPL.PARSQ.....RHH.RL.........................A.TN.LGTSqlh.........................lagPSCLSEMN.TP.EA...S.DP.........GI...VS.----GR..C..............G..V.....L...SP..........GCE.SFL...GHL..QVALRSRF.HLLLL...gVRQ...........................................----..---.TQP..LC....SE....LCDAWFATCES.A.....IIC-...-...--.....SP.T.WL..........................PLLEK.....RG..C-.-..E..PGC........TTYGQTF.AD..GA...E.LC......RSFLGY.AVPVA....--DPG................SGHCLN................................................................
A0A2K5WWK3_MACFA/22-183              ..................................................qcldfrppf-----....------.--RPP.....QLL.RL.........................C.AQ.YSDF...............................GCCDEGRD.AE.LT...R.RF.........WD...LAsRVD---..-..............T..A.....E...WA..........ACA.GYA...RDL..LC-QECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRG.L.....FRHL...S...TD.....QE.L.WA..........................LEGNR....aRF..C-.-..-..---........RY---LS.LD..DT...D.YC......------.-----....-----................------fpyllvnknlnsnlghvvadakgclq......................................
A0A315VA51_GAMAF/86-261              ...........................................................MCMNA....KHHKVE.PGPEG.....ELY.HQ.........................C.AP.WREN...............................ACCTANTS.EE.AH...N.DN.........SY...LY.YFNWNH..C..............G..A.....M...SP..........KCK.KHF...IQD..TCFYECSP.HLGPW....IQSgd.......................................esWRKE..RIL.NVP..LC....KE....DCEQWWEDCKN.D.....FTCK...T...NW.....HK.G.WD..........................WSSGT.....NK..CP.A..D..SQC........RKWTDAF.AT..PK...S.MC......EQIWSN.SYLYT....TYTKD................SGRCMQ................................................................
A0A3B3IIT4_ORYLA/37-218              ...........................................................RCYDG....SLPKRL.KKRER.....KVL.HDggsss..............snsgelC.HM.LYSR..............................vSCCPTRRA.AY.QI...-.--.........--...LH.RMDARI..F..............S..T.....N...NT..........ECA.HLL...DEI..KCA-RCSP.NAQVL....FHSld.......................................idRQPH..REP.DLP.rLC....LD....FCHKFYYTCRG.H.....IPEL...-...-F.....QA.D.V-..........................DEFCQ....yYG..RR.G..A..GLCf.....pdFQRRQLL.GQ..DS...N.YL......EDEKID.GLNRR....--HKH................NCYCA-q...............................................................
A0A2Y9KUE2_ENHLU/13-188              ...........................................................VCMDA....KHHKAK.PGPED.....KLH.GQ.........................C.TP.WKEK...............................ACCSVSTS.QE.LH...K.DT.........SL...LY.NFTWEH..C..............G..K.....M...EP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.HVP..LC....KE....DCQQWWEDCRT.S.....YTCK...N...NW.....QR.G.WD..........................WTSGI.....NK..CP.A..G..TTC........RTFETYF.PT..PA...A.LC......EGLWSH.SYQAS....NYSRG................SGRCIQ................................................................
A0A093IH44_EURHL/3-165               ..............................................qcldyrppfqppf-----....------.-----.....-HL.EF.........................C.SA.YDNF...............................GCCDQERD.NS.IA...A.KY.........WD...IM.DYIDP-..-..............-..R.....G...HK..........LCG.TYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....FD....YCSEFHINCRS.A.....ISLL...-...--.....--.-.-T..........................SDKHI.....QE..CC.E..A..NKT........RFCNLLH.LH..DE...D.YCf....pNVLKNT.ALNRNl..gSVVED................RRGCL-q...............................................................
A0A2K6KIA1_RHIBE/47-110              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...DA..........---.---...---..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------tlsrt...........................................................
A0A091N6X8_9PASS/21-188              ...........................................................RCLEG....DTQKLK.PSPEP.....NMQ.E-.........................C.TL.YSKS...............................SCCYANFT.EQ.LA...H.SP.........VI..kVS.NSYWNR..C..............G..Q.....L...SK..........SCE.DFT...KKI..ECFYRCSP.HAARW....IHP...........................................NDTA..AIQ.AVP..LC....QS....FCDDWFEACKD.D.....SICV...R...NW.....LT.D.WE..........................QDERG....eNH..C-.-..K..NKC........VPYSEVY.AN..GT...D.MC......QDMWGE.SFKVT....---ES................SCLCLQ................................................................
A0A2K6MFR4_RHIBE/47-206              .................................................dygppfqpll-----....------.-----.....-HL.EF.........................C.SD.YESF...............................GCCDQHKD.RR.IA...A.RY.........WD..iME.YFD---..-..............L..K.....R...HE..........LCG.DYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHS.A.....ISLL...T...ND.....-R.G.LQ..........................ESHGM.....DG..V-.-..-..---........RFCHLLD.LP..DK...D.YC......------.-----....-----................------fpnvlrndylnrnlgmvaqdprgclq......................................
A0A2K6UA21_SAIBB/30-205              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WRKN...............................ACCTANTS.RE.LH...K.DT.........SR...LY.NFNWDH..C..............G..R.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........RSFEFYF.PT..PA...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3Q1M762_BOVIN/201-256             ...................................................gyrssilp-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................--TGY.....NQ..CP.V..K..AAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A1S3JE36_LINUN/50-146              .............................................enhvwelmyehpdf-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................---D..HLD.QAP..IC....AS....QCEEWWDACKE.E.....YTCH...R...NW.....IT.D.MD..........................WGGEE....iNS..CK.E..G..SVC........KKYKEFY.SS..AA...D.FC......NTIWHN.AYKVV....---PD................SEPCM-v...............................................................
A0A1E7FJP8_9STRA/94-255              ...........................................................TCHLD....YLHKDI.PSPEG.....DGM.TE.........................C.HP.WKNK...............................ACCDKTNV.PD.VQ...T.IK.........EA..yGE.GYEWDR..C..............G..P.....M...SQ..........ACE.RFF...VME..ACLYECEP.SAGLFr..kYKDnqde...................................dvegFNKW..QIE.KMP..IK....KS....FCNAWYDACRT.D.....YFCG...K...GD.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------yfecqeyyaknkkeeelslqeqeliqadknqmkf..............................
A0A2R9ABR9_PANPA/36-211              ...........................................................VCMNA....KHHKEK.PGPED.....KLH.EQ.........................C.RP.WRKN...............................ACCSTNTS.QE.AH...K.DV.........SY...LY.RFNWNH..C..............G..E.....M...AP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.NVP..LC....KE....DCEQWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGF.....NK..CP.V..G..AAC........QPFHFYF.PT..PT...V.LC......NEIWTH.SYKVS....NYSRG................SGRCIQ................................................................
A0A5N4DN97_CAMDR/30-205              ...........................................................VCMDA....KHHKVK.PGPED.....KLH.DQ.........................C.IP.WKKN...............................ACCTASVS.QE.LH...K.DI.........SL...LY.NFNLDH..C..............G..K.....M...EP..........TCK.RHF...IQD..NCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.NVP..LC....KE....DCESWWEDCRT.S.....YTCK...T...NW.....QK.G.WN..........................WTSGS.....NR..CP.A..G..ATC........STFESYF.PT..PT...A.LC......EGVWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A2I3RVZ9_PANTR/47-201              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCTASTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WT---.....--..--.-..-..---........-------.--..SA...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
M4FHF9_BRARP/205-369                 ...........................................vcvskggrshqpyele-----....-----G.KLPESadlefRDL.NM.........................C.SM.FHEK...............................TCCSASRM.LS.SS...L.AL.........QN...LA.TH----..-..............G..E.....A...SK..........DCL.FWF...ELL..ECSI-CHP.DVGVQ....SGP...........................................----..---.-LR..VC....AS....FCDTVFEACSD.A.....YFNT...S...DS.....TN.Q.VI..........................V---P.....CV..AS.N..D..TIC........EKASKLE.TN..GT...A.FC......EAV---.-----....-----................------gftvvqpagdsveepcyg..............................................
A0A2R6RGD4_ACTCC/41-190              ...............................................fasegkpprkvs-----....------.--KGL.....KDL.TL.........................C.RL.FRKK...............................TCCDVAQT.HL.AL...L.SV.........RR...LA.V-----..T..............G..E.....A...SQ..........ECL.QLW...ELL..ECSI-CDP.HVG--....VQP...........................................----..---.GPP.lIC....ES....LCNRVYKACSN.A.....YFSM...-...DV.....KT.Q.VL..........................A----.....PC..GA.S..D..FVC........GSLSEWT.SN..GS...E.LC......RAA-GF.SVQSS....H-DVQ................ETSC--yg..............................................................
A0A4D9DVA7_9SAUR/26-226              ...........................................................MCMDA....KHHKTQ.PGPEG.....ALH.GQ.........................C.AP.WKDN...............................ACCTAETS.TG.AH...Q.DQ.........SY...LY.DFNWNH..C..............G..A.....M...PE..........KCK.QHF...IQD..TCLYECSP.NLGPW....IDQad.......................................tsWRRE..RIL.NVP..LC....KE....DCELWWEDCKD.A.....ITCK...E...NW.....HK.G.WNwtsardgegwle.gvqpqlahcrplsPSPGT.....NR..CP.R..G..FIC........QPFKYVF.PR..PG...D.LC......EKIWSN.SYKYT....TEHRG................GGRCIQ................................................................
A0A091TGX1_PELCR/31-206              ...........................................................ICMDA....KHHKTK.PGPEG.....TLH.DQ.........................C.AP.WKDN...............................ACCTANTS.SE.AH...K.DQ.........SN...LY.NFNWNH..C..............G..L.....M...PP..........KCK.RHF...IQD..TCLYECSP.NLGPW....IEQvd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKD.Y.....VTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFSQVF.PR..PK...D.LC......EKIWSN.SYKYT....TEHRG................SGRCIQ................................................................
L5M231_MYODS/9-162                   ...............................................hsleeeclllcq-----....------.-----.....---.--.........................-.--.----...............................------HQ.PG.AA...Q.DT.........SP...LN.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvn.......................................dsWRRE..RFR.NVP..LC....KE....DCESWWEDCRT.S.....YTCK...N...NW.....HK.G.WN..........................WTSGS.....NK..CP.V..E..AVC........RPFESYF.PT..PV...A.LC......EGLWSH.SYQVS....QYSRG................SGRCIQ................................................................
A0A2I3MYB7_PAPAN/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............agemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A671WWN0_SPAAU/29-191              ................................................qcldfeppfkp-----....------.---Q-.....WHL.EF.........................C.VE.YEQF...............................GCCDQQTD.NT.IA...E.RY.........WD..iID.QLE---..-..............V..A.....G...YD..........LCA.DML...KDI..MC-QECSP.YAAHL....YDA..........................................eDPYT..PVR.ELP.gLC....SG....YCYEFHGKCRH.V.....VKYL...T...--.....EN.K.LL..........................QDTSE.....RD..V-.-..S..TFC........SLLDL--.-S..DQ...D.YC......------.-----....-----................------ypnvlktsvlnnklgkvaedttgclk......................................
A0A2K6NI78_RHIRO/26-208              ...........................................................ICMNA....KHHKRV.PGPED.....KLY.EE.........................C.IP.WKDN...............................ACCTLTTS.WE.AH...L.DV.........SP...LY.NFSLFH..C..............G..L.....L...MP..........GCR.KHF...IQA..ICFYECSP.NLGPW....IRPvgslg................................weeapsGQGE..RVV.NAP..LC....QE....DCEEWWEDCRM.S.....YTCK...S...NW.....RG.G.WD..........................WSQGK.....NR..CP.K..G..AQC........LPFSHYF.PT..PA...D.LC......EKTWSN.SFKAS....PERRN................SGRCLQ................................................................
A0A1W0X217_HYPDU/53-186              ..........................................................y-C--S....YFQNRV.PLPAP.....ELR.N-.........................C.SW.YKKE...............................SCCRQVEL.DA.IF...K.DI.........KP...IQ.------..-..............-..G.....A...DD..........KCQ.QTF...NFL..ICWV-CDP.TQNSF....YSS...........................................----..SKQ.KLT..LC....ES....FCDQILDACKF.A.....SFKG...K...AL.....GE.S.--..........................HDSGR.....RF..CE.D..H..N--........-------.--..--...-.--......------.-----....-----................------fvvprdptdrhcfslray..............................................
A0A1V4J5R4_PATFA/108-283             ...........................................................VCMDA....KHHKTT.PGPEG.....LLY.KQ.........................C.AP.WKDN...............................ACCTANTS.SE.AH...K.DQ.........SS...LY.NFNWNH..C..............G..V.....M...PP..........KCK.RHF...IQD..MCLYECSP.NLGPW....IEQvd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKD.A.....VTCK...D...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFSEVF.PH..PK...D.LC......EKIWSN.SFKYT....TERRG................SGRCIQ................................................................
A0A4W6F149_LATCA/28-192              ...........................................................MCLQD....GKHKAT.PSPEP.....HLK.D-.........................C.AL.YADN...............................SCCTEDDI.QD.IS...H.VP.........AA..nNK.NEPWDK..C..............G..P.....L...SS..........ECE.GFL...KRV..SCFYRCSP.DAARW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRM.D.....LTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GTC........VQYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDEP-................------edvgea..........................................................
A0A3N6QTL4_BRACR/194-335             .......................................................grpy-----....--ELEG.KLPKP.....GDL.NL.........................C.NA.FHDK...............................TCWSASLA.LQ.NL...-.--.........--...-A.T-----..H..............G..E.....A...SK..........DCL.YFY...DLL..ECSI-CHP.DVG--....VQS...........................................----..--E.RLR..IC....AS....FCDRVFEACSD.A.....YFST...S...DA.....SN.Q.VI..........................V-P--.....CG..AS.N..G..IIC........VKVSKWG.TN..GT...A.FC......EAVGFT.VVQ--....-----................------taddsacyg.......................................................
A0A1A6FXD0_NEOLE/1-103               ........................................................lls-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--LQECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRG.L.....FRHL...S...PD.....RE.L.WA..........................LESNR.....AK..L-.-..-..--C........RYLS---.LD..DT...D.YCf....pSLLVNE.NLNSNl..gRVVAD................AKGCLQ................................................................
A0A2I3LNK9_PAPAN/59-198              ..........................................................a-C---....GGSHPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagTCCPSEMD.AT.EI...S.GP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQAG.VQ..WH...N.LC......S-----.-----....-----................------lq..............................................................
A0A212DIP5_CEREH/30-117              ...........................................................VCMDA....KHHKAE.PGPED.....KLH.NQ.........................C.TP.WKKN...............................ACCSARVS.QE.LH...K.DT.........SS...LY.NFTWDH..C..............G..K.....M...EP..........ACQ.RHF...IQD..NCLYECSP.NLGPW....IQE...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------cpng............................................................
A0A5N5H4K2_9ROSA/26-188              ..........................................vcisqggrfppfssegk-----....------.-PPKRvtkgsKDL.TL.........................C.RV.FREK...............................TCCDVAQT.HP.AL...V.SV.........RK...LA.S-----..S..............G..E.....A...GP..........ECL.HLW...ELL..ECSI-CDP.RIG--....VQS...........................................----..---.GPP.vIC....AS....FCDRVFEACAE.A.....YYST...-...DA.....IT.Q.VL..........................APCGV.....ND..Y-.-..-..-VC........GRASEWI.RN..GT...E.FC......HAA---.GF---....-----................------dvkddlsaskeepfcyg...............................................
L9LDL7_TUPCH/163-317                 ..........................................................e-----....------.-----.....---.--.........................-.SP.WKNN...............................ACCSINTS.HE.AH...R.NI.........SY...LY.NFNWDH..C..............G..K.....M...EP..........ACK.QHF...IQD..TCLYECSP.NLGPW....IQKvd.......................................qsWRRE..RIL.NVP..LC....KE....DCERWWEDCRS.S.....YTCK...S...NW.....HK.G.WN..........................WTSGY.....NT..CP.V..K..EAC........HPFPFYF.PT..PA...H.LC......NEIWTH.SYKVS....NYSRG................SGR---wiq.............................................................
A0A341CG66_NEOAA/98-259              ......................................................qcldf-----....--RPPF.RPPQP.....LR-.-F.........................C.AQ.YSAF...............................GCCAPEHD.AA.LA...R.RF.........GA..lAA.RV----..D..............A..A.....I...WA..........ECA.GYA...LDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDLWQSCRG.L.....FRHL...S...PD.....RE.L.WT..........................LEGNR....aKF..--.-..-..--C........RYLS---.LD..DT...D.YCf....pHLLVNE.NLNSNl..gRVVAD................AMGCL-q...............................................................
A0A2I0VYK1_9ASPA/46-197              ...................................................ltegkppr-----....-----K.VTKGP.....RDL.AV.........................C.RV.FRQN...............................TCCDVVQT.YR.VL...E.FV.........RR...LA.SF----..-..............G..E.....A...SQ..........ECL.HAW...ELL..ECSV-CDP.LIG--....VQP...........................................----..---.GPP.lIC....AS....FCNMILQDCSS.A.....YFSI...D...PR.....-N.K.VL..........................S---P.....CG..L-.G..D..IIC........GRASEWA.SN..GT...E.LC......HLA---.-----....-----................------gfavkqdvfgnhdvdkqycy............................................
A0A091JJM0_EGRGA/3-129               ........................................................lsv-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..T.....N...NT..........ECV.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETPE..REL.TLP.yLC....KD....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCY....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A0R3UJB2_9CEST/36-228              ..........................................................i-CQES....EHRKER.PTPEY.....GLT.S-.........................C.TA.WKEN...............................SCCTAATA.TM.IL...S.NN.........MH...--.GFNYHV..C..............G..N.....L...SK..........ACH.DFF...NDE..HCFVKCSP.NLGPW....LVKls.......................................ssRFKE..RAF.RVP..LC....ES....DCKSWYDACKD.D.....LTCA...M...NW.....RS.G.GFdwgsgrs............clksktrLDECE.....NA..CR.K..G..FHC........LKISEIY.RS..AV...S.FC......ERVWDH.AYTVV....PDTPV................------gnwtskephcmh....................................................
C3YF31_BRAFL/56-188                  .......................................................ycsl-----....-FTNRA.PHPEH.....KLV.K-.........................C.SW.FHND...............................ACCYQEEV.DR.IF...P.TV.........VP...-P.------..-..............R..G.....A...NQ..........NCT.DHL...YYL..MC-YICSP.RQHLF....YRD...........................................----..--E.VVT..IC....EE....LCNRLFEACAN.A.....TLKG...Q...RI.....GE.Q.Y-..........................-SSGR.....DY..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------vsrkfrvdrqssgscyshnfsiv.........................................
A0A5E4D1D3_MARMO/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlelln...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCVQ................................................................
A0A1S3KCF9_LINUN/33-205              ...........................................................TCMDA....QSHKSK.PGPED.....SLH.AE.........................C.TP.WKNR...............................ACCHKKTT.EE.LH...Q.NA.........-T...WY.KFTWGH..C..............E..P.....L...SD..........MCK.RYF...VRD..LCFYECSP.NVGPW...lVQEs........................................rtWRKE..RMY.HAP..LC....ET....DCNTWYNECKN.E.....KTCL...D...NW....sNG.G.FN..........................FSSGV.....NT..CP.T..G..KPC........KPFHEIF.GN..AT...N.FC......ETIWDG.SWKVT....---PD................DKPCM-k...............................................................
A0A1V4JX64_PATFA/158-325             ..........................................................g-CLEG....DTHKLK.PSPEP.....KMH.E-.........................C.TL.YSKS...............................SCCHADFT.EQ.LA...H.SP.........VI..kVN.NSYWNR..C..............G..Q.....L...SK..........SCE.DFT...KKI..ECFYRCSP.HAAHW....INR...........................................NNAA..AIQ.SVP..LC....QS....FCDDWYEACKD.D.....STCV...R...NW.....LT.D.WE..........................WDESG....eNI..C-.-..K..NKC........IPYSEMY.AN..GT...D.MC......QNMWGQ.SFKVS....---ES................SCLCLQ................................................................
H2M6E9_ORYLA/23-198                  ...........................................................MCMDA....KHHKVE.PGPEG.....QLY.SQ.........................C.SP.WREN...............................ACCTANTS.EE.AH...N.DN.........SY...LY.KFNWNH..C..............G..A.....M...SD..........ACK.KHF...IQD..TCFYECSP.HLGPW....IQEad.......................................qsWRKE..RII.DVP..LC....KE....DCESWWSDCKN.D.....TTCK...T...DW.....HK.G.WD..........................WSSGT.....NK..CP.E..G..SKC........SKWTDVF.PT..PK...S.MC......EQIWSQ.SYVYT....TYTKS................SGRCMQ................................................................
A0A087XS24_POEFO/23-198              ...........................................................MCMNA....KHHKVE.PGPEG.....ALH.RQ.........................C.AP.WREN...............................ACCTANTS.EE.AH...N.DN.........SY...LY.YFNWNH..C..............G..A.....M...SS..........KCK.QHF...IQD..TCFYECSP.HLGPW....IQSad.......................................enWRKE..RIL.NVP..LC....KE....DCEQWWEDCKD.D.....FTCK...T...NW.....HE.G.WD..........................WSSGT.....NK..CP.A..G..SQC........RKWTDVY.PT..PK...S.MC......EQIWSN.SYLYT....TLTKD................SGRCMQ................................................................
A0A091CNE7_FUKDA/43-193              .......................................................acgg-----....--SHPP.QARSQ.....SGH.GL.........................A.AE.PGTE...............................QLHLEKVD.RP.QA...W.GP.........GA...--.--APER..C..............G..T.....L...SP..........RCR.SFL...GHL..QRVLHHRL.RLLLL...gLR-...........................................----..---.GAP.sLC....AE....LCEAWFTNCKA.D.....ITC-...-...--.....GP.T.WP..........................PTSED.....RG..C-.-..A..PSC........PTYGQTF.SD..GV...D.LC......RSVFGD.ALPVA....--APG................SCHCLN................................................................
A0A674HPM4_TAEGU/21-188              ..........................................................g-CLEG....DTQKLK.PGPEP.....NMQ.E-.........................C.TL.YSKS...............................SCCYADFT.EQ.LA...H.SP.........VI..kIG.DSYWNR..C..............G..Q.....L...SK..........SCE.DFT...KKI..ECFYRCSP.DAARW....IHP...........................................NDTA..AIR.AVP..LC....QS....FCDDWYEACKD.D.....SICV...R...NW.....LT.D.WE..........................WDERG....eNH..C-.-..N..NKC........IPYREMY.AN..GT...D.MC......QSMWGE.SFKVS....---ES................SCLCLQ................................................................
L8GFZ8_ACACA/320-468                 ..........................................................k-CLVP....KTNRRA.QRPEP.....QLK.R-.........................C.KW.YNEK...............................ACCTADKD.RS.VD...Q.WM.........AK..aI-.----NP..L..............F..K.....H...KP..........NCQ.ALF...EDL..WCGYECSP.HRPHF....LDP..........................................yDTIN..EEQ.GMR..IC....SS....FCKSLYGECKD.T.....PIMG...L...T-.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------iravyarhqdfcmantpnnflrvtvtdthcfngtkae...........................
A0A2I0TEI5_LIMLA/1-85                ..........................................................m-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...PP..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQvd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKD.Y.....LTCK...E...NW.....HK.G.WN..........................WATGT.....F-..--.-..-..---........-------.--..--...-.--......------.-----....-----................------tilsvirnd.......................................................
A0A093F6M3_TYTAL/1-156               ...........................................................-----....------.-----.....---.-Q.........................C.AP.WKDN...............................ACCTANTS.SE.AH...K.DN.........SN...LY.NFNWNH..C..............G..V.....M...PP..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQad.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKD.Y.....VTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFSHVF.PR..PK...D.LC......EKIWSN.SYKYT....TEHRG................SGRCIQ................................................................
U3JIW3_FICAL/7-168                   ....................................................qcldfkp-----....----PF.RPPRG.....LA-.-F.........................C.RR.YAEF...............................GCCDPRRD.RA.LL...Q.RF.........YR...LS.---AGL..D..............E..R.....T...YA..........ACA.GHL...QDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCVQVWQNCRS.I.....FRSL...S...AD.....PE.L.IA..........................LENNV....aKF..--.-..-..--C........RYLS---.LE..DT...D.YCf....pQLLANQ.NLNQNl..gRVTAD................AEGCL-q...............................................................
A0A1S3BYL2_CUCME/33-190              ...........................................vcisqggrfapfsseg-----....--KPPS.KVSKA.....QDL.TL.........................C.RV.FRKR...............................TCCGVAQT.HP.AL...L.SV.........RK...LA.S-----..A..............G..E.....A...NH..........ECL.QLW...ELL..ECSI-CDP.QVG--....VQP...........................................----..---.GPP.lIC....AS....FCDRVFKACSD.A.....YFSV...D...A-.....KT.Q.VL..........................APCGV.....ND..F-.-..-..-VC........GRASKWV.SN..GT...D.LC......NAA-GF.SVKIS....-----................------deetscyg........................................................
A0A3Q1MRP4_BOVIN/30-205              ...........................................................VCMNA....RYHKEK.PGPED.....KLH.GQ.........................C.SP.WKKN...............................ACCFVNTS.IE.AH...K.DI.........SS...LY.RFDWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IREvn.......................................qsWRKE..RIL.NVP..LC....KE....DCQSWWEDCRT.S.....YTCK...S...NW.....HR.G.WD..........................WTSGY.....NQ..CP.V..K..AAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SYKAS....NYSRG................SGRCIQ................................................................
G1LGF8_AILME/44-124                  ...........................................................VCMDA....KHHKAK.PGPED.....KLH.DQ.........................C.TP.WKEK...............................ACCSASTS.QE.LH...K.DI.........SL...LY.NFTWDH..C..............G..K.....M...EP..........ACA.T--...---..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------ssrttvstsahptwgpgs..............................................
A0A1R3JTK2_COCAP/42-205              ........................................vcisqggrfppfssegkpp-----....----KK.VGKGQ.....KDL.TL.........................C.RL.FRKR...............................TCCDAAQT.YP.AL...L.SI.........RR...LT.V-----..T..............G..E.....A...SQ..........ECL.QLW...ELL..ECSI-CDP.RVG--....VQP...........................................----..---.GPP.lIC....TS....FCDKVFQACST.A.....YFSM...D...AK.....TQ.A.L-..........................A----.....PC..GA.S..D..FVC........GRASEWV.SN..GT...E.LC......RAA---.-----....-----................------gflveqtdvmrngvedrfcy............................................
G1LY46_AILME/1-102                   ........................................................lsl-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..---QECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRG.L.....FRHL...S...PD.....RE.L.WA..........................LEGNR....aKF..--.-..-..--C........RYLS---.LD..DT...D.YCf....pRLLVNE.NLNSNl..gRVVAD................AKGCLQ................................................................
H3CIM9_TETNG/5-160                   .................................................qcldfkppfr-----....------.---PS.....REL.EL.........................C.VM.YSDF...............................GCCDYQKD.QE.LL...A.KY.........YR..iMD.NFD---..-..............Y..D.....G...YS..........RCA.GFV...LEL..LC-QECSP.YAAHL....FDA..........................................eDAQT..PVR.TLP.gLC....PD....YCEEFWSKCDS.T.....IPL-...-...--.....LS.G.-K..........................PDVGS.....YH..C-.-..-..---........---QDLV.LD..DA...D.YCy....pRLLSNK.KLNQNl..gRVQAS................SDGCL-q...............................................................
A0A674NCW4_TAKRU/30-189              ................................................qcldfkppfrp-----....------.----M.....KEL.EL.........................C.VM.YKDF...............................GCCDYQKD.QE.LL...L.KF.........YH..vME.HFD---..-..............Y..N.....G...YS..........NCA.GYV...LEL..LC-QECSP.YAAHL....FDT..........................................eDTQT..PVR.TIP.gLC....PD....YCEEFWKKCNS.T.....VPLL...-...--.....--.-.--..........................--LGK.....PH..MG.K..Q..QPA........ERCQDLV.LD..DM...D.YC......------.-----....-----................------yprllsnqklnknlgrvqadgdgclq......................................
A0A4X2M5F2_VOMUR/29-204              ...........................................................VCMDA....KHHKIQ.PGPED.....DLH.LQ.........................C.SP.WKKN...............................ACCTANTS.IA.AH...E.DA.........SY...LY.RFNYNH..C..............G..T.....M...AL..........ACK.RHF...IQD..TCLYECSP.NLGPW....IRPvs.......................................ssWRRE..RML.NVP..LC....KE....DCNQWWEDCRT.S.....YTCK...E...NW.....QK.G.WN..........................WTSGI.....NK..CP.V..E..AAC........HPFSFYF.PT..PA...S.LC......ENIWGH.SYNAS....SFGRG................SGKCIQ................................................................
A0A2K6AU50_MACNE/42-217              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........LTFESYF.PT..PV...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A2F0B8W2_ESCRO/27-116              ..........................................................a-C---....GGSHPL.PARSQ.....RHH.RL.........................A.TN.LGTS...............................QLHLAEMN.TP.EA...L.DP.........GI...VS.----VR..C..............G..E.....L...SP..........GCE.SFL...EHL..QVALRSRF.HLLLL...gVRQ...........................................----..---.TQP..LC....SE....LCDAW------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------................................................................
A0A124SAH4_CYNCS/279-427             .................................................siqgkpprrv-----....------.-SKGP.....NDL.TL.........................C.RV.FRKK...............................TCCDVTQT.HP.AL...L.SI.........RR...LA.S-----..T..............G..E.....A...TD..........ECL.HLW...ELL..ECSI-CDP.HVG--....VQA...........................................----..---.GSP.iVC....AS....LCDRIYGACSN.A.....YFAM...D...AK.....N-.-.--..........................QVLAP.....CG..M-.S..D..TVC........GRASEWV.SN..GT...E.LC......KAS-GF.SV---....-----................------kpsndfketfcyg...................................................
A0A674F6Z0_SALTR/34-195              ..................................................qcldfkppf-----....------.KPQ--.....EDL.QF.........................C.AM.YRNF...............................GCCDSAKD.QE.LM...A.KF.........YK..iVD.NFD---..-..............N..Y.....A...YA..........NCA.GYV...QDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PIR.TLP.gLC....PD....YCSQFWLKCRS.T.....ITLL...S...DD.....LQ.L.AQ..........................AKPDQ....vHF..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------qhleledpdycyphllsnqqltqnlghvradpegclq...........................
A0A2Y9E1U1_TRIMA/26-201              ...........................................................VCMNT....KHHKRE.PSPED.....KLY.EE.........................C.IP.WKDN...............................ACCTASTS.WE.AH...L.EE.........SL...LY.NFSLTH..C..............G..L.....L...TP..........SCQ.KHF...IQA..FCFYECSP.NLGPW....IRQvd.......................................prGQGQ..RIV.GVP..LC....RE....DCEQWWADCRS.S.....YTCK...S...NW.....QG.G.WD..........................WSRGK.....NR..CP.A..G..AHC........LPFPDYF.PT..PA...D.LC......EKIWSN.SYKAS....PERRG................SGRCIQ................................................................
A0A4W5PNF9_9TELE/29-207              ...........................................................ACLQD....GRQKAT.PSQEP.....HLK.E-.........................C.TI.YAEN...............................ACCSEDDI.QD.LN...P.TT.........GE...-K.NSPWDK..C..............G..K.....L...SP..........KCE.DFL...KRV..TCFYRCSP.DAARW....PHS...........................................HLQS..SMQ.AVP..LC....HS....FCRDWYEACRM.D.....MTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GNC........VPYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDEEE................------eqeggevisngnggrpcgclt...........................................
A0A3Q2CIF1_CYPVA/60-221              ................................................cldfappfkpq-----....------.-----.....WHL.EF.........................C.SQ.YEDF...............................GCCDQRTD.NV.IA...E.RY.........WD...II.EL-LE-..-..............A..A.....G...YD..........LCE.DML...KEI..MC-QECSP.YAAHL....YDA..........................................eDPYT..PVR.DLP.gLC....FG....YCSEFHSKCRH.V.....LKYL...T...E-.....-N.Q.LL..........................LDTSG.....RD..M-.-..T..TFC........SLID---.LS..DQ...D.YCy....pNVLKST.DLNSNl..gQVVED................PRGCL-q...............................................................
A0A2K5D9K7_AOTNA/47-201              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WRKN...............................ACCTADTS.QE.LH...K.DT.........SR...LY.NFNWEH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WT---.....--..--.-..-..---........-------.--..SA...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A2I0J249_PUNGR/24-199              .......................................vcvskggrfppyssegrppr-----....-----K.VSKGP.....KDL.TL.........................C.RV.FRRK...............................TCCDVAQT.HA.AL...V.TV.........RK...LA.L-----..T..............G..D.....A...TD..........ECV.QLW...ELL..ECSI-CDP.RVG--....VQP...........................................----..---.GPP.rIC....AS....FCDRVFQACSS.A.....YFST...D...AI.....-T.Q.GE..........................SPQCS....eRR..RR.Y..P..PVAillpvmsiGWATEWV.SN..GT...D.LC......QAA---.-----....-----................------gfavkvplypgeeetscyg.............................................
A0A6A5EXE8_PERFL/28-213              ...........................................................VCLQD....GKHKAT.PGPEP.....QLR.E-.........................C.GL.YADN...............................SCCTEEDI.QD.IS...H.VP.........SA..sNK.NDPWDK..C..............G..P.....L...SS..........ECE.GFL...KRV..SCFYRCSP.DAARW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRM.D.....MTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GTC........VQYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDEPE................------dvgeagevgagggggvsggrpcgclt......................................
A0A672GWR8_SALFA/7-146               ...........................................................VCLQD....GKHKAA.PGPEP.....HLS.E-.........................C.GM.YADN...............................SCCSEEHI.QD.VS...Y.LP.........SA..sSK.NEPWDK..C..............G..P.....L...SA..........ECE.GFL...KRV..SCFYRCSP.DAARW....PHP...........................................QRRS..YIQ.AVP..LC....HS....FCRDWFDACRM.D.....LTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GTC........VQYQQV-.--..--...-.--......------.-----....-----................------glqr............................................................
F7DUE2_ORNAN/38-221                  ...........................................................RCLNG....NPPRRL.KRRDR.....RVM.SQleaps...............ggesvC.GG.LYPR..............................lSCCSRTDS.QG.WL...H.VE.........TK..iFS.------..-..............V..I.....N...NT..........ECV.KLL...EEI..QCAH-CSP.HAQNL....FHSpe.......................................rgEATE..REI.ALP.lLC....KD....YCKEFYYTCRG.H.....IPG-...-...-F.....LL.T.TV..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEl..sRKHKH................NCFCLQ................................................................
G3Q9Q0_GASAC/1-143                   ..........................................................m-----....------.-----.....---.--.........................-.--.YKEF...............................GCCDYQRD.QE.LM...A.NY.........YH...VM.---GGS..D..............Y..S.....G...YV..........RCA.GFV...LEL..LC-QQCSP.YAAHL....FDA..........................................eDPNT..PVR.TIP.gLC....PD....YCSEFWKKCSS.T.....IPLL...S...ND.....--.T.-L..........................IAK--.....--..L-.K..E..DQT........RLCQYLK.LD..DD...D.YCy....pHLLSNQ.KLTQNl..gTVQSD................SEGCLQ................................................................
A0A671XGR2_SPAAU/35-196              ................................................qcldfkppfrp-----....------.----Q.....REL.DF.........................C.VM.YREF...............................GCCDFQKD.QE.LM...R.KF.........YQ..iMD.HFD---..-..............D..Y.....G...YE..........RCA.GFV...SDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....PD....YCSQLWMKCSS.T.....IPYL...-...--.....--.-.-S..........................DHPNI.....AE..V-.K..D..DQT........RFCQYLQ.LD..DM...D.YCy....pHLLSNQ.KLTNNl..gRVQSD................SDGCLQ................................................................
G3WWL1_SARHA/29-194                  ......................................sahpqcldfkppfrpprplpf-----....------.-----.....---.--.........................C.EQ.DSAF...............................GCCDAEQD.AA.LS...R.RY.........WA..vTS.RLE---..-..............P..D.....T...FA..........VCA.AYV...RGL..LC-QECSP.YAAHL....FDA..........................................eDPST..PLR.TVP.gLC....KD....YCVDVWHNCRT.I.....FRHL...S...PD.....PE.L.WA..........................LETNR....aKF..C-.-..-..---........RYLS---.LD..DA...D.YCf....pRLLVNE.NLNVNl..gQVRAD................TEGCL-e...............................................................
A0A383ZEX0_BALAS/30-205              ...........................................................VCMDA....KHHKIK.PGPED.....KLH.DQ.........................C.IP.WKKN...............................ACCSAKVS.QE.LH...R.DT.........SS...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RVL.NVP..LC....KE....DCQIWWEDCRT.S.....YTCK...T...NW.....QK.G.WN..........................WTSGS.....NK..CP.T..G..TTC........GTFEFYF.PT..PA...A.LC......EGLWSH.SYKLS....NYSQG................SGRCIQ................................................................
A0A099YZJ2_TINGU/4-129               .........................................................sv-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETPE..REL.ALP.yLC....KD....YCKELYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..nRKHKH................NCFCIQ................................................................
A0A4S2M3L0_OPIFE/34-204              ...........................................................ICING....THHKKA.PSPEP.....TDD.HI.........................C.TD.WASM...............................SCCEHKTM.RS.VQ...-.-D.........SL...LY.GFNHSH..C..............K..P.....M...SQ..........KCI.NMF...KRE..LCFYECSP.HVGPW...lV-Ktq.......................................slRRRE..RSY.LVP..LC....EE....DCNKWYEACKN.E.....ETCV...R...DW.....SV.E.FE..........................WSEGM.....NV..CP.A..D..SSC........ELFSNVY.KD..AS...D.FC......HAIWDG.GWKVE....-K---................APRC--mhf.............................................................
W5NUZ8_SHEEP/20-195                  ...........................................................VCMNA....KPHKPK.PSPEA.....ELY.EE.........................C.IP.WKDN...............................ACCTASTS.WE.AH...L.DV.........SL...LY.NFSLVH..C..............G..L.....M...MP..........DCQ.RHF...LQA..ICFYQCSP.NLGPW....IQKvd.......................................prWQAE..RVL.DAP..LC....LE....DCERWWADCRT.S.....HTCK...S...NW.....LG.S.WA..........................WSRGK.....PR..CP.E..R..APC........RPFPHYF.PT..PA...N.LC......ERIWSG.SFRAS....PERRG................SGRCLQ................................................................
A0A1S3F111_DIPOR/29-204              ...........................................................ACLDA....KHHKTK.PGPED.....KLH.EQ.........................C.SP.WRRN...............................SCCSFNTT.QE.LH...K.DT.........SL...LY.NFNWDH..C..............G..K.....M...EP..........ACK.CHF...IQD..SCLYECSP.NLGPW....IQEvn.......................................qnWRKE..RFL.DVP..LC....KE....DCQRWWEDCRT.S.....STCK...T...NW.....HK.G.WD..........................WSSGV.....NK..CP.A..K..AVC........HTFEFYF.PT..PA...S.FC......EGLWSH.SYKVS....NYSQG................SGRCIQ................................................................
A0A2Y9F7K9_PHYMC/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........SK...MF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lFC....KD....YCKEFFYTCRG.H.....VPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A0B0MQQ7_GOSAR/43-205              .........................................cvsqggrfppfssegkpp-----....------.---KRvgkghKDL.TL.........................C.RV.FRKK...............................TCCDAAQT.HP.AL...L.SI.........RR...LA.L-----..T..............G..E.....A...SE..........ECL.HLW...ELL..ECSI-CDP.RVG--....VQP...........................................----..---.GPP.lIC....TS....FCDRVFQACSN.A.....YFSM...D...A-.....KT.Q.VL..........................APCGA.....ND..F-.-..-..-VC........GRASEWA.SN..GT...E.LC......LAA---.-----....-----................------gfrveqsvgmhggieeescy............................................
A0A401PDB6_SCYTO/37-133              ....................................................klykqvd-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....--Q..........................................tWRNE..RIM.HVP..IC....KT....DCEEWWADCRE.D.....HTCK...V...NW.....HK.G.WD..........................WSSGI.....NK..CP.T..N..SKC........QKFSQVF.PT..PQ...D.LC......EKLWSN.SYQYT....QHDRG................SGECI-v...............................................................
A0A2K6U9X6_SAIBB/1-174               ...........................................................--MDA....KHHKAQ.PGXED.....NLY.GQ.........................C.SP.WRKN...............................ACCTANTS.RE.LH...K.DT.........SR...LY.NFNWDH..C..............G..R.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........RSFEFYF.PT..PA...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
U6KH51_9EIME/1-99                    ..............................................mceprfgtgeles-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................----..--K.GKP.vLC....PQ....LCEKWFNACKE.E.....FVSA...S...PS.....GS.S.SA..........................LTFCD.....--..-D.S..S..LIC........SRLSATL.GD..SL...S.FC......RQMGYD.VLEDA....-----................------ggdssevlgrrrrscfn...............................................
A0A0V0QLV3_PSEPJ/47-208              ..........................................qckgsspffnikygqqn-----....------.PKQ--.....-LK.NQi.......................fC.NE.VSQR...............................TCCNNQNF.EA.LK...Q.AW.........YM..fNY.NL----..-..............N..E.....V...SS..........QCQ.IQF...NEI..IC-SECDA.DIGTQ....LRK...........................................----..---.--G..IC....QN....ICDNFYNNCVN.D.....LFKM...E...EN.....--.-.--..........................--RVK.....YC..NQ.N..D..MIC........SPLKSIF.TD..ST...S.FC......DNI---.GFKVN....-----................------qnsdyqvwmedlkekqsqes............................................
A0A665U4V8_ECHNA/27-195              ...........................................................MCMDA....KHHKTE.PGPEG.....ELY.LQ.........................C.SP.WRDN...............................ACCTANTS.VE.AH...E.DN.........SY...LY.NFNWNH..C..............G..I.....M...SP..........KCK.KHF...TQD..ACFYECSP.NLGPW....IQQvh.......................................qsWRKE..RII.DVP..LC....ME....DCHDWWEDCKN.D.....YTCK...S...NW.....HK.G.WD..........................WSSGE.....CK..A-.-..-..HTC........----TIY.PT..PK...S.MC......EQIWSS.SYLYT....TLPKS................SGRCMQ................................................................
A0A3P9Q3Q5_POERE/23-198              ...........................................................MCMDA....KHHKVE.PGPEG.....ALH.RQ.........................C.AP.WREN...............................ACCTANTS.EE.AH...N.DN.........SY...LY.YFNWNH..C..............G..A.....M...SS..........KCK.QHL...IQD..TCFYECSP.HLGPW....IQSad.......................................enWRKE..RIL.NVP..LC....KE....DCEQWWEDCKD.D.....FTCK...T...NW.....HK.G.WD..........................WSSGI.....NK..CP.A..G..SHC........RKWTDVY.AT..PK...S.MC......EQIWSN.SYLYT....TLTKD................SGRCMQ................................................................
A0A5B6VI32_9ROSI/17-179              .........................................cvsqggrfppfssegkpp-----....------.---KRvgkghKDL.TL.........................C.RV.FRKK...............................TCCDAAQT.HP.AL...L.SI.........RR...LA.L-----..T..............G..E.....A...SE..........ECL.HLW...ELL..ECSI-CDP.RVG--....VQP...........................................----..---.GPP.lIC....TS....FCDRVFQACSN.A.....YFSM...D...A-.....KT.Q.VL..........................APCGA.....ND..F-.-..-..-VC........GRASEWA.SN..GT...E.LC......LA----.-----....-----................------agfrveqsvgmhggieevscy...........................................
A0A329S9C2_9STRA/33-184              ..............................................tcrsagvlkfepe-----....----TH.PMQRT.....KGM.EV.........................C.SK.YRKS...............................TCCNATHA.HA.LR...L.KI.........RE..pVV.------..-..............A..K.....F...SR..........KCQ.ALT...EEM..ACSS-CHP.LMGTW...eMK-...........................................----..---.--N..VC....PS....LCNDWYDACKD.E.....YYAY...-...-G.....GA.G.TL..........................APCYG.....NA..L-.-..-..-VC........SPLKSIA.KS..GS...D.FC......VHMGFH.VGGVA....-----................------daegidcfd.......................................................
A0A0D9VHR3_9ORYZ/41-193              .............................................fssegkppgraakg-----....------.----R.....RDL.AL.........................C.RV.FRQN...............................TCCDVSQT.FS.AL...L.SV.........RK...LA.S-----..T..............G..E.....G...SQ..........ECL.HLW...ELL..ECSI-CDP.RVG--....VRH...........................................----..---.GPP.vIC....AS....FCDMVFKACSE.A.....YFAI...-...D-.....VK.T.QA..........................LSPCG.....--..L-.G..D..ILC........GKAHKWV.SN..GT...E.LC......RSA---.-----....-----................------gfsvqaldsssgglddtfcy............................................
A0A3N0XWP8_ANAGA/1-143               ..........................................................m-----....------.-----.....---.--.........................-.--.YKHF...............................GCCDYARD.QE.LM...A.KY.........YR..iMD.NFD---..-..............Y..Y.....G...YS..........NCA.AYV...QDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PLR.TIP.gLC....PD....YCSQFHSKCRS.F.....LTLL...S...DD.....PR.L.LE..........................LEHDQ....rRL..C-.-..-..---........QY---LE.LD..DP...D.YC......------.-----....-----................------yphllsnerltknlgrtaadpegclq......................................
A0A446WCW3_TRITD/54-207              ...............................................fssegkppgkaa-----....------.--KGR.....RDL.AL.........................C.RI.FRQN...............................TCCDVTQT.FP.AL...L.SV.........RK...LS.S-----..T..............G..E.....G...SG..........ECL.HLW...ELL..ECSV-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFEACSE.A.....YFSI...-...--.....-D.T.KT..........................QALSP.....CG..L-.G..D..ILC........GKAHKWV.SN..GT...E.LC......RLA-GF.SVQVS....DASPS................------evvetfcyg.......................................................
A0A2K6Q6I5_RHIRO/59-198              ..........................................................a-C---....GGSHPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagTCCPSEMD.TT.EI...S.GT.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.HLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFTNCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQAR.VQ..WH...H.LC......S-----.-----....-----................------lq..............................................................
A0A093Q978_9PASS/1-139               ...........................................................-----....------.-----.....---.-Q.........................C.VL.WKDN...............................ACCTANTS.QE.AH...E.DQ.........SY...LY.NFNWDH..C..............G..A.....M...PQ..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQad.......................................ntWRKE..RIR.DVP..LC....QE....DCEQWWEDCQD.A.....VTCK...V...NW.....HK.G.WN..........................WTSGT.....NQ..CP.Q..G..AMC........QKFKFVF.PT..AA...A.PC......ETIW--.-----....-----................------a...............................................................
A0A1S3JP76_LINUN/35-178              ......................................................tctyy-----....-GGTHV.PSPEN.....GLV.N-.........................C.SW.YSTN...............................ACCKRTEV.TS.VF...G.GM.........YK...LA.------..-..............-..R.....A...SK..........KCQ.NRV...NYL..MC-YFCSP.EQHLW....YQD...........................................----..---.QLH..VC....AD....FCDSIHFYCKT.A.....MFSG...E...KI.....GT.S.YKngk....................eicEGQKF.....KY..VE.S..N..TNC........FKFD---.--..--...-.--......------.-----....-----................------ptvfdtgcslksslit................................................
W5P1W2_SHEEP/35-210                  ...........................................................VCMDA....KHHKAK.PGPED.....SLH.EQ.........................C.SP.WRKN...............................ACCSVNTS.IE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IREvn.......................................qkWRKE..RVL.GVP..LC....KE....DCQIWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WSAGY.....NQ..CP.V..K..AAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SYKVS....NYGRG................SGRCIQ................................................................
A0A226MGQ3_CALSU/59-234              ...........................................................VCMDA....KHHKTK.PGPEG.....TLH.GQ.........................C.AP.WKDN...............................ACCTANTS.SE.AH...K.DQ.........SY...LY.NFNWNH..C..............G..V.....M...PS..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQvd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKD.Y.....VTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFTQVF.PR..PK...D.LC......EKIWSN.SYKYT....TERRG................SGRCIQ................................................................
A0A2K6GD42_PROCO/36-211              ...........................................................VCMDA....KHHKEK.PGPED.....NLH.EQ.........................C.TP.WKKN...............................ACCTADTS.EE.AH...K.DI.........SN...LY.RFNWDH..C..............G..K.....M...AP..........ACK.RHF...IQD..TCFYECSP.NLGPW....IKQvd.......................................qsWRKE..RIL.NVP..LC....KE....DCESWWEDCRS.S.....YTCK...G...NW.....HK.G.WN..........................WTSGY.....NQ..CP.V..K..AAC........HPFPFYF.PT..PA...D.LC......NEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A5F8HFA9_MONDO/60-186              ..............................................hsagspimagicl-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.--IWDR..C..............G..G.....L...SP..........RCE.SFL...QSL..SHFLYCSL.LAGNW....AHP...........................................EKHG..SVQ.ALP..IC....AA....FCDQWFSACRD.D.....LTC-...-...--.....GR.N.WL..........................FQPGG.....GS..C-.-..E..GGC........LTFDQTF.LD..AR...D.LC......NSALGD.YLVAA....-----................------papcpflq........................................................
A0A4U5QS39_POPAL/90-253              .......................................vciskggrfppytsegkppk-----....-----K.VSKGA.....KDL.TL.........................C.RV.FRKK...............................TCCDVAQT.YP.AL...L.SV.........RR...LA.S-----..T..............G..E.....A...SQ..........ECL.QLW...ELL..ECSI-CDP.RIG--....VQP...........................................----..---.GPP.lIC....AS....FCDRVYQACAN.A.....YFSM...D...A-.....--.-.-N..........................KRVIA....pCG..V-.S..D..FVC........GQAAEWV.SN..GT...E.LC......HAA-GF.S----....-----................------vklsddayvgaeeascy...............................................
A0A2U9CRZ8_SCOMX/28-203              ...........................................................MCLQD....GKHKAA.PGPEP.....HLR.D-.........................C.AL.YADN...............................SCCTDEDI.QD.IS...H.VP.........SA..sNK.NEPWDK..C..............G..P.....L...SS..........ECE.GFL...KRV..SCFYRCSP.DAARW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRM.D.....LTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GSC........VQYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDDPEdggea......gdggrPCGCL-t...............................................................
A0A2T7F8G7_9POAL/45-196              ..................................................fssegkppg-----....------.RAPKG....rRDL.AL.........................C.RI.FRQN...............................TCCDLTQT.FP.AL...I.SV.........RN...LA.L-----..T..............G..E.....G...SQ..........ECI.HLW...ELL..ECSI-CDP.RVG--....VRP...........................................----..---.GPP.aIC....AS....FCDMVFKACSE.S.....YFSI...-...--.....-D.T.KT..........................QALSP.....CG..L-.G..D..ILC........GKAHKWV.SN..GT...E.LC......HLA-GF.S----....-----................------vqvsgtssglvddifc................................................
H3ASX4_LATCH/39-187                  .................................................qcldfkppfk-----....------.--PQ-.....KEL.AF.........................C.VM.HKDF...............................GCCDSLKD.AA.LI...T.RF.........YS..iVE.HLD---..-..............T..E.....R...YA..........TCA.GYV...QDI..LC-QECSP.YAAHL....YDA..........................................eDPTT..PMR.TIP.gLC....KD....YCSVLWQKCRP.I.....FGL-...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------isedshlatlennveklcdylaledldycfphllsnekltqn......................
A0A340XVA8_LIPVE/30-205              ...........................................................VCMDA....KHHKIK.PGPED.....KLH.DQ.........................C.IP.WKKN...............................ACCSAKVS.QE.LH...R.DT.........SS...LY.NFNWEH..C..............G..K.....M...KP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.NVP..LC....KE....DCQNWWEDCRT.S.....YTCK...T...NW.....HK.G.WN..........................WTSGS.....NK..CP.T..G..ATC........GTFEFYF.PT..PA...A.LC......EGLWSN.SYKLS....NYSRG................SGRCIQ................................................................
A0A078GMG4_BRANA/3-101               ....................................savqnlstygeapkdclylfell-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................---E..CSK.TLP..IC....AS....FCDRVFEACSD.A.....YFTS...D...AS.....--.-.--..........................DQVIV....pCG..AS.E..S..IIC........GKASKWE.TN..GT...A.FC......YAL---.GFTVQ....-----................------sadeepcyg.......................................................
A0A3P8X980_ESOLU/34-195              ..................................................qcldfkppf-----....------.KPQ--.....EDL.QF.........................C.TM.YGTF...............................GCCDSVKD.QE.LM...T.KF.........YN..iMD.NFD---..-..............Y..Y.....G...YA..........NCA.GYV...QDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PTR.TIP.gLC....PD....YCSQFWSKCRS.T.....ITLL...S...DQ.....PQ.H.AE..........................TEQDQ....vRF..C-.-..-..---........---QN--.--..--...-.--......------.-----....-----................------lqledpdycyphilrneqltqnlgrvvanpegclq.............................
A0A2I0TKU5_LIMLA/9-109               .......................................wkmreaiycvpvpgrsitqk-----....------.-----.....---.--.........................-.-D.SKRA...............................SCCYADFT.EQ.LA...H.SP.........VI..kVN.NSYWNR..C..............G..Q.....L...SK..........SCE.DFT...KKI..ECFYRCSP.HAAHW....IHP...........................................NYTA..AIQ.SVP..LC....QS....FCDDW------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------................................................................
A0A226MRY7_COLVI/2-92                ........................................................dss-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................WRRE..RIL.HVP..LC....RE....DCEQWWEDCQD.S.....STCK...V...NW.....HK.G.WN..........................WSTGT.....NQ..CP.H..G..AMC........QKFKYVF.PT..PA...D.LC......EKVWSQ.SYKYT....TERRG................SGRCIQ................................................................
A0A0K9PKS2_ZOSMR/44-193              .............................................segnppgkvakgpr-----....------.-----.....-DL.VF.........................C.GV.FRKY...............................TCCDVAQT.YP.AL...V.SV.........RK...LA.S-----..T..............G..Q.....A...NH..........ECL.HLW...ELL..ECSI-CDP.RVGTQ....IGP...........................................----..---.--P.vIC....TS....FCDSLWKACYD.A.....FFSF...D...S-.....KT.Q.IL..........................SP---.....CG..L-.E..D..ILC........GAAGQWV.SN..GT...E.LC......RSA---.-----....-----................------gfivqpseynvvekqfcyg.............................................
A0A2U3VKW6_ODORO/27-188              ......................................................qcldf-----....--RPPF.RPPQP.....LR-.-F.........................C.AQ.YSAF...............................GCCTPEQD.EA.LA...R.RF.........GA...LAaRVD---..-..............A..A.....E...WA..........ACA.GYA...LDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....EV....YCLDMWQTCRG.V.....FRHL...S...PD.....RE.L.WA..........................LEGNQ....aKF..--.-..-..--C........RYLS---.LD..DT...D.YCf....pHLLVNK.NLNSNl..gRVVAD................AKGCLQ................................................................
A0A452HZT4_9SAUR/26-208              ...........................................................MCMDA....KHHKTE.PGPEE.....ALH.GQ.........................C.VL.WKDN...............................ACCTANTS.TE.AH...Q.DQ.........SY...LY.NFNWNH..C..............G..V.....M...PE..........KCK.QHF...IQD..TCLYECSP.NLGPW....IDQvrgls................................lppgtgWRRE..RIL.NVP..LC....KE....DCELWWEDCQD.A.....ITCK...E...NW.....HK.G.WN..........................WTSGT.....NR..CP.R..G..FMC........QPFKYVF.PR..PA...D.LC......EKIWSN.SYKYT....MEHRG................SGRCIQ................................................................
A0A2K6GLL0_PROCO/22-183              .....................................................rcldfr-----....---PPF.RPPQP.....LR-.-F.........................C.AQ.YSAF...............................GCCAPEQD.AA.LA...R.RF.........GA...LAaRV----..D..............A..A.....V...WA..........ACA.GYA...LDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....QD....YCLDMWQTCRG.L.....FRHF...S...PD.....--.R.VL..........................WSLEG.....NR..A-.-..-..---........KFCHYLS.LD..DA...D.YCf....pHLLVNE.NLNANl..gRVVAD................AKGCLQ................................................................
A0A061F3A3_THECC/42-205              ............................................vcvsqggrfppfsse-----....-----G.KPPKRvgkghKDL.TL.........................C.RV.FRKM...............................TCCDAAQT.HP.AL...L.SI.........RK...LA.L-----..T..............G..E.....A...SP..........ECL.QLW...ELL..ECSI-CDP.RVG--....VRP...........................................----..---.GPP.lIC....TS....FCDRVFQACSN.A.....YFSM...D...A-.....KT.Q.VL..........................APCGV.....ND..F-.-..-..-VC........GRASEWT.SN..GT...E.LC......RAA---.-----....-----................------gfavkqsdvvhggveetscy............................................
R4GC40_ANOCA/31-192                  .............................................qcldfkppfkpsrp-----....------.-----.....-L-.AF.........................C.VQ.YSDF...............................GCCEAERD.AA.LL...R.RY.........YS...VS.---THL..D..............Q..G.....A...YA..........ACA.SHL...QNL..LC-QECSP.YAAHL....YDA..........................................eDPST..PER.TLP.gLC....RD....YCTQVWQNCRS.M.....FRHL...T...SD.....EE.L.LS..........................LENNQ....aK-..--.-..-..-FC........RYLS---.LD..DT...D.YCf....pQLLVNE.NLNQNl..gLVTAD................SEGCLQ................................................................
A0A4X2M5D9_VOMUR/33-172              ...........................................................VCMDA....KHHKIQ.PGPED.....DLH.RQ.........................C.SP.WKKN...............................ACCTANTS.IA.AH...E.DA.........SY...LY.RFNYNH..C..............G..T.....M...AL..........ACK.RHF...IQD..TCLYECSP.NLGPW....IRPvs.......................................ssWRRE..RML.NVP..LC....KE....DCNQWWEDCRT.S.....YTCK...E...NW.....QK.G.WN..........................WTSGE.....AQ..A-.-..-..---........-------.--..--...-.--......------.-----....-----................------pperlg..........................................................
A0A286Y3Q3_CAVPO/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggevlC.GG.FYPR..............................lSCCLRGDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECE.KLL...EEI..KCAF-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRS.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCS....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.SL......DQMEEY.DKVEEi..nRKHKH................NCFCVQ................................................................
A0A446VF58_TRITD/47-198              ................................................fegkppgkaak-----....------.---GR.....RDL.AL.........................C.RI.FRQN...............................TCCDVTQT.FP.AL...L.SV.........RK...LS.S-----..T..............G..E.....G...SG..........ECL.HLW...ELL..ECSV-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFEACSE.A.....YFSI...-...D-.....MK.T.QA..........................LSPCG.....--..L-.G..D..ILC........GKAHKWV.SN..GT...E.LC......RLA-GF.SVQVS....-----................------daglsevdetfcyg..................................................
A0A397XQY0_BRACM/38-198              ......................................cvskggrfppyesagkppnsv-----....------.-GRGS.....KDL.TM.........................C.RV.FRKR...............................TCCSPAQT.TP.AF...V.AV.........RN...LA.TH----..-..............G..E.....A...TQ..........DCL.HLF...ELL..ECSI-CNP.DVG--....TQP...........................................----..---.GPP.rIC....AS....FCDRVFDACKD.A.....YFAS...N...AL.....--.-.-T..........................QTIGP.....CG..VN.D..D..IIC........VKASNWE.SN..GT...S.FC......EAA---.GFAVQ...tNEDSR................EEPC--yg..............................................................
A4S053_OSTLU/1-131                   .........................................................mt-----....------.-----.....---.-F.........................C.DA.HRGS...............................TCCGKEQT.DA.AR...V.RA.........VH...MQ.------..L..............N..G.....F...GE..........RCR.DAW...GAL..ECSV-CDA.RVG--....VSE...........................................----..---.GVP..VC....AA....ACDGVYRACAD.E.....FFAE...D...GS.....RR.L.VP..........................CRPSD.....TI..C-.-..T..KLS........EWIGDVR.DK..GK...E.MC......EAA---.-----....-----................------gwdyvapgerwcfd..................................................
A0A1S3F1E4_DIPOR/45-206              ..................................................cldygppfr-----....------.---PS.....QHL.EF.........................C.SD.YQSF...............................GCCDQHKD.HR.IA...A.RY.........WD...IM.NYFD--..-..............L..R.....S...HE..........LCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPKT..PLR.NLP.gLC....SD....YCSAFHSNCHS.A.....ISLL...T...G-.....--.-.--..........................-DHGL.....QD..SH.D..K..DGA........RFCHLLN.LP..DQ...D.YCf....pN-----.-----....-----................------vlrndhlnrnlgvvaedrqgclq.........................................
A0A384BWL5_URSMA/27-202              ...........................................................VCMNT....KHHKRE.PGPED.....KLY.EE.........................C.IP.WQDN...............................ACCTAGTS.WE.AH...L.DA.........SL...LY.TFSLLH..C..............G..V.....M...MP..........GCE.KHF...LQA..ICFYECSP.NLGPW....IQKvd.......................................ssGPGE..RIL.DVP..LC....QE....DCEQWWEDCRT.S.....YTCK...S...NW.....HG.D.WD..........................RSGGK.....NR..CP.A..R..AVC........HPFPHYF.PT..PA...D.LC......EKIWNH.SFKAS....PEPRN................SGQCLQ................................................................
A0A094K8L7_ANTCR/21-188              ..........................................................g-CLEG....DTHKLK.PSPEP.....NMH.E-.........................C.TL.YSKS...............................SCCYANFT.EQ.LA...R.SP.........VI..kVK.NSYWNR..C..............G..Q.....L...SK..........SCE.DFT...KKI..ECFYRCSP.HAARW....IHP...........................................NNTA..AIR.SVP..LC....QS....FCDDWYEACKD.D.....SICA...H...NW.....LT.D.WE..........................WDENG....eNR..C-.-..R..NKC........IPYREMY.RN..GT...D.MC......QNMWGE.SFKVS....---ES................SCLCLQ................................................................
A0A1E5W2X3_9POAL/37-197              ......................................................lctng-----....----RA.PVPLN.....KTL.GF.........................C.SA.YGGGg............................gsSCCDAAAD.AA.LR...K.RF.........DA...MN.------..-..............-..V.....S...DA..........ACA.GVV...KSV..LC-AECSP.FSAEL....FNSsskiqmv.............................pllcnytSSAS..AAQ.SKD..ST....QD....YCELVWETCKN.V.....TIVN...S...P-.....--.-.FQ..........................PPLQG....sAR..L-.-..P..SSS........SKLTDVW.QS..EN...D.FC......SSFGGS.-----....-----................------sgdqsl..........................................................
A0A2R9CTI8_PANPA/37-208              ...........................................................VCMNA....KYHKTQ.PSPED.....ELY.G-.........................-.--.QKKN...............................ACCMTNTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TGLYECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGI.....NK..CP.A..W..ALC........HTFEPYF.PT..PA...A.LC......EGLWSH.SFKMW...fDSA--................------qgnhnee.........................................................
A0A2K5RGP9_CEBCA/20-181              ..................................................qcldfrppf-----....------.--RPQ.....RLL.AL.........................C.SR.YSVF...............................GCCDEKRD.AE.LT...S.RF.........WA...LA.NR---M..L..............A..A.....E...WA..........DCA.GYA...REL..LC-QECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....QD....YCLTMWQKCRR.L.....LRHL...S...TD.....KK.L.WA..........................LEDNR....dKF..C-.-..-..---........---HYLS.LD..DM...D.YCy....pNLMVN-.-----....-----................------knlssdlghmvadatgclq.............................................
A0A200PWQ4_9MAGN/26-189              .....................................vcisqggrfapfssegkppsia-----....------.-TKGA.....KDL.TL.........................C.RV.FRKS...............................TCCDVAQT.HP.AL...L.TI.........RR...LA.-----S..A..............G..E.....A...NQ..........ECL.QLW...ELL..ECSI-CDP.RVG--....VQP...........................................----..---.GPP.lIC....TS....FCDKVFQACSN.A.....YFSE...D...A-.....KT.Q.VL..........................SPCGF.....GD..--.-..-..FVC........GRVSEWA.SN..GT...E.LC......QLA-GF.ATKSS....-----................------ednsevgiepscy...................................................
A0A096MMB1_PAPAN/36-211              ...........................................................VCMNA....KHHKEK.PGPED.....KLH.EQ.........................C.RP.WKKN...............................ACCSTNTS.QE.AH...K.DV.........SY...LY.RFNWNH..C..............G..E.....M...AP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.NVP..LC....KE....DCEQWWDDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGF.....NK..CP.V..G..AAC........QPFHFYF.PT..PI...V.LC......NEIWTY.SYKVS....NYSRG................SGRCIQ................................................................
S7PD58_MYOBR/36-211                  ...........................................................VCMDA....KYHKTK.PSPED.....KLH.GQ.........................C.SP.WKKN...............................ACCSVNTS.QE.AH...K.DV.........SY...LY.RFNWDH..C..............G..P.....M...KP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRRE..RIL.DVP..LC....KE....DCESWWEDCRT.S.....YTCK...G...NW.....HK.G.WN..........................WTAGS.....NE..CP.V..K..AAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
M1CAU9_SOLTU/41-192                  ..................................................rfsnegkpp-----....----RK.VKKGP.....RDL.NL.........................C.RV.FRGK...............................TCCDVTQT.HP.AF...M.SI.........RR...LA.S-----..T..............G..E.....A...SQ..........ECL.HLW...EML..ECSI-CDP.RVG--....VQA...........................................----..---.GPP.vLC....TS....FCDKVYQACSN.A.....YFSV...D...AK.....-T.Q.VL..........................AP---.....CA..V-.N..D..FVC........GRASEWI.SN..GT...E.LC......RV-AGF.SVKSL....SDDPE................EVSCY-g...............................................................
A0A667ZX62_9TELE/20-179              ...................................................chpqcldy-----....--KPPF.EPRQP.....LVF.--.........................C.KE.YGKF...............................GCCDAEKD.EE.IS...N.RF.........YT..iMD.NFD---..-..............Y..S.....G...YA..........TCG.KYI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.VLP.gLC....GD....YCSDYWHQCRY.T.....LSLL...L...EN.....IQ.D.DR..........................QKFCD....fLE..LK.D..K..QYC........-------.--..--...-.--......------.-----....-----................------ypnvltnaelnenlglvredskgcle......................................
A0A4Z2DXW4_SCHJA/40-184              ..........................................................l-CPDG....KFHKHK.PSAEP.....GLS.KD.........................C.SH.WASL...............................SCCNPQIL.DS.VS...S.TS.........--...LY.QFTHNH..C..............G..N.....L...SD..........KCQ.QVF...QED..LCFYECSP.NTGPWlvtvN-R..........................................kISNE..RFF.GAP..LC....QS....ECEYWWNSCKF.D.....KTCV...T...NW.....NT.H.FN..........................WSTGT.....HF..VP.E..H..A--........-------.--..--...-.--......------.-----....-----................------illfyntks.......................................................
A0A2R6WMZ3_MARPO/42-206              ...........................................vcvsqgsrfpkfslen-----....-HAPRK.ASKGK.....IDL.TL.........................C.RY.YRKK...............................TCCDVVQT.HA.AI...L.TL.........QK...LA.GS----..-..............G..E.....A...SS..........QCL.EQW...EVL..ECSI-CDP.RVG--....ITP...........................................----..---.GPP.lLC....PA....FCESVFSACAD.A.....FFST...D...PL.....-T.Q.ML..........................M----.....PC..GP.K..D..VLC........ARAKEWA.SN..SS...A.FC......QLA---.-----....-----................------gfasvdtrnqfnfleeracyd...........................................
A0A0L0FZI6_9EUKA/26-177              ...............................vvghplcqdftapaianpslqwcdepey-----....------.-----.....---.--.........................-.--.---Rf............................neSCCTVESE.NV.LR...V.AH.........EA...AA.------..L..............T..I.....V...NP..........ECQ.SYL...KQI..LCSS-CDQ.YSAHL....FGT...........................................-ETF..EDR.KVP.mLC....EA....YCSMVYEACKN.E.....SIVS...L...RS.....LV.G.SN..........................Y----.....--..--.-..T..GNG........TTLAEAY.PT..GN...D.FC......------.-----....-----................------gvaaadvssycysg..................................................
F7IF74_CALJA/59-215                  ..........................................................a-C---....GGSRPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagPCCPSEMD.TT.ET...S.GP.........GN...--.--YPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.HLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
C0HAY9_SALSA/29-207                  ...........................................................ACLQD....GRQKAT.PSQEP.....HLK.E-.........................C.TI.YAEN...............................ACCSEDDI.QD.LH...P.MT.........SE...-K.NSPWDK..C..............G..K.....L...SP..........KCE.DFL...KRV..TCFYRCSP.DAARW....PHS...........................................HLQS..SMQ.AVP..LC....HS....FCRDWYEACRM.D.....MTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GNC........VPYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDEEE................------ereggegisndnggrpcgclt...........................................
A0A3B6QER5_WHEAT/44-197              ...............................................fssegkppgkaa-----....------.--KGR.....RDL.AL.........................C.RI.FRQN...............................TCCDVTQT.FP.AL...L.SV.........RK...LS.S-----..T..............G..E.....G...SG..........ECL.HLW...ELL..ECSV-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFEACSE.A.....YFSI...-...--.....-D.T.KT..........................QALSP.....CG..L-.G..D..ILC........GKAHKWV.SN..GT...E.LC......RLA-GF.SVQVS....DASPS................------evvetfcyg.......................................................
A0A5K1VB92_PIG/4-164                 ......................................................aagdp-----....------.-----.....---.-Q.........................C.VP.WKKN...............................ACCSARVS.HE.LH...R.DK.........SS...LY.NFSWEH..C..............G..R.....M...EP..........ACK.RHF...IQN..NCLYECSP.NLGPW....FQEvn.......................................qkWRKE..RFL.NVP..LC....KE....DCLDWWEDCRT.S.....YTCK...S...SW.....HK.G.WN..........................WSSGS.....NQ..CP.T..G..TTC........DTFESFF.PT..PA...A.LC......EGIWNH.DYKFT....NYSRG................SGRCIQ................................................................
A0A2K5LBG7_CERAT/36-211              ...........................................................VCMNA....KHHKAQ.PSPED.....ELY.GQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........LTFESYF.PT..PV...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3Q2WVY0_HAPBU/36-208              .................................................chpqcldykp-----....----PF.EPRQP.....LA-.-F.........................C.KE.YSKF...............................GCCDVEKD.EE.IS...G.RF.........YN..iME.N--FDH..S..............G..-.....-...YA..........ACG.KYV...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.ALP.gLC....GD....YCSDYWQQCRY.T.....LSLL...L...ED.....LG.N.SQ..........................QFANL.....TA..TI.E..E..DHR........RFCEFLV.LK..DK...E.YC......------.-----....-----................------ypsvltnaelnanlgllnedpegcle......................................
K3YUK0_SETIT/45-198                  ..................................................fssegkppg-----....------.RAPKG....rRDL.AL.........................C.RI.FRQN...............................TCCDVTQT.FP.AL...V.SV.........RN...LA.L-----..T..............G..E.....G...GQ..........ECI.HLW...ELL..ECSI-CDP.RVG--....VRP...........................................----..---.GPP.vVC....AS....FCDMVFKACSE.S.....YFSV...-...-D.....MK.T.QA..........................LSPCG.....--..L-.G..D..ILC........GKAHKWV.SN..GT...E.LC......HLA-GF.SVQVS....E----................------tnsglvddtfcyg...................................................
A0A2Y9K9W1_ENHLU/27-201              ...........................................................VCMNT....KYHKQE.PGPED.....QLY.EE.........................C.SP.WRGN...............................ACCRAGTS.LD.AH...L.DL.........PL...LS.NFSLHH..C..............G..V.....M...LP..........GCE.KHF...LQA..VCFYQCSP.NLGPW....IQKld.......................................sgGPGE..RIL.EVP..LC....WE....DCEQWWEDCRT.S.....YTCK...A...DW.....-R.S.WD..........................WSGGK.....NL..CP.A..Q..AFC........HPFPHYF.PT..PV...D.LC......EKIWSH.SFKAS....PEHRN................SGLCLQ................................................................
A0A4W2FC54_BOBOX/39-221              ...........................................................RCLNG....NPPKRL.KKKDR.....RMM.SQpells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........SK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAV-CSP.HSQSL...fYSPe.........................................rEALE..RDL.VLP.lLC....KD....YCTEFFYTCRG.H.....IPG-...-...-L.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2K6AU36_MACNE/36-211              ...........................................................VCMNA....KHHKAQ.PSPED.....ELY.GQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..ACLYECSP.NLGPW....IRQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGI.....NE..CP.A..R..ALC........RTFESYF.PT..PA...A.LC......EGLWSH.SFKVS....NYSGG................SGHCIQ................................................................
G3TYX8_LOXAF/28-189                  ......................................................qcldf-----....--RPPF.RPPQP.....LR-.-F.........................C.TQ.YSGF...............................GCCAAERD.EV.LA...R.RF.........GA...LA.A---SL..D..............A..A.....V...WA..........ACA.GYA...LDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRG.L.....IRHL...S...PD.....RE.L.WA..........................LEGNR....aKF..C-.-..-..---........RYLS---.LD..DA...D.YCf....pRLLVNE.NLNSNl..gRVVAD................AKGCL-q...............................................................
A0A6G1B0V7_CROCR/30-203              ...........................................................VCMDA....KHHKTK.PGPKD.....KLH.D-.........................-.QV.RMEN...............................ACCSLNTC.QE.LH...Q.DP.........SL...LY.NFNLDH..C..............S..K.....M...EP..........TCR.RHF...VQD..NCLYECSP.NLGPW....IQEvk.......................................qsWRKE..RFL.DVP..LC....KE....DCQQWWEDCRT.S.....HTCK...N...NW.....HR.G.WN..........................WSSGF.....NK..CP.A..G..ATC........RTFESYF.PS..PA...A.LC......EGIWSH.SYKLS....NYSRG................SGRCIQ................................................................
Q5CX08_CRYPI/39-218                  ..........................................................f-CLEI....YDNKND.EKHLP....yYFL.NEf......................piC.KE.HERR...............................TCCKKSHS.EA.IS...R.LF.........ST..lVA.R-----..-..............S..S.....L...ST..........RCS.NFY...QKS..LCSY-CDA.DIGVG....-K-...........................................---K..VIQ.KSP.iLC....QS....YCNLWYDACYE.D.....YFDN...I...QNs...yIR.N.IEdi......................sfIRLNL....iPC..TD.S..S..AIC........SPLHAIT.LD..PT...E.FCs....lNGFSTHqDFHSSs..gP---Asl...........teyNTECF-n...............................................................
A0A2U3XGN1_LEPWE/27-177              .........................................................ac-----....GGSRLL.PAMSR.....RHH.RL.........................A.AD.LGTG...............................QLHLAEMD.TP.EA...S.DP.........GM...VP.----ER..C..............G..D.....P...SP..........GCE.SFL...GHL..QVVLHSRF.RLLLL....GRR...........................................----..--Q.AQP..LC....SE....LCDVWFATCEN.D.....ITC-...-...--.....GP.T.WL..........................PLLEK.....RG..C-.-..E..PGC........TTYEQTF.AD..GA...D.LC......RSVLGY.ALPVA....--APG................AGHCLN................................................................
A0A671FX69_RHIFE/26-208              ...........................................................VCMRA....KHHKRE.PSPED.....QLY.EE.........................C.MP.WKDN...............................ACCTFNTS.WE.AH...L.DV.........SL...LY.SFSLLH..C..............G..L.....M...MP..........DCQ.KHF...IQA..VCFYECSP.NLGPW....IQQvvrls................................wevglrGQEE..RIL.DAP..LC....RE....DCEQWWADCHT.S.....YTCQ...S...NW.....HG.S.WD..........................WSRGK.....SR..CP.A..R..APC........HPFPHYF.PT..PA...D.LC......EKIWSN.SFKAS....PERRD................SGRCLQ................................................................
A0A5A9PKT8_9TELE/36-212              ...........................................................RCYDG....SLPKRL.KKKER.....KLS.LEgsg..................ggevC.HR.LYPR..............................vSCCPSRRA.PY.QI...L.HR.........RD...AR.IF----..-..............S..T.....N...NT..........ECS.RLL...EEI..KCAH-CSP.HAQML....FHStk.......................................leKAPH..RAH.DLP.rLC....HD....YCQEFYYTCRG.H.....VPEL...-...-F.....QA.D.V-..........................DEFCQ....yYG..RR.D..G..GLC........FPDFHRK.QL..GR...D.SN......YLLDEK.IEAIN....RKHKH................NCYCTQ................................................................
A0A2U3VBC3_ODORO/30-205              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.TP.WKEK...............................ACCSASTS.QE.LH...K.DT.........SL...LY.NFTWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IWEvn.......................................qsWRKE..RFL.HVP..LC....KE....DCQQWWEDCRT.S.....YTCK...S...NW.....HR.G.WD..........................WTSGF.....NK..CP.A..G..TTC........RTFETYF.PT..PA...A.LC......EGLWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A1A6FW57_NEOLE/34-218              ...........................................................VCMDA....KHHKEK.PGPED.....NLH.NQ.........................C.SP.WKKN...............................SCCSTNTS.QE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...TP..........ECK.RHF...IQD..TCLYECSP.NLGPW....IQQptgqlcapnisyrlclqlqfysgcisevpelktffvnsqvdqsWRKE..RIL.DVP..LC....KE....DCQQWWEDCRT.S.....FTCK...S...NW.....HM.G.WD..........................WTSGK.....ER..VG.W..E..GAC........N------.--..--...-.--......------.-----....-----................------vsgle...........................................................
W2YHK5_PHYPR/33-184                  ..............................................tcrsagvlkfdpe-----....----TH.PMQRT.....KGM.EV.........................C.SK.YRKS...............................TCCNATHA.HA.LR...L.KI.........RE..pVV.------..-..............A..K.....F...SR..........KCQ.ALT...EEM..ACSS-CHP.LMGTW...eMK-...........................................----..---.--N..VC....PS....LCNDWYDACKD.E.....YYAY...-...-G.....GA.G.TL..........................APCYG.....NA..L-.-..-..-VC........SPLKSIA.NS..GA...D.FC......VHM---.GFHVG....-----................------sdsdaegidcfd....................................................
A0A4W3HYK1_CALMI/25-191              ...........................................................RCLVG....NNHKTL.PSPEP.....GMQ.A-.........................C.TK.YSQS...............................SCCYANYT.QQ.LN...V.SP.........LI..kVN.NMYWNT..C..............G..Q.....L...SP..........QCE.QYL...KNV..DCFYHCSP.HAFHW....VNP...........................................NNSY..SII.AVP..IC....RS....YCDDWFTACKN.D.....RTCA...R...NW.....IT.D.WE..........................WNEQG.....NR..C-.-..K..NEC........IPFHQMF.KD..GK...D.LC......ESMWSP.SFNVS....---SS................NCHCL-m...............................................................
A0A4W5P190_9TELE/33-194              ..........................................................q-CL--....DYKPPF.QPREP.....LVF.--.........................C.KE.YAKF...............................GCCDLEKD.DK.IS...Q.NF.........YK...IM.DY-FDY..-..............-..S.....G...YV..........TCA.KYI...RTI..LC-QECSP.YSAHL....YDA..........................................eDANT..PMR.ELP.gLC....GD....YCSEFWHECRY.T.....ISLL...T...DN.....NA.T.VG..........................IEEDR....nKF..C-.-..-..---........NF---LE.LK..DR...E.YC......------.-----....-----................------ypnvlsddklnanlgdvradpegclq......................................
A0A5N4CII2_CAMDR/47-206              .................................................dygppfrpll-----....------.-----.....-HL.EF.........................C.SD.YESF...............................GCCDQRKD.HR.IA...A.RY.........WD...IM.EYF-D-..-..............L..K.....G...HE..........LCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSSCHS.A.....ISLL...T...ND.....HR.L.QK..........................-----.....PH..Q-.-..K..DGA........HFCHLLN.LP..DK...D.YC......------.-----....-----................------fpkvlrsdhlnrnlgvvaedhrgclq......................................
A0A444U9V3_ACIRT/21-186              ..........................................................k-CLDG....KDHRKY.PSADP.....NMK.E-.........................C.TI.YSNS...............................SCCYGNFT.EQ.LV...S.PV.........LI...VD.NTHWDR..C..............G..K.....L...SE..........KCE.VFM...KKI..ECFYQCSP.HAAHW....INP...........................................NYTV..GIL.LAP..LC....LN....FCDNWFEACKD.D.....LTCA...R...NW.....LT.D.FD..........................WNYDG.....NH..C-.-..R..NSC........IPYSQMY.KN..GR...D.LC......QSMWGQ.SFTVS....---ES................PCRCL-r...............................................................
A0A1U8D644_ALLSI/22-189              ..........................................................s-CLEG....DTHKEK.PSPEP.....DMH.E-.........................C.TL.YSKS...............................SCCDADLT.AQ.LD...H.SP.........VI..kVN.NSYWNR..C..............G..N.....L...SK..........SCE.DYT...KKI..ECFYRCSP.YAAHW....INP...........................................NYTA..AIE.FVP..LC....QN....FCDDWYEACKE.D.....LTCV...R...NW.....LT.D.WE..........................WDDNG....vNH..C-.-..K..SDC........SPYSEVF.AN..GT...E.LC......QTLWGH.SFKVS....---ES................SCLCLQ................................................................
A0A1S3JMU8_LINUN/25-193              ..........................................................e-CLPG....NNHKRT.PGPEE.....GTF.GA.........................C.HE.YKNN...............................SCCTAAFT.QT.LS...A.SP.........IV..kVE.DTYWNR..C..............G..N.....L...SR..........SCE.QYK...LSV..ECFYRCSP.NAIYW....KNP...........................................DHPS..AAL.HVP..VC....AE....DCDAWFEACKD.D.....MTCA...T...NW.....LT.D.WN..........................FTKPG....eNH..C-.-..K..MPC........KSFTEIY.KD..GK...G.LC......EKMWGS.TFLYE....---GN................ADKCI-k...............................................................
A0A5D2YDN9_GOSMU/43-205              .........................................cvsqggrfppfssegkpp-----....------.---KRvgkghKDL.TL.........................C.RV.FRKK...............................TCCDAAQT.HP.AL...L.SI.........RR...LA.L-----..T..............G..E.....A...SE..........ECL.HLW...ELL..ECSI-CDP.RVG--....VQP...........................................----..---.GPP.lIC....TS....FCDRVFQACSN.A.....YFSM...D...A-.....KT.Q.VL..........................APCGA.....ND..F-.-..-..-VC........GRASEWA.SN..GT...E.LC......LAA---.-----....-----................------gfrveqsvgmhggieeescy............................................
A0A2K5U027_MACFA/47-222              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........LTFESYF.PT..PV...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
I3LDJ1_PIG/192-248                   ..................................................rgqkpcilp-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................--TGY.....NQ..CP.V..S..AAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SFEVS....SYSRG................SGRCIQ................................................................
A0A2K5LBK9_CERAT/47-110              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...DA..........---.---...---..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------tlsrt...........................................................
A0A087G9F8_ARAAL/33-194              .....................................vciskggrfppyelqgkppkpv-----....------.-GRGS.....KDL.TL.........................C.RV.FRKR...............................TCCSSLQT.NP.AF...V.AV.........RN...LA.TY----..-..............G..E.....A...SQ..........DCL.HLF...ELL..ECSI-CNP.NVG--....IQP...........................................----..---.GPP.rIC....SS....FCDKVFEACKD.A.....YFAS...N...AL.....--.-.--..........................KRVIG....pCG..VN.D..D..IIC........VKASNWE.TN..GT...A.FC......EAA---.GFSVQ...pNDDSR................DEPC--yg..............................................................
C3XSA1_BRAFL/90-235                  ..........................................................l-CHLR....YLHKDT.PGPEP.....DTF.AE.........................C.HP.WKER...............................SCCTEDTV.NS.VQ...K.LK.........ES..yGP.EWHWDR..C..............G..P.....L...SP..........ACE.RFF...IQE..ACFYECEP.NAGLF....RKYpdsdy................................nasdpsHNQW..QMS.GMP..IW....SD....YCDAWHRACRN.D.....QFCA...H...DD.....GN.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------ffscaaiyeevqtmd.................................................
G1M0Y2_AILME/27-208                  ..........................................................a-C---....GGSHPL.PSMSQ.....RHQ.RL.........................A.TD.LGTGqlhltgdhqalvpqsylriqdpnsqespspwSCCPSEMD.TP.EA...S.DP.........AM...VP.----ER..C..............G..D.....P...SP..........GCE.SFL...GHL..QVALHSRF.RLLLL...gIRQ...........................................----..---.AQP..LC....SE....LCDVWFATCES.D.....ITC-...-...--.....GP.T.WL..........................PLLEK.....RG..C-.-..E..PGC........TTYEQTF.AD..GA...D.LC......RSVLGY.ALPVA....--APG................AGHCLN................................................................
A0A2K5UR81_MACFA/26-208              ...........................................................ICMNA....KHHKRV.PGPED.....KLY.EE.........................C.IP.WKDN...............................ACCTLTTS.WE.AH...L.DV.........SP...LY.NFSLIH..C..............G..L.....L...MP..........GCR.KHF...IQA..ICFYECSP.NLGPW....IRPvgslg................................weeapsGQGE..RVV.NAP..LC....QE....DCEEWWEDCRL.S.....YTCK...S...NW.....RG.G.WD..........................WSQGK.....NR..CP.K..G..AQC........LPFSHYF.PT..PA...D.LC......EKTWSN.SFKAS....PERRN................SGQCLQ................................................................
A0A6Q2Z0F9_ESOLU/30-180              ..........................................................q-CL--....DYKPPF.QPREP.....LVF.--.........................C.KE.YAKF...............................GCCDLEKD.DQ.IS...K.NF.........YN..iMD.HFD--Y..-..............-..L.....G...YV..........TCA.KYI...RTI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.DLP.gLC....GD....YCTEFWQQCRY.T.....ISLL...T...DN.....NA.T.AG..........................IEEDR....nKF..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------dllelkdreycypnvlsndklnanlg......................................
A7T9S3_NEMVE/40-169                  ..........................................................y-CP--....YFNNRA.PSPQP.....NLR.N-.........................C.TW.YKEN...............................ACCLPHEL.DS.IL...E.AI.........AP...LT.------..-..............-..G.....A...NN..........RCL.RAF...NYL..MC-YVCAP.YQNMF....YKN...........................................----..--E.RLT..VC....RD....FCDTIFQSCGD.A.....FLKG...S...RI.....SS.A.--..........................YKSGE.....EF..CE.-..-..---........-------.--..--...-.--......------.-----....-----................------srkfivadgkskncftsiq.............................................
G3WEP6_SARHA/39-222                  ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQldsls...............gaeavC.GA.FYPR..............................lSCCSRIDS.QS.LL...H.ME.........SK...IF.S-----..-..............V..T.....N...NT..........ECM.KLL...EEI..RCAH-CSP.HSQNL....FHSpe.......................................rgEASE..RDL.ALP.lLC....ED....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.SA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..TS...N.YL......DQMEEY.DKVDEi..sRKHKH................SCFCAQ................................................................
A0A3B6NQI2_WHEAT/47-198              ................................................fegkppgkaak-----....------.---GR.....RDL.AL.........................C.RI.FRQN...............................TCCDVTQT.FP.AL...L.SV.........RK...LS.S-----..T..............G..E.....G...SG..........ECL.HLW...ELL..ECSV-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFEACSE.A.....YFSI...-...D-.....MK.T.QA..........................LSPCG.....--..L-.G..D..ILC........GKAHKWV.SN..GT...E.LC......RLA-GF.SVQVS....-----................------daglsevdetfcyg..................................................
A0A093PCA7_9PASS/3-129               ........................................................lsv-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETAE..REL.TLP.yLC....RD....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCY....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..nRKHKH................NCFCIQ................................................................
A0A2K5D9H1_AOTNA/30-205              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WRKN...............................ACCTADTS.QE.LH...K.DT.........SR...LY.NFNWEH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........RTFEFYF.PT..PA...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A2K6ESG4_PROCO/44-206              ..............................................qcldygppfqlpl-----....------.-----.....-HL.EF.........................C.SD.YKSF...............................GCCDQHKD.RR.IA...A.RY.........QD...IL.EYLD--..-..............P..K.....S...HE..........LCG.GYI...KDI..LCQV-CSP.YAAHL....YGA..........................................qDART..PLR.PLP.gLC....AD....YCSAFLSRCPA.A.....TSLL...-...--.....-T.-.--..........................GDHGL.....RA..TR.G..Q..DSA........TFCHLLR.LP..DQ...D.YCf....pNVLRSH.RLARTp..gAAATG................PRGC--lr..............................................................
A0A2Z7AWH8_9LAMI/33-193              ..........................................vcisqggrfprfanegk-----....--PPKK.ASKGP.....KDM.TL.........................C.RV.FRKR...............................SCCDVTQT.HP.VL...L.SI.........RR...LA.SF----..-..............G..E.....A...TQ..........DCL.QLW...EFL..ECSI-CDP.RVG--....VQP...........................................----..---.GPP.cIC....AS....FCNRVYEACST.A.....YFSM...-...DV.....KT.Q.VL..........................APCGS.....--..--.G..D..FVC........GRAFEWV.SN..GT...E.LC......HAS---.GFSV-....-----................------ssfndpeetscyg...................................................
G1RQQ9_NOMLE/17-170                  ................................mswdptasvpkpylniqdpgsqrsplp-----....------.-----.....---.--.........................-.--.---G...............................PCCPSEMD.TT.ET...L.GL.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..K..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A3Q4HYE0_NEOBR/5-166               ..................................................qcldfkppf-----....------.R--PR.....KEL.EF.........................C.IM.YKEF...............................GCCDYQKD.QE.LM...S.KY.........YQ..iMD.HFD---..-..............Y..S.....G...YA..........SCA.GFI...FDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....SE....YCFQFWNKCSF.T.....IPF-...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------lsgdpyianfrenqtslchyleiqdkdycyphllsnqqltqnlggiqvnsdgclq.........
A0A5N3XBI4_MUNRE/35-210              ...........................................................VCMDA....KHHKAE.PGPED.....SLH.EQ.........................C.SP.WRKN...............................ACCSVNTS.IE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IREvn.......................................qsWRRE..RVL.GVP..LC....KE....DCQIWWEDCRT.S.....YTCK...S...NW.....HK.G.WD..........................WTSGY.....NQ..CP.V..K..AAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SYKVS....NYGRG................SGRCIQ................................................................
A0A087R786_APTFO/31-206              ...........................................................ICMDA....KHHKTK.PGPEG.....MLH.DQ.........................C.AP.WKDN...............................ACCTANTS.LE.AH...K.DQ.........SN...LY.NFNWNH..C..............G..L.....M...PP..........KCK.SHF...IQD..TCLYECSP.NLGPW....IDQad.......................................ssWRRE..RIL.HVP..LC....KE....DCEAWWEDCKD.Y.....VTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFSHVF.PQ..PK...D.LC......EKIWSN.SYKYT....TEHRG................SGRCIQ................................................................
A0A0E0NH61_ORYRU/49-201              .............................................fssegkrpgraakg-----....------.----R.....RDL.AL.........................C.RV.FRQN...............................TCCDVSQT.FS.AL...L.SV.........RK...LA.S-----..T..............G..E.....G...SQ..........ECL.HLW...ELL..ECSI-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFKACSE.A.....YFAI...-...D-.....VK.T.QA..........................LSPCG.....--..L-.G..D..ILC........GKAHKWV.SN..GT...E.LC......RSA---.-----....-----................------gfsvqalettsggvddtfcy............................................
A0A2I4BP03_9TELE/38-210              ..............................................chpqcldykppfg-----....------.--PQQ.....PLV.F-.........................C.KE.YTKF...............................GCCDLNKD.AE.IS...T.RF.........YK..iMD.NF--DH..-..............-..S.....G...FT..........TCG.KYI...RTI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.VLP.gLC....RD....YCSDYWRECRY.T.....LSLL...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------ledlgnpqqfanxtsaleedhkrfcdflelkdkqycypnvltdaelnanlglvredpkgcle..
G3QHP1_GORGO/59-215                  ..........................................................a-C---....GGSRPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagPCCPSEMD.TT.ES...S.GP.........GN...--.--HPER..C..............G..V.....P...SP..........QCK.SFL...EHL..QRALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFVNCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A384AQ25_BALAS/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........SK...MF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lLC....KD....YCKEFFYTCRG.H.....VPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2K6A9J8_MANLE/34-196              ...........................................................VCMNA....KQHKAQ.PSPED.....ELH.G-.........................-.--.----...............................QSCVFPTH.QE.LH...K.DT.........SH...LY.NFNWDH..C..............G..K.....M...EP..........ACK.CHF...IQD..TCLYECSP.NLGPW....ICW...........................................-RKE..RIL.NVP..LC....KE....DCERWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGI.....NE..CP.A..R..ALC........RTFESYF.PT..PA...A.LC......EGLWSH.SFKVS....NYSGG................SGRCIQ................................................................
H2QZT5_PANTR/22-183                  ...................................................qcldfrpp-----....-----F.RPPQ-.....-PL.RL.........................C.AQ.YSDF...............................GCCDEGRD.AE.LT...R.RF.........WA...LAsRVD---..-..............A..A.....E...WA..........ACA.GYA...RDL..LC-QECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRG.L.....FRHL...S...TD.....QE.L.WA..........................LEGNR....aRF..C-.-..-..---........RY---LS.LD..DT...D.YC......------.-----....-----................------fpyllvnknlnsnlghvvadakgclq......................................
A0A340X670_LIPVE/23-112              ..........................................................a-C---....GGSHPL.PARSQ.....STI.GL.........................A.TN.LGTS...............................QLHLAEMN.TP.EA...S.DP.........GI...VS.----GR..C..............G..V.....L...SP..........GCE.SFL...GHL..QVALRSRF.HLLLL...gVRQ...........................................----..---.TQP..LC....SE....LCDAW------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------................................................................
A0A5J9V1V7_9POAL/46-199              ...................................................fssegkpp-----....-----G.KAPKG....rRDL.AL.........................C.RI.FRQK...............................TCCDVTQT.FP.AL...V.SV.........RN...LA.L-----..T..............G..E.....G...NQ..........ECL.HLW...ELL..ECSI-CDP.RVG--....VRS...........................................----..---.GPP.vVC....AS....FCDMVFKACSE.A.....YFSV...-...DM.....KT.Q.V-..........................LSPCG.....--..L-.G..D..ILC........GKAHKWV.SN..GT...D.LC......RLA-GF.SVQVS....ETS--................------sggvddtfcyg.....................................................
A0A2H5PYP7_CITUN/19-195              .............................................vcvsqggrfapfss-----....----EG.KPPERaskgrSDL.TL.........................C.RV.FRKK...............................TCCDAAQT.HP.AL...L.SI.........RK...LA.S-----..T..............G..E.....A...SQ..........ECL.HLW...ELL..ECSI-CDP.NVG--....VQP...........................................----..---.GPP.lIC....AS....FCERVYQACSN.A.....YFSM...D...AK.....TQ.F.FVpvcw.................ycnlsMQVLA....pCG..V-.N..D..FVC........GRAAEWV.SN..GT...E.LC......HAA---.-----....-----................------gfavklpddryidgeetsc.............................................
A0A2P6NF93_9EUKA/60-205              ......................................................gtcin-----....----KV.RTQAP.....RSN.SN.........................C.GW.YNDY...............................ACCTQYDT.LG.YD...Y.--.........--...-N.NVRDSG..C.............aG..P.....I...DG..........RCT.DYI...ILT..DCALACSP.NITST....MVG...........................................----..TTP.QIQ..IC....SS....LADTIWKKCKY.S.....SVK-...-...EW.....TK.G.V-..........................-----.....--..--.-..-..--C........VALNTVF.DN..ST...D.FV......ENS---.-----....-----................------lnmiyyngtdttqcwnaavla...........................................
A0A096MUB4_PAPAN/36-211              ...........................................................VCMNA....KHHKAQ.PSPED.....ELY.GQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..ACLYECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGI.....NE..CP.A..R..ALC........RTFESYF.PT..PA...A.LC......EGLWSH.SFKVS....NYSGG................SGRCIQ................................................................
A0A3Q3MUQ5_9TELE/35-196              ..............................................qcldfkppfrplr-----....------.-----.....-EL.EF.........................C.VM.YKEF...............................GCCDYQKD.QE.LM...T.KF.........YQ..vMR.NFD---..-..............Y..Y.....G...YA..........NCA.GFV...LEL..LC-QECSP.YAAHL....FDA..........................................eDPNT..PVR.TIP.gLC....PD....YCSQFWKKCSS.T.....IPFL...T...D-.....NP.H.VA..........................-----.....-K..I-.K..E..DHT........RLCQYLE.LD..DM...D.YCy....pHLLSNQ.NLTQNl..gRVQSD................SDGCLQ................................................................
A0A6A1QAN0_BALPH/114-197             ...............................................plriltypglsl-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....P...MS..........RCE.SFL...EHL..QVALRSRF.HLLLL...gVRQ...........................................----..---.TQP..LC....SE....LCDAWFATCES.D.....IIC-...-...--.....SP.T.WL..........................PLLEK.....RG..C-.-..E..PGC........TTY----.--..--...-.--......------.-----....-----................------g...............................................................
A0A2Y9DVM5_TRIMA/36-211              ...........................................................VCMDA....KHHKEK.PSPED.....ELH.DQ.........................C.GP.WKKN...............................SCCSVNTS.QE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.NVP..LC....KE....DCQNWWEDCRT.S.....YTCK...I...NW.....HK.G.WN..........................WTSGH.....NQ..CP.A..E..AQC........APFDVYF.PT..PD...V.LC......NEIWSH.SYKAS....NYTRG................SGRCIQ................................................................
A0A556V3U1_BAGYA/30-191              ..........................................................q-CL--....DYKPPF.QPQEP.....LFF.--.........................C.KE.YAKF...............................GCCDSEQD.KQ.IS...Y.RF.........DQ...IM.DY-FDH..S..............G..F.....L...--..........VCG.KYI...RNI..LC-QECSP.YAAHL....YDA..........................................eNANT..PMR.ELP.gLC....RD....YCSDYWHHCRY.T.....LSLL...T...DN....nIT.T.II..........................EEHLD.....KF..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------dylelkdpeycypnvlannelnanlgsvqsdpkgciq...........................
A0A3Q1C9Y7_AMPOC/26-199              ................................................cchpqcldykp-----....----PF.QPHQ-.....PLV.F-.........................C.KE.YSKF...............................GCCDVEKD.EQ.IS...H.RF.........YT..iME.N--FDH..S..............G..Y.....V...--..........TCG.RYI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.MLP.gLC....GD....YCSDYWHQCRY.T.....LGLL...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------ledsespqqfanltatieedrrkfcdflelkdqqycypnvltntelnanlglvredpkgcle..
A0A2Y9JXW6_ENHLU/44-206              ...............................................qcldygppfqpp-----....------.-----.....VHL.EF.........................C.SD.YESF...............................GCCDQHKD.RR.LA...A.RY.........RD...IM.DYFD--..-..............L..R.....G...HE..........LCG.GYV...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....SD....YCSAFHSSCHS.A.....ISLL...T...ND.....-R.H.LQ..........................GSH--.....--..--.E..K..DGA........HFCHLLN.LP..DE...D.YCf....pNVLRND.HLNRNl..gVVAKD................QQGCL-q...............................................................
A0A553MY15_9TELE/3-164               ......................................................mndid-----....------.-----.....---.TI.........................C.SP.WKDN...............................ACCTANTS.QE.AH...E.DN.........SY...LY.NFNWNH..C..............G..V.....M...SD..........KCK.QHF...IQD..TCFYECSP.HLGPW....IQKan.......................................edWRKE..RIL.DVP..LC....LE....DCESWYDDCKN.D.....FTCK...D...NW.....HK.G.WD..........................WSTDT.....NR..CP.V..N..TRC........RPWTEVF.PS..AE...E.MC......EKIWSN.SYKFT....SLKRE................SGRCM-r...............................................................
S7MV48_MYOBR/31-206                  ...........................................................VCMDA....KHHKEK.PSPED.....KLH.EQ.........................C.SP.WKKN...............................ACCSVNTS.QE.AH...K.DV.........SY...LY.RFNWDH..C..............G..P.....M...KP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRRE..RIL.DVP..LC....KE....DCESWWEDCRT.S.....YTCK...G...NW.....HK.G.WN..........................WTAGS.....NE..CP.V..K..AAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
L5LF69_MYODS/124-301                 ............................eekdveekliengrqisyhrfrvssllsktk-----....------.-----.....---.--.........................-.--.----...............................DKCLQTDE.DL.LT...G.IE.........SI...HN.RFNWDH..C..............G..P.....M...KP..........SCK.RHS...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKD..QIL.NVP..LC....KE....DCESWWEDCCT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGS.....NE..CP.V..K..AAC........HRFDFYF.PT..PA...A.LC......SEIWRH.SYKVS....NYSRG................SGRCI-................................................................
RTBDN_CANLF/27-177                   ..........................................................a-C---....GGSRPL.PALSR.....RHH.RL.........................A.AD.LGTG...............................QLHLAEMD.TP.EA...S.GP.........GM...VS.----EH..C..............G..K.....P...SP..........GCE.SFL...GHL..QVALHNRF.RLLLL...gIRQ...........................................----..---.AQP..LC....SE....LCDIWFATCES.D.....ITC-...-...--.....GP.T.WL..........................PLLEK.....RG..C-.-..E..PRC........TTYEQTF.AD..GA...D.LC......RSVLGY.ALPVA....--APG................ADHCLN................................................................
A0A2G3AXK6_CAPCH/39-189              ...................................................fsnegkpp-----....----RK.VKKGP.....RDL.NL.........................C.RV.FRGK...............................TCCDVTQT.HP.AL...I.SI.........RR...LA.-----S..T..............G..E.....A...SQ..........ECL.HLW...EML..ECSI-CDP.RVG--....VQA...........................................----..---.GPP.vLC....TS....FCDKVYQACSN.A.....YFAI...D...A-.....KT.Q.VL..........................AP---.....CA..V-.N..D..FVC........GRASEWI.SN..GT...E.LC......HV-AGF.SVKSM....SDDPE................EVSCY-g...............................................................
H2RXT6_TAKRU/19-188                  ....................................................qcldykp-----....----PF.QPQQ-.....PLV.F-.........................C.KE.YSKF...............................GCCDLQKD.EE.IR...I.RF.........YT..iME.--NFDH..S..............G..Y.....V...--..........TCS.RYI...HSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.ILP.gLC....GN....YCADYWHRCRY.T.....MSLL...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------ledlgvlhqyanitmaieedrkrfcdflelkdkqycypnvltsaelnanlgfvrenpkgcle..
A0A267GXH9_9PLAT/30-181              ...............................kaaqqeedqkthkatkskctffagtrys-----....------.-VPES.....SLV.N-.........................C.YW.YNRN...............................ACCKRIEV.TS.VF...S.SL.........--...LS.KL----..-..............E..G.....Q...SR..........RCY.DML...RYL..LC-YFCSP.EQHFW....FRD...........................................----..--N.KVF..VC....KS....FCDDIYSHCRS.A.....VMNG...L...EF.....GK.A.FK..........................N----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------gedfcrgnnfavqednvacfafdptqfd....................................
A0A402E919_9SAUR/36-218              ...........................................................RCLNG....SPPRRL.KKRDR.....RLL.LLepph................gveltC.RG.FYPR..............................lSCCPRAQS.QS.WL...Q.LS.........EN..kIF.------..S..............V..T.....N...NT..........ECV.KLL...QEI..KCAH-CSP.NAQNL....FHSt........................................ekEALE..REL.VLP.fLC....KD....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TV..........................DEFCF....yYA..RK.D..G..GSCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.GKVEEi..sRKHKH................NCFCI-h...............................................................
A0A6H5FV41_9HEMI/2-75                ....................................................pllvqge-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................DKQE..FVK.DVP..LC....RS....DCENWFEACAD.A.....TTCT...T...NW.....RA.A.-H..........................DDPNF.....SC..IG.D..N..KNC........QTFKKKF.GT..AE...T.FC......R-----.-----....-----................------e...............................................................
A0A493SVL6_ANAPP/26-124              ...........................................................VCMDA....KHHKTK.PGPEG.....TLH.GQ.........................C.AP.WKDN...............................ACCTANTS.SE.AH...R.DQ.........SY...LY.NFNWNH..C..............G..V.....M...PP..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQ...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------ghlhlsywvwtglcl.................................................
A0A6I8R932_XENTR/24-181              ...........................................................VCMDG....KHQKVE.PGKED.....ALH.GQ.........................C.TP.WKDK...............................SCCTANTS.QE.AH...N.DQ.........SY...LY.NFNWDH..C..............G..I.....M...AP..........ACK.THF...IQD..TCFYECSP.NLGPW....IQK...........................................----..---.---..--....--....DCDGWYNDCKL.E.....YTCM...E...NW.....HK.G.WN..........................WTSGT.....NQ..CP.N..G..TKC........RRVFEVF.PS..AA...D.FC......EKIWSN.SYKYS....DERRG................SGRCMQ................................................................
A0A384BNF0_URSMA/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggeilC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................EEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCLQ................................................................
A0A2Y9MWE7_DELLE/30-205              ...........................................................VCMDA....KHHKIK.PGPED.....KLH.DQ.........................C.IP.WKKN...............................ACCSAKVS.QE.LH...R.DT.........SS...LY.NFNWEH..C..............G..K.....M...KP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.NVP..LC....KE....DCQSWWEDCRT.S.....YTCK...T...NW.....QK.G.WN..........................WTSGS.....NK..CP.T..G..TTC........GTFEFYF.PT..PA...A.LC......EGLWSN.SYKLS....NYSRG................SGRCIQ................................................................
A0A6A5EXL5_PERFL/50-225              ...........................................................MCMDA....KHHKVE.PGPEG.....ELY.LQ.........................C.TP.WRDN...............................ACCTANTS.TE.AH...N.DN.........SY...LY.NFNWNH..C..............G..I.....M...SP..........QCK.KHF...TQD..TCFYECSP.HLGPW....IQPvd.......................................qtWRKE..RIL.DVP..LC....KE....DCHQWWDDCKD.D.....YTCK...T...DW.....HK.G.WD..........................WSSKV.....NK..CP.A..G..SKC........RKWTEIY.PT..PK...S.MC......EQIWSN.SYLYT....TYSKT................SGRCMQ................................................................
A0A3B5QDK3_XIPMA/26-201              ...........................................................VCLQD....GKHKAT.PGAEP.....RLS.E-.........................C.GL.YADN...............................SCCTEEDI.QD.IA...Y.VP.........SD..sNK.NEPWDK..C..............G..P.....L...SS..........ECE.GYL...KRV..SCFYRCSP.DASRW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRM.D.....MTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GTC........VQYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDDQQeagen......gaegrPCGCL-t...............................................................
A0A4D9F027_9SAUR/35-217              ..........................................................k-CLNG....NPPRRL.KKRER.....RMM.FLepas................ggemmC.RG.LYPR..............................lSCCSRTDS.QG.LL...H.IE.........TK...IF.S-----..-..............V..T.....N...NT..........ECV.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgEASE..REL.ALP.fLC....KD....YCKEFYYTCRG.Q.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A3M6V221_9CNID/29-195              ..........................................................k-CIDG....PYHKDK.PSPEG.....PDY.VE.........................C.QP.WKEN...............................TCCTAGFT.AQ.LE...K.SN.........VE..vLY.NFSWHH..C..............G..N.....L...SK..........ECE.RYI...KNE..ECFYSCEP.SLIKW....HT-...........................................-SGG..GVK.QVP..IC....AD....YCDKWYDACKN.D.....MTCA...E...DW.....LA.D.FN..........................FTLSQ.....YS..CR.T..D..SKC........LRFSELY.KD..GE...G.LC......NKMWGQ.SFTYE....----K................SNNCM-v...............................................................
G1PPC7_MYOLU/2-153                   .........................................................gg-----....------.-----.....---.--.........................-.--.--KN...............................ACCSVSTS.QE.LH...K.DT.........SL...LY.NFNWDH..C..............G..K.....M...KP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvn.......................................dsWRRE..RFR.NVP..LC....KE....DCESWWEDCRT.S.....YTCK...S...DW.....HK.G.WN..........................WTSGS.....NK..CP.A..Q..AVC........RTFESYF.PT..PA...A.LC......EGLWSH.SYQVS....QYSRG................SGRCIQ................................................................
A0A671G275_RHIFE/48-206              ..................................................ygppfrplf-----....------.-----.....-HL.EF.........................C.SD.YESF...............................GCCDHSKD.LR.IA...A.RY.........WD..iMD.YFD---..-..............L..K.....G...HE..........LCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....AD....YCSAFHSNCHS.A.....ISLL...T...SD.....-R.R.LQ..........................E----.....--..TH.G..K..DGT........HFCHLLN.LP..DK...D.YC......------.-----....-----................------fpnvlrnghlnrnlglvaedpqgclq......................................
A0A1S3JFL1_LINUN/32-204              ...................................................kcvtlpve-----....GASKTR.PSPEP.....GLE.--.........................C.PS.FRKR...............................SCCYVNAV.AN.IL...E.NH.........VW...NE.MITYMH..Cp...........qkP..R.....L...SP..........ECE.RLT...FEQ..SCFYACSP.NLGPW....IYR..........................................yLHFD..ALD.NAP..LC....AS....QCNKWWDACKE.E.....YTCH...R...NW.....IT.D.MD..........................W-NGL.....NT..CK.E..G..SVC........RKYTEFY.NS..ST...D.FC......STVFNG.AYKVV....---PD................SEPCM-v...............................................................
A0A672V311_STRHB/26-201              ...........................................................ICMDA....KHHKTK.PGPEG.....MLY.DQ.........................C.AP.WKDN...............................ACCTANTS.LE.AH...R.DQ.........SN...LY.NFNWNH..C..............G..V.....M...PR..........KCK.HHF...IQD..TCLYECSP.NLGPW....IDQad.......................................ssWRRE..RIL.HVP..LC....RE....DCEQWWEDCKD.Y.....VTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFSQVF.PR..PK...D.LC......EKIWSN.SYRYT....TEQRG................SGRCIQ................................................................
A0A0D9R2L1_CHLSB/1-120               .................................................mdtteisspg-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.-NHPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................AHHCFN................................................................
A0A485P7N9_LYNPA/2-164               .......................................................cssv-----....------.-----.....-FS.TQ.........................C.TP.WRKN...............................ACCSHNTS.QE.LH...K.DP.........SL...LY.NFNLDH..C..............G..K.....I...EP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQQWWEDCRT.S.....YTCK...N...NW.....HK.G.WD..........................WSSGS.....NK..CP.A..G..ATC........RTFETYF.PT..PA...A.LC......EGIWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A2K6SEV9_SAIBB/48-206              ..................................................ygppfrpll-----....------.-----.....-HL.EF.........................C.SD.YESF...............................GCCDQDKD.RR.IA...A.RY.........WD..iME.YFD---..-..............L..K.....R...HE..........LCG.DYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHS.A.....ISL-...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------ltgdrglqeppgtdgarfchlldlpdkdycfphvlrndhlnrhlgvvardprgclq........
A0A3Q4MBB3_NEOBR/34-195              .....................................................tvriti-----....------.-----.....---.-N.........................C.SP.WRDN...............................ACCTANTS.AE.AH...D.DA.........SY...LY.NFNWNH..C..............G..I.....M...SK..........ECK.KHF...IQD..TCFYECSP.HLGPW....IQPvd.......................................qsWRKE..RIL.DVP..LC....KE....DCETWWEDCKN.D.....ITCK...D...NW.....HK.G.WD..........................WSSGI.....NK..CP.E..G..SKC........SKWTDFF.PT..PK...S.MC......EKIWSN.SYIYT....TYTKT................SGKCMQ................................................................
U3JUU5_FICAL/47-222                  ...........................................................ICMDA....KHHKTE.PGPEG.....QLY.GQ.........................C.VL.WKDN...............................ACCTANTS.ME.AH...Q.DQ.........SY...LY.NFNWDH..C..............G..A.....M...PE..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQad.......................................ssWRKE..RIR.DVP..LC....QE....DCEQWWEDCQD.A.....VTCK...A...NW.....HT.G.WN..........................WTTGT.....NQ..CP.K..G..AMC........QKFKYVF.PT..AA...E.LC......EQVWSG.SYRYT....SQHRG................SGRCIQ................................................................
I3M7G9_ICTTR/27-208                  ..........................................................a-C---....GGSHQF.QARSQ.....GHL.GL.........................A.SN.LGTNqvqlagdlqasgpqpymmiqdpdsqafplpePCCPSEMD.TP.ET...S.GP.........GI...FP.----PR..C..............G..T.....P...SS..........GCE.SFL...GHL..QRALRNRF.HLLLL...gVRQ...........................................----..---.APP..LC....EE....LCQNWFATCEA.D.....ITC-...-...--.....GR.T.WL..........................WPSGK.....RS..C-.-..E..GRC........RTYGQTF.AD..GV...D.LC......RSVLGH.ILPVA....--APG................SRHCLN................................................................
A0A078G0I8_BRANA/33-173              .................................................vaeseavnss-----....------.--ENA.....LHL.NL.........................C.NA.FHGN...............................TCCSSSLA.LQ.NL...-.-A.........T-...-H.------..-..............G..E.....A...SK..........DCL.YLF...ELL..ECSI-CHP.DVG--....-GP...........................................----..---.-LR..IC....AS....FCDSVFKACSD.A.....YFST...S...DS.....TN.Q.VI..........................VPCGA.....RN..G-.-..T..YIC........EKASKLE.TN..GT...S.FC......EAV---.-----....-----................------gfsvqagddsvevpcy................................................
A0A673TNZ0_SURSU/26-201              ...........................................................VCMNT....KHHKQK.PGPED.....KLY.EE.........................C.IP.WKDN...............................ACCTASTS.WE.AH...L.DV.........SL...LY.NFSLIH..C..............G..L.....M...MP..........GCE.KHF...NQA..VCFYECSP.NLGPW....IQKmd.......................................lsGPGE..RIL.DVP..LC....QE....DCEEWWEDCRT.S.....YTCK...S...NW.....HS.D.WD..........................WSRGK.....NR..CP.R..R..AVC........HPFPHYF.PT..PA...D.LC......EKIWNN.SFKAS....PERRN................SGLCLQ................................................................
U6MBN1_EIMMA/1-87                    ..............................................mceprfgtgeyes-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................----..-KG.KAV..LC....PE....LCEKWFNACKE.E.....FVSA...S...PS.....GS.S.SA..........................LTFCE.....--..-D.S..S..LIC........SRLSATL.GD..SI...S.FC......RQM-G-.-----....-----................------yevpeddggvsl....................................................
A0A0Q3UR77_AMAAE/25-186              ....................................................qcldfkp-----....----PF.RPPRG.....LA-.-F.........................C.RR.YAEF...............................GCCDLRRD.RA.LL...Q.RF.........YR...LS.---ARL..D..............G..P.....T...YA..........ACA.GHL...QDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCLQVWQKCRS.I.....FHYL...S...AD.....QE.L.IA..........................LENNA....aKF..C-.-..-..---........RYLS---.LE..DT...D.YCf....pHXLANQ.NLNQ-....-----................------nlglvtadaegclq..................................................
H3AU75_LATCH/19-181                  ................................................qcldyrppfkp-----....------.----A.....YHL.EF.........................C.SQ.YDTF...............................GCCDQDKD.NE.IA...E.RY.........WD...IM.DFFD--..-..............Y..Q.....G...HE..........LCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eDLET..PLR.SIP.gLC....FD....FCNELVVKCAS.S.....IVLL...-...--.....TD.D.WR..........................I--LE.....AC..QQ.D..R..AGC........CDLLN--.IP..DQ...D.YC......------.-----....-----................------ypnvlkntilnrklgavvedpagclq......................................
A0A3Q1GX10_9TELE/23-198              ...........................................................MCMDA....KHHKEE.PGPEG.....KLY.LQ.........................C.AP.WRDN...............................ACCKANTT.EE.AH...N.DN.........SY...LY.NFNWNH..C..............G..A.....M...SP..........QCK.KHF...IQD..TCFYECSP.HLGPW....IQLav.......................................esWRKE..RIL.DVP..LC....KE....DCESWWEDCKN.D.....YTCK...T...NW.....HK.G.WD..........................WSSGV.....NQ..CP.A..D..TKC........QKWTEVF.PT..PK...S.MC......EQIWSK.SYLYT....TLSKD................SGRCMQ................................................................
A0A3Q7X8Q3_URSAR/4-176               .............................................hllqspealtlpac-----....------.-----.....-HR.IQ.........................C.SP.WKKN...............................SCCFTNTS.EE.AH...K.DI.........SY...LY.KFNWNH..C..............G..H.....M...TP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.DVP..LC....KE....DCQQWWEDCRT.S.....YTCK...S...NW.....HK.G.WD..........................WSSGY.....NR..CP.A..G..AAC........LPFHFYF.PT..SA...A.LC......SEIWSH.SYKPS....NYSRG................SGRCIQ................................................................
A5PJW9_BOVIN/38-220                  ...........................................................RCLNG....NPPKRL.KKKDR.....RMM.SQpells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........SK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAV-CSP.HSQSL...fYSPe.........................................rEALE..RDL.VLP.lLC....KD....YCTEFFYTCRG.H.....IPG-...-...-L.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A067EMB2_CITSI/29-192              .............................................vcvsqggrfapfss-----....----EG.KPPERaskgrSDL.TL.........................C.RV.FRKK...............................TCCDAAQT.HP.AL...L.SI.........RK...LA.S-----..T..............G..E.....A...SQ..........ECL.HLW...ELL..ECSI-CDP.NVG--....VQP...........................................----..---.GPP.lIC....AS....FCERVYQACSN.A.....YFSM...D...A-.....KT.Q.VL..........................APCGV.....ND..F-.-..-..-VC........GRAAEWV.SN..GT...E.LC......HAA---.-----....-----................------gfavklpddryidgeetscy............................................
A0A668A834_9TELE/38-203              ...................................................chpqcldy-----....--KPPF.EPRQP.....LVF.--.........................C.KE.YGKF...............................GCCDAEKD.EE.IS...N.RF.........YT..iMD.NFD---..-..............Y..S.....G...YA..........TCG.KYI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.VLP.gLC....GD....YCSDYWHQCRY.T.....LSLL...L...EN.....IQ.G.TGt........................gKDDRQ.....KF..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------dflelkdkqycypnvltnaelnenlglvredskgcle...........................
A0A2R9C5Y0_PANPA/26-208              ...........................................................ICMNA....KHHKRV.PSPED.....KLY.EE.........................C.IP.WKDN...............................ACCTLTTS.WE.AH...L.DV.........SP...LY.NFSLFH..C..............G..L.....L...MP..........GCR.KHF...IQA..ICFYECSP.NLGPW....IQPvgslg................................wevapsGQGE..RVV.NVP..LC....QE....DCEEWWEDCRM.S.....YTCK...S...NW.....RG.G.WD..........................WSQGK.....NR..CP.K..G..AQC........LPFSHYF.PT..PA...D.LC......EKTWSN.SFKAS....PERRN................SGRCLQ................................................................
A0A2K5DCK6_AOTNA/22-181              ...................................................qcldfrpp-----....------.-FRPQ.....QLL.SL.........................C.SR.YSAF...............................GCCDEKRD.AE.LT...S.RF.........WS...LA.NR---M..L..............A..A.....E...WA..........DCA.GYA...REL..LCQVSGRA.ATARA....EDP...........................................--ST..PLR.TVP.gLC....QD....YCLTMWQKCRR.L.....IRH-...-...--.....--.-.FS..........................TDKEL.....QA..L-.E..D..NRD........KFCHRLS.LD..DA...D.YCy....pNLMVNK.NLNSDl..gHMVTD................ATGCLQ................................................................
A0A1S3HE47_LINUN/1-143               ................................................mttsfledhqw-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...MN.MTDYGH..Cp...........qkP..R.....L...SP..........ECE.RLN...HDE..VCFFACSP.NSGPW....IVKgt.......................................esPFNH..RLK.HLP..LC....AS....QCDKWWNACKE.E.....YTCH...R...NW.....LT.D.PA..........................WDANG....vNI..CP.K..D..AVC........KKYTEMY.TS..AA...D.FC......NTIWDG.GYHVV....---PD................TEPCM-e...............................................................
A0A3Q3B8W9_KRYMA/38-209              ..............................................chpqcldykppfg-----....------.--PQQ.....PLV.F-.........................C.KE.YTKF...............................GCCDLSKD.EE.IS...S.RF.........YT..iMD.NF--DH..-..............-..S.....G...FT..........TCG.KYI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.VLP.gLC....RD....YCSDYWWECRY.T.....LS--...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------llledlgnppqfanltsaieedhkrfcdvlelkdkqycypnvltnaelnanlglvredpkgcl.
A0A671WTR5_SPAAU/54-216              ................................................qcldfeppfkp-----....------.---Q-.....WHL.EF.........................C.VE.YEQF...............................GCCDQQTD.NT.IA...E.RY.........WD..iID.QLE---..-..............V..A.....G...YD..........LCA.DML...KDI..MC-QECSP.YAAHL....YDA..........................................eDPYT..PVR.ELP.gLC....SG....YCYEFHGKCRH.V.....VKYL...T...--.....EN.K.LL..........................QDTSE.....RD..V-.-..S..TFC........SLLDL--.-S..DQ...D.YC......------.-----....-----................------ypnvlktsvlnnklgkvaedttgclk......................................
L8Y219_TUPCH/38-220                  ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggevlC.GG.FYPR..............................lSCCPRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.YSQSL....FHSp........................................erDVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..KK.D..G..GSCf.....pdFPRKQVR.GP..AS...N.YL......NQMEEY.DKVDEi..nRKHKH................NCFCIQ................................................................
A0A2B4SH32_STYPI/41-152              ......................................................rdgev-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...-YL..ECFYQCSP.KVYQW....KNP...........................................KIKG..ALK.GVP..VC....SG....FCDAWFEACKD.D.....QICV...E...NV.....LD.D.YN..........................FTIHR....eNY..CP.G..D..REC........ESYQAMY.GN..GK...N.LC......EKMWGE.SYNYT....QPNDN................YSNCL-m...............................................................
K7EVL7_PONAB/47-222                  ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCTASTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........RTFESYF.PT..PA...A.LC......DGLWSH.SYKVS....NYSQG................SGRCIQ................................................................
L5K8G1_PTEAL/30-205                  ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCSVSTS.QE.LH...R.DT.........SL...LY.NFNWDH..C..............G..Q.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RFL.DVP..LC....KE....DCQSWWEACRT.S.....YTCK...S...DW.....HK.G.WN..........................WTSGS.....NK..CP.V..E..AVC........RTFESYF.PT..PA...A.LC......EGLWSH.SYKVS....QYSRG................SGRCIQ................................................................
A0A2K6GQF4_PROCO/30-205              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WRKN...............................ACCSVNTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............R..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IRQvd.......................................qsWRKE..RFL.DVP..LC....KE....DCQHWWEDCRT.S.....YTCK...S...NW.....HQ.G.WE..........................WTSGV.....NK..CP.A..G..ATC........RTFESYF.PT..PA...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A446VF53_TRITD/57-208              ................................................fegkppgkaak-----....------.---GR.....RDL.AL.........................C.RI.FRQN...............................TCCDVTQT.FP.AL...L.SV.........RK...LS.S-----..T..............G..E.....G...SG..........ECL.HLW...ELL..ECSV-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFEACSE.A.....YFSI...-...D-.....MK.T.QA..........................LSPCG.....--..L-.G..D..ILC........GKAHKWV.SN..GT...E.LC......RLA-GF.SVQVS....-----................------daglsevdetfcyg..................................................
A0A2K1K7J2_PHYPA/29-181              ....................................................lcaknle-----....-----P.PGRAN.....LTF.CT.........................A.PE.YAAN...............................GCCNSRDD.TQ.IK...T.TF.........DA...MN.------..-..............-..I.....S...NA..........KCA.AVM...KAI..LCSK-CDQ.YSADL....YDV..........................................tSALS..KPR.PVP.fLC....TSgannYCNQVWTACEN.V.....TIPN...S...PF.....EP.G.LQ..........................E--RG.....NS..T-.S..K..ASA........SLASFYK.NN..DT...S.FC......I-----.-----....-----................------ssaaplaaenv.....................................................
A0A667ZQB9_9TELE/23-198              ...........................................................MCMDA....KHHKEE.PGPEG.....QLF.SQ.........................C.SP.WRDN...............................ACCTGNTT.ET.AH...L.ES.........SY...LY.NFTWNH..C..............G..I.....M...SP..........GCL.KHF...IQD..TCFYECSP.HLGPW....IQEvd.......................................qsWRKE..RIL.NVP..LC....ME....DCHSWWEDCKN.D.....FTCK...N...NW.....HY.G.WD..........................WSTGH.....NR..CP.K..G..SRC........RKWTEVY.PT..PK...S.MC......EEIWSN.SFQYT....TLSKS................SGRCMQ................................................................
C3Z7R5_BRAFL/50-177                  ......................................................ycslf-----....--GNRA.PKPEH.....KLV.S-.........................C.PW.FRLD...............................SCCYQEEV.DR.LF...P.IV.........TP...-P.------..-..............R..G.....A...DQ..........VCR.DHL...YYL..KC-YICSP.HQHLF....YHE...........................................----..--E.TVT..MC....EE....FCDSIFWACAN.A.....TLEG...E...R-.....IS.D.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------lysngreycldrkfrvekessgtcytv.....................................
V4A3I8_LOTGI/9-180                   ...........................................................TCLDG....QHHKKK.PGPEA.....DLF.SF.........................C.SP.WKKR...............................SCCTEQIT.KQ.MH...I.SD.........SW...-Y.NFNWNH..C..............G..D.....L...SA..........NCR.SHF...LQD..LCFYECSP.NTGPW....LQPvk.......................................mkIRNE..KFM.HVP..LC....QV....DCTNWWEDCKN.D.....LTCT...D...NW.....GK.N.FN..........................WTTGQ.....NR..CP.V..G..SSC........KKFSDIF.SN..ST...N.FC......EIVWNY.SWKVV....---AD................TESCM-h...............................................................
A0A5N3XBH7_MUNRE/30-205              ...........................................................VCMNA....RYHKEK.PGPED.....KLH.GQ.........................C.SL.WKKK...............................ACCFVNTS.IE.AH...K.DI.........SS...LY.SFDWDH..C..............S..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.NVP..LC....KE....DCQSWWEDCRT.S.....YTCK...S...NW.....HR.G.WN..........................WTSGY.....NQ..CP.V..K..AAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A1A6FW57_NEOLE/213-297             .....................................................nvsgle-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................----..---.---..LC....-S....CCVKIWAFEAG.T.....-TRD...S...SA.....HS.G.LQs.......................siMYIGY.....NQ..CP.V..G..ASC........HPFSFYF.PT..PA...A.LC......EEIWTH.SYKLS....NYSRG................SGRCIQ................................................................
A0A670IQY9_PODMU/22-189              ...........................................................QCLEG....AAHKQR.PSQEN.....NLH.E-.........................C.TL.YSKS...............................SCCSEDIT.KE.LA...D.SP.........VI..kVN.TTYWNR..C..............G..N.....N...SK..........LCQ.SYL...KKI..ECFYRCSP.YIAHW....AHP...........................................HYAA..AIV.SVP..MC....QN....FCDDWYEACKN.D.....FTCV...S...NW.....LT.D.WA..........................IDEKG....eNH..C-.-..K..NAC........IPYHEMY.GN..GT...D.MC......ESMWGD.SLKVS....---DS................PCLCLQ................................................................
A0A4Z2F325_9TELE/17-179              ........................................................qcl-----....DFEPPF.KPPS-.....-HL.EF.........................C.TQ.YELF...............................GCCDQDSD.NT.IA...E.RY.........WD..vID.QL--D-..-..............T..A.....G...HE..........LCE.DML...KEI..MC-QECSP.YAAHL....YDA..........................................eDPYT..PVR.ELP.gLC....LA....YCSEFHGKCRH.V.....VQYL...T...E-.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------nqplrdaaerdasafcsladlsdrdycypnvlkspglnsnlgqvaedpegclq...........
A0A096M9D8_POEFO/15-184              .................................................qcldykppfg-----....------.--PQQ.....PLV.F-.........................C.TD.YTKF...............................GCCDLQKD.EE.IS...R.KY.........DL..iME.NFD---..-..............T..L.....G...SA..........RCG.KYI...SSI..LC-QECSP.YAAHL....YDA..........................................eDANT..QMR.VLP.gLC....GD....YCSDYWRDCRY.T.....LSLL...L...ED.....KG.N.LQ..........................QFANL.....TA..AI.E..E..DRR........RFCDFLE.LK..DK...Q.YCy....pNVLTDA.ELNA-....-----................------nlglvredstgcle..................................................
A0A1X7U4F1_AMPQE/33-210              ..........................................................q-CL--....RGDKHS.PEPET.....GDY.YA.........................C.HQ.WKDG...............................ACCSSNFT.KQ.LA...N.SS.........VT..sID.GFHWDR..C.............dS..N.....L...SS..........QCR.KFF...VEI..ECFYRCSP.NVAHF....EVA...........................................EFPS..AFA.NLP..LC....GD....YCDRWYEACKD.E.....RTCA...V...NW.....IM.D.WD..........................YNNMTg...eNH..CK.A..N..SQC........QKYSDVY.RN..GR...G.IC......NMLWGR.SFFYS....NSSSTdp............ddRRECL-t...............................................................
A0A091WBS1_OPIHO/3-165               ..............................................qcldygppfqppf-----....------.-----.....-HL.EF.........................C.SA.YENF...............................GCCDQERD.NS.IA...A.KY.........WD...IM.DYID--..-..............P..Q.....G...HK..........LCG.TYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....FD....YCSEFHFNCHS.A.....ISLL...-...--.....--.-.-T..........................SDKHI.....QE..CC.E..T..NKT........HFCNLLH.LH..DE...D.YCf....pNVLKNT.ALNRNl..gSVVED................RKGCL-q...............................................................
FOLR1_BOVIN/35-210                   ...........................................................VCMDA....KHHKAE.PGPED.....SLH.EQ.........................C.SP.WRKN...............................ACCSVNTS.IE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IREvn.......................................qrWRKE..RVL.GVP..LC....KE....DCQSWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGY.....NQ..CP.V..K..AAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3S2LZH0_ORYJA/23-193              ...........................................................MCMDG....KHNKVE.PGPEG.....QLY.SQ.........................C.SP.WREN...............................ACCTANTS.EE.AH...S.DN.........SY...LY.NFNWNH..C..............G..V.....M...SE..........ACK.KHF...IQD..TCFYECSP.HLGPW....IQEad.......................................esWRKE..RII.DVP..LC....KE....DCESWWSDCKN.D.....LTCK...T...NW.....HK.G.WD..........................WSSGT.....NK..CP.E..G..SKC........SKWKDMF.PT..PQ...T.-C......------.-----....-----................------fppqssvnkansvyttsq..............................................
A0A2I3GV70_NOMLE/30-187              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.D-.........................-.QV.WTPP...............................ACTTLTGI.TV.AR...W.--.........--...--.------..-..............-..-.....-...SP..........PAS.ATS...SRD..TCLYECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........RTFESYF.PT..PA...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A0P7U0S1_SCLFO/29-212              ...........................................................ACPRD....GKHKAT.PSPEP.....QLT.E-.........................C.RL.YADSk.............................nACCTVDDV.QD.LV...A.PS.........VP..gVE.SGFWDR..C..............G..A.....L...SPplhlsllppiRCE.GFL...KRV..ACFQRCSP.DAVHW....TSP...........................................RHST..TAQ.AVP..LC....HS....FCREWYEACKT.D.....LTCA...R...NW.....MI.D.W-..........................---KG.....RN..C-.-..T..GNC........VPYRQMY.QH..ER...D.LC......ESLWGD.HFVTM....VDEEGdqw..........kgrTCGCL-t...............................................................
A0A218V2Q1_9PASE/26-187              ....................................................qcldfkp-----....----PF.RPPRG.....LA-.-F.........................C.RR.YAEF...............................GCCDPRRD.RA.LL...Q.RF.........YR...LS.---ARL..D..............E..R.....A...YA..........ACA.GHL...QEL..LC-QECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCTQVWQNCRS.I.....FHAL...S...AD.....PE.L.IA..........................LENNM....aKF..--.-..-..--C........RYLS---.LE..DT...D.YC......------.-----....-----................------fphllanqnlnqnlglvtadaegclq......................................
A0A5N3XAW7_MUNRE/26-208              ...........................................................VCMNA....KPHKPE.PGPEA.....ELY.EE.........................C.IP.WKDN...............................ACCTASTS.WE.AH...L.DV.........SL...LY.NFSLAH..C..............G..I.....M...MP..........DCQ.RHF...LQA..ICFYQCSP.NLGPW....IQQvgkgg................................lgvdprGQVE..RVL.DAP..LC....LE....DCERWWADCRT.S.....HTCK...S...NW.....LG.G.WA..........................WSRGK.....PR..CP.E..R..ASC........RPFPHHF.PT..PA...D.LC......ERIWSG.SFRAS....PERRG................SGRCLQ................................................................
A0A087GDP1_ARAAL/28-181              .....................................................lcsdsk-----....-----T.QVNTN.....ETL.EF.........................C.DS.YTGR...............................SCCNSKDD.LQ.LQ...N.RF.........NS...MN.------..-..............-..I.....S...DT..........NCS.SLL...KSI..LCSK-CDQ.FSGQF....FDD...........................................----..ETS.QIP.iLCnstkQD....LCSKLWDTCQN.I.....SIVS...S...PF.....SP.T.LL..........................GGATS.....PS..T-.-..T..SNS........STLTDLY.KS..KT...D.FC......TAFGGP.S----....-----................------etkdnitkcfn.....................................................
A0A6I8PNF8_XENTR/37-198              ........................................................qcl-----....DFKPPF.RPPQE.....LS-.-F.........................C.VQ.YKDF...............................GCCDSVRD.GE.IM...Q.NF.........YR..vLS.HFD---..-..............Q..S.....G...YE..........SCA.AHV...QDI..LC-QECSP.YAAHL....FDA..........................................eDPST..PVR.TIA.gLC....ED....YCWGVWQTCRS.I.....FQYL...T...TD.....KE.L.LA..........................LESNK....aKF..C-.-..-..---........---RHLA.LE..DT...D.YC......------.-----....-----................------fprllansnlnqnlglvtadaegclq......................................
A0A078HDM7_BRANA/1-131               ..........................................................m-----....------.-----.....---.--.........................-.--.FHEK...............................TCCSASQM.FS.AS...S.AL.........QN...LA.TH----..-..............G..E.....A...SK..........DCL.YLF...ELL..ECSI-CHP.DVGVQ....PRP...........................................----..---.-LR..IC....AS....FCDTVFEACSD.A.....YFNT...S...DA.....SN.Q.--..........................--VIV....pCV..AS.E..D..TIC........EKASMLE.TN..GT...A.FC......EAVGFT.VVQTA....-DDSV................EEPC--yg..............................................................
A0A6G1ADC7_CROCR/38-200              ..............................................qcldfgppfqppl-----....------.-----.....-HL.DF.........................C.SD.YESF...............................GCCDQRKD.HR.LA...A.RY.........RD...IM.DYL---..D..............L..G.....A...HE..........LCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....AD....YCSAFHSSCHS.A.....ISLL...T...ND.....RR.L.--..........................-----.....RE..TH.E..K..DGA........HFCHLLN.LP..DK...D.YCf....pN-----.-----....-----................------vlrndhlnrnlgvvakdhrgclq.........................................
A0A3Q1CNW7_AMPOC/23-198              ...........................................................MCMDA....KHHKEE.PGPEG.....QLY.LQ.........................C.AP.WRDN...............................ACCKANTT.EE.AH...N.DN.........SY...LY.NFNWNH..C..............G..A.....M...SP..........QCK.KHF...VQD..TCFYECSP.HLGPW....IQLad.......................................esWRKE..RIL.DVP..LC....KE....DCESWWEDCKN.D.....FTCK...T...NW.....HK.G.WD..........................WSSGV.....NR..CP.A..N..TKC........QKWTEVF.PT..PK...S.MC......EQIWSN.SYLYT....TLTKD................SGRCMQ................................................................
A0A091U2T7_PHORB/31-206              ...........................................................ICMDA....KHHKTK.PGPEG.....MLH.DQ.........................C.AP.WKDN...............................ACCTANTS.SE.AH...K.DQ.........SN...LY.NFNWNH..C..............G..V.....M...PP..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQad.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKD.Y.....VTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFSHVF.PR..PK...D.LC......EKIWSN.SYKYT....TEHRG................SGRCIQ................................................................
A0A5N3XU34_MUNRE/44-206              ...............................................qcldyrppfqpl-----....------.-----.....QHL.EF.........................C.SD.YESF...............................GCCDQRKD.HR.IA...A.RY.........WD...IM.EYF-D-..-..............L..K.....G...HE..........LCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....SD....YCFAFHSNCHS.A.....IALL...T...ND.....-R.R.LQ..........................ESPGK.....DG..--.-..-..--T........RFCHLLN.LP..DK...D.YC......------.-----....-----................------fpnilrrdhlnrnlgavaedprgclq......................................
A0A091JXS0_COLST/31-202              ...........................................................VCMDA....KHHKTK.PGPEG.....MLH.NQ.........................C.AP.WKDN...............................ACCTANTS.SE.AH...K.DQ.........SN...LY.NFNWNH..C..............G..L.....M...PP..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQad.......................................ssWRRE..RIL.HVP..LC....RE....DCEEWWEDCKD.F.....VTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFSLVF.PR..PK...D.LC......EKIWSN.SYKYT....----A................DGRCIQ................................................................
A0A6G0HUW1_LARCR/28-206              ...........................................................VCLQD....GKHKAT.PSPEP.....HLT.DT.........................C.TL.YADN...............................SCCTEDDI.QD.IS...H.VP.........SA..iNK.NEPWDK..C..............G..P.....L...SS..........ECE.GFL...KRV..SCFYRCSP.DAARW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRM.D.....MTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GTC........VQYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDEPE................------elaetgevgaegdggrpc..............................................
A0A2K5Q8J6_CEBCA/27-183              ..........................................................a-C---....GGSRPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagPCCPSEMD.TT.ET...S.GP.........RT...--.--YPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.HLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A484C3K8_PERFV/35-196              ...............................................qcldfkppfrpq-----....------.-----.....MEI.EF.........................C.VM.YKEF...............................GCCDYQKD.QD.LM...T.KY.........YQ..iMD.NFD---..-..............Y..Y.....G...YA..........NCA.GFV...LEL..LC-QECSP.YAAHL....FDA..........................................eDPST..PIR.TIP.gLC....PD....YCPQFWKKCSS.T.....IPFL...S...D-.....--.-.--..........................-DPHI.....AK..V-.K..E..DQT........RLCQYLE.LD..DV...D.YCy....pHLLSNQ.KLTSNl..gKVQSD................SDGCLQ................................................................
A0A2K5EWG4_AOTNA/36-211              ...........................................................VCMDA....KHHKEK.PGPED.....KLH.EQ.........................C.RP.WRKN...............................ACCSTNTS.QE.AH...K.DV.........SY...LY.NFNWNH..C..............G..E.....M...AP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.DVP..LC....KE....DCEQWWKDCRT.S.....NTCK...S...NW.....HK.G.WN..........................WTSGS.....NK..CP.V..G..ATC........RPFYFYF.PT..PT...A.LC......NEIWSH.SFKVS....NYSRG................SGRCIQ................................................................
A0A1V4JJ80_PATFA/11-171              ................................................ldygppfqptf-----....------.-----.....-HL.EF.........................C.SA.YENF...............................GCCDQEKD.NS.IA...A.KY.........WD...IM.DYI-D-..-..............S..R.....G...HK..........LCG.TYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....FD....YCSEFHFNCRS.A.....ISLL...-...--.....--.-.-T..........................SDRHL.....QE..CC.E..T..NKT........RFCNLLH.LH..DE...D.YCf....pNVLKNT.ALNRNl..gSVVED................RRGCL-q...............................................................
A0A3Q0D977_MESAU/26-134              ...........................................................VCMKA....KHHKQE.PGPED.....KLF.LE.........................C.SP.WKDN...............................ACCTFSTS.WE.AH...L.DE.........LS...SF.NFSMMH..C..............G..L.....L...TP..........GCH.KHF...IQA..VCLHECSP.NLGPW....IQL...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------lgdgsvikhlphkrehlnsilrtpm.......................................
A0A2K5NV54_CERAT/59-215              ..........................................................a-C---....GGSHPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagTCCPSEMD.AT.EI...S.GP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.RLRLL...gVRH...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A2U3YPW0_LEPWE/31-206              ...........................................................VCMDA....KHHKEK.PSPED.....QLH.KQ.........................C.SP.WKKN...............................SCCFANTS.QE.AH...K.DI.........SY...LY.KFNWDH..C..............G..H.....M...TP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RIL.DVP..LC....KE....DCQQWWEDCRT.S.....YTCK...S...NW.....HR.G.WD..........................WTSGY.....NQ..CP.A..G..AAC........LPFHFYF.PT..SA...A.LC......REIWSH.SYKLS....NYSRG................SGRCIQ................................................................
C3Z5S2_BRAFL/82-229                  ..........................................................d-CHLE....YFHKEA.PGPEP.....DNF.TE.........................C.HP.WKDY...............................SCCHQDTV.SS.VQ...K.IK.........EA..yGK.EWHWDR..C..............G..P.....L...SS..........ACE.RFF...VQE..ACLYECEP.NAGFY....-RKfpdhvy...............................ndsdpnHNKW..QME.GMP..IR....AD....YCDAWFRACRY.D.....RFCA...A...DS.....--.-.GS..........................YSS--.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------careyakvdntgdn..................................................
A0A4W5R152_9TELE/34-195              .................................................qcldfkppfk-----....------.--PQ-.....DDL.QF.........................C.AT.YRNF...............................GCCDSAKD.TE.LM...A.KF.........YK..iMD.NFD---..-..............Y..Y.....G...YA..........SCA.GYV...QDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PIR.TLP.gLC....PD....YCSQFWLKCRS.T.....ITLL...S...DD.....PQ.L.AE..........................AEPDQ....dRF..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------qhleledpdycyphllsneqltqnlgrvradpegclq...........................
A0A226NA06_CALSU/27-188              ..................................................qcldfkppf-----....------.RPPR-.....-AL.AF.........................C.RR.YGAF...............................GCCDARRD.RA.LL...E.RF.........YR...LS.---AHL..D..............G..A.....T...YA..........ACA.GHL...QDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCQQVWQKCRS.I.....FHYL...S...TD.....PE.L.IA..........................LENNM....aKF..--.-..-..--C........RYLS---.LE..DT...D.YCf....pH-----.-----....-----................------llanenlnqnlglvtadaegclq.........................................
A0A0R3SDA3_HYMDI/36-214              ...........................................................MCLES....DDLNDH.PVPEP.....SLT.S-.........................C.SE.WKDL...............................SCCPAKTA.DL.IT...D.ES.........--...LN.GFKFDF..C..............-..D.....I...TP..........ECK.KMF...LHE..YCMAKCSP.HFGPW....MVKvp.......................................ssKFKE..NFF.KVP..LC....ES....DCNKWYEVCNT.S.....MACS...T...NW....rSG.G.FD..........................WSSAT.....NK..CH.K..G..YKC........LEISKIY.GS..AK...A.FC......ESVWDN.SYSVI....PSDS-................------vsewgvtdyhcmh...................................................
A0A2K5MMC2_CERAT/20-181              ..................................................qcldfrppf-----....------.--RPP.....QLL.RL.........................C.AQ.YSDF...............................GCCDEGRD.AE.LT...R.RF.........WD...LAsRV----..D..............A..A.....E...WA..........ACA.GYA...RDL..LC-QECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRG.L.....FHHL...S...T-.....--.-.--..........................-DQEL.....RA..L-.E..G..NRA........RFCRYLS.LD..DT...D.YCf....pYLLVNK.NLNSNl..gHVVAD................AKGCL-q...............................................................
A0A452GGV2_9SAUR/35-210              ...........................................................VCMDA....KHHKTK.PGPEG.....ALH.GQ.........................C.AL.WKDN...............................ACCTAETS.TG.AH...Q.DQ.........SY...LY.NFNWNH..C..............G..V.....M...PE..........MCK.RHF...IQD..TCLYECSP.NLGPW....IDQad.......................................tsWRRE..RIL.NVP..LC....KE....DCELWWEACKD.A.....VTCK...E...NW.....HK.G.WN..........................WTSGT.....NQ..CP.H..S..STC........QLFKYIF.PR..PA...D.LC......EKIWSN.SYKYT....TEHWG................SGRCIQ................................................................
A0A0R4IY94_DANRE/29-201              ...........................................................ACLRD....GRHKAT.PSPER.....HLQ.E-.........................C.SL.YTEN...............................SCCSETDI.QD.LS...V.SV.........ST...VE.NTHWDK..C..............G..V.....L...SP..........LCE.SFL...KRV..VCFYRCSP.DAARW....PHP...........................................HQGS..SLK.AVP..LC....HS....FCRDWFEACKM.D.....MTC-...-...--.....AR.D.WT..........................TDPRG.....QN..C-.-..T..GAC........VPYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDDPGeedg........vegsSCGCL-t...............................................................
K3WYW0_GLOUD/25-185                  .....................................aapkqrqedscrsvgalkfdps-----....----QR.PMQRS.....KGL.EV.........................C.SK.YKKN...............................TCCNETHT.HA.LR...L.KI.........RE..pVV.------..-..............A..K.....F...NE..........KCQ.KIT...EEM..VCSS-CHP.FIGTW...kMK-...........................................----..---.--N..VC....PS....LCNAWFSACRS.E.....YYSY...-...--.....GG.A.GS..........................LTPCY....gNA..L-.-..-..-IC........SPLSSIA.AS..GA...E.FC......EKMG--.-FHVG...tENDSE................GDECF-d...............................................................
A0A2K6FL04_PROCO/41-168              ..........................................................v-C---....AGSHPL.HARSR.....GHH.GL.........................E.AD.LGTSqlh.........................lagSCCPSEMD.TP.ET...P.GP.........GI...FP.----ER..C..............G..A.....S...SP..........GCE.SFL...GHL..QLALRSRF.RLLLL...gVRQ...........................................----..---.AQP..LC....AE....LCQAWFAACEN.D.....VTC-...-...--.....GP.T.WL..........................PIPEK.....RS..C-.-..E..PSC........RTYGQ--.--..--...-.--......------.-----....-----................------................................................................
E7EU04_HUMAN/43-210                  ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCTASTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........RTFESYF.PT..PA...A.LC......EGLWSH.SYKVS....N----................------ys..............................................................
A0A5F9DDF8_RABIT/35-210              ...........................................................VCMDA....KHHKEK.PSPED.....KLH.EQ.........................C.SP.WKKK...............................ACCSTNTS.QE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.DVP..LC....KD....NCQRWWEDCRT.S.....HTCK...S...NW.....HK.G.WD..........................WTSGV.....NR..CP.A..G..ATC........RTFESYF.PT..PA...A.LC......EGLWSH.SYKVS....NYSSG................SGRCIQ................................................................
A0A2K3LBL3_TRIPR/24-185              .............................................vcvsqggrfppfks-----....--EGNP.PKRGP.....KDL.TL.........................C.RV.FRKK...............................TCCDVTHT.HP.AL...L.SV.........RK...LA.-----S..G..............G..E.....A...SQ..........ECL.HLW...ELL..ECAI-CDP.RVG--....TQS...........................................----..---.GPP.lIC....AS....LCERIYDACSN.A.....YFSM...-...DV.....KT.Q.VL..........................APCGV.....ND..F-.-..-..-VC........GRAAEWV.SN..GT...D.LC......VAA---.-----....-----................------gfrvkssdivhvaseeifcyg...........................................
A0A3P8WQC7_CYNSE/33-206              ................................................nchpqcldykp-----....----PF.EPRQP.....LA-.-F.........................C.KE.YSKF...............................GCCDLEKD.EE.IS...K.SF.........YS..iME.N--FDH..S..............G..Y.....V...--..........TCG.KYI...RSI..LC-QECSP.YAAHL....FDA..........................................eDANT..PMR.LLP.gLC....GD....YCFDYWNQCRY.T.....LSLL...L...EN.....MG.S.PQ..........................QFSNL.....TA..IL.E..E..DRT........KFCDFLE.LR..DK...Q.YCy....pNVLTNE.ELNANl..gSVREN................TKGCL-e...............................................................
V8PDU7_OPHHA/22-189                  ...........................................................RCLRG....AGHKLR.PTQEK.....YLQ.E-.........................C.TL.YAKS...............................ACCYADIT.EE.LA...Y.SP.........VI..kVH.TTFWNR..C..............G..N.....L...SS..........ACE.TYM...KKI..ECFYRCSP.YIAHW....AHP...........................................KQAA..AIS.SVP..IC....QR....FCDNWYEACKS.D.....HTCV...S...NW.....LT.D.WE..........................IDDKR....eNH..C-.-..K..NDC........IPITEMY.AS..GT...D.MC......EKMWGD.SLKVS....---HS................PGLCF-e...............................................................
A0A2G9G2W0_9LAMI/30-190              ..........................................vcisqggrfppfanegk-----....--PPKK.ASKGP.....RDL.TL.........................C.RV.FRRR...............................TCCDVSQT.HP.AL...L.TI.........RR...LA.S-----..S..............G..E.....A...SQ..........ECL.QLW...ELL..ECSI-CDP.RVG--....VQR...........................................----..---.GPP.rIC....AS....FCDRVYEACSA.A.....YFAM...D...AK.....-T.Q.VL..........................APCG-.....--..L-.A..D..FVC........GRASEWI.SN..GT...E.LC......HAAGFS.VTQFE....--DPE................EAQC--yg..............................................................
A0A091RYF6_9GRUI/3-165               ...................................................qcldygpp-----....-----F.QPPS-.....-HL.EF.........................C.SA.YETF...............................GCCDQERD.NS.IA...E.KY.........WD...IM.DY-IDP..W..............G..-.....-...HK..........LCG.TYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.KLP.gLC....SE....YCSEFHFNCRS.A.....ISLL...-...--.....--.-.-T..........................SDQHI.....QE..CL.E..T..NKT........CFCNLLH.LH..DE...D.YCf....pNVLKNT.ALNRNl..gLVAED................RKGCL-q...............................................................
A0A0D9S170_CHLSB/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A3L8SQR4_CHLGU/21-188              ..........................................................g-CLEG....DTQKLK.PGPEP.....NMQ.E-.........................C.TL.YSKS...............................SCCYADFT.EQ.LA...H.SP.........VI..kVS.DSYWNR..C..............G..Q.....L...SK..........SCE.DFT...KKI..ECFYRCSP.HAARW....IHP...........................................NDTA..AIQ.AVP..LC....QS....FCDDWYEACKD.D.....SICV...R...NW.....LT.D.WE..........................WDESG....eNH..C-.-..K..NKC........IPYREMY.AN..GT...D.MC......QSMWGE.SFKVR....---ES................SCLCLQ................................................................
H3HEC3_PHYRM/33-184                  ...............................................tcrsagvlkfds-----....---ETH.PMQRT.....KGM.EV.........................C.SK.YRKS...............................TCCNATHA.HP.LR...L.KI.........RE..pVV.------..-..............A..K.....F...GR..........KCQ.RLT...EEM..ACSS-CHP.LMGTW...eMK-...........................................----..---.--N..VC....PS....LCNDWYDACKD.E.....YYAY...-...-G.....GA.G.TL..........................APCYG.....NA..L-.-..-..-VC........SPLSSIA.KS..GA...D.FC......VHM---.G----....-----................------fhvgsdtdadgidcfd................................................
A0A091G927_9AVES/3-129               ........................................................lsv-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETPE..REL.TLP.yLC....KD....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A251PAD7_PRUPE/14-166              ..............................................gapstlssplkfc-----....------.-----.....---.--.........................-.-S.YNET...............................ACCNSTED.LQ.IQ...K.QF.........QT...MN.------..-..............-..I.....S...NS..........GCA.SLL...KSV..LCA-RCDP.FSGEL....FTVdsvprpvp..........................llcnstvsaNSSQ..SIQ.EV-..--....ND....FCSNIWDTCQN.V.....SILN...S...P-.....--.-.FA..........................PSLQG....qAG..LP.V..K..SNV........SELTKLW.QS..KA...D.FC......NAFGG-.-----....-----................------assdgs..........................................................
A0A0N8K116_SCLFO/23-198              ...........................................................MCMDA....KHHKTK.PGPEG.....KLY.QQ.........................C.SP.WKDN...............................ACCLANTT.EE.AH...K.DN.........SY...LY.NFNWDH..C..............G..A.....M...TD..........KCK.RHF...IQD..TCFYECSP.HLGPW....IQKvn.......................................ssWRKE..RIL.DVP..LC....RE....DCETWWEDCKD.D.....HTCK...E...NW.....HV.G.WD..........................WSTDV.....NR..CP.E..G..TQC........KKFSEIF.PT..AQ...S.MC......EKIWSR.SYKYT....TYTKD................SGKCMQ................................................................
A0A4X2KMW6_VOMUR/39-222              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQmesls...............gaeavC.GA.FYPR..............................lSCCSRIDS.QS.LL...H.ME.........SK...IF.S-----..-..............V..T.....N...NT..........ECV.KLV...EEI..RCAH-CSP.HSQNL....FHSse.......................................rgDASE..RDL.ALP.lLC....ED....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yHA..RK.D..G..GLCf.....pdFPRKQVR.GP..TS...N.YL......DQMEEY.DKVDEi..sRKHKH................SCFCAQ................................................................
A0A078FZH1_BRANA/153-313             ......................................cvskggrfppyesagkppnsv-----....------.-GRGS.....KDL.TM.........................C.RV.FRKR...............................TCCSPAQT.TP.AF...V.AV.........RN...LA.TH----..-..............G..E.....A...SQ..........DCL.HLF...ELL..ECSI-CNP.DVG--....TQP...........................................----..---.GPP.rIC....AS....FCDRVFDACKD.A.....YFSS...N...AL.....--.-.-T..........................QTIGP.....CG..VN.D..D..IIC........VKASNWE.SN..GT...S.FC......EAA---.GFAVQ...tNEDSR................EEPC--yg..............................................................
A0A3Q7RZ30_VULVU/45-206              ...............................................cldygppfqpal-----....------.-----.....-HL.EF.........................C.SD.YKSF...............................GCCDQRKD.RR.LA...A.RY.........KD...IM.DYL-D-..-..............L..K.....G...HE..........LCG.RYV...KDI..LC-QECSP.YAAHL....YDA..........................................kNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHS.A.....ISLL...T...ND.....HR.P.RR..........................P----.....QE..VD.G..-..--A........HFCHLLN.LP..DE...D.YC......------.-----....-----................------fpnvlrndhlnrnlgvvaqdqqgclq......................................
M4FHF8_BRARP/34-173                  .................................................agseavnsse-----....------.---NA.....LHL.NL.........................C.NA.FHGN...............................TCCSSSLA.LQ.NL...-.-A.........T-...-H.------..-..............G..E.....A...SK..........DCL.YLF...ELL..ECSI-CHP.DVG--....-GP...........................................----..---.-LR..IC....AS....FCDSVFKACSD.A.....YFST...S...DS.....TN.Q.VI..........................VPCGA.....RN..G-.-..T..YIC........EKASKLE.TN..GT...S.FC......EAV---.-----....-----................------gfsvqagddsvevpcy................................................
A0A1U7SPX6_CARSF/27-183              ..........................................................a-C---....GGSHPL.QARSR.....LHH.GL.........................A.PD.LGTGqlh.........................lpgPCCPSEVN.TP.EV...S.SP.........GI...FP.----ER..C..............S..A.....P...SP..........GCE.SFL...GHF..QLALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....AE....LCQAWFDTCKD.D.....NTC-...-...--.....GP.T.WI..........................PLSEK.....RD..C-.-..E..PGC........RTYGQTF.SD..GA...D.LC......RSVLGH.ALPVA....--APG................ARHCLN................................................................
A0A1S3GN12_DIPOR/27-173              .........................................................tc-----....GGSRPL.PARPW.....GHY.GL.........................A.SH.LGTG...............................QLHLAEVD.TP.DL...A.DP.........--...--.----ES..C..............G..A.....P...SP..........GCE.SFL...RHL..QRALRNRF.RLLLL...gVGQ...........................................----..---.AQP..LC....AE....LCQAWFTICKA.D.....LIC-...-...--.....GS.T.WL..........................PPSEN.....RT..C-.-..E..PGC........PTYGQTF.VD..GM...D.LC......RSVLGH.VVPVA....--APG................SRHCLN................................................................
A0A3Q7RSV4_VULVU/26-182              ...........................................................VCMKT....KHHKRE.PGPED.....KLY.EE.........................C.IP.WAEK...............................ACCTASTS.WH.AH...L.DV.........SL...LY.NFSLLH..C..............G..L.....M...MP..........ACE.EHF...IQA..VCFYECSP.NLGPW....IQKvd.......................................ssGQGE..RIR.DVP..LC....RE....DCEQWWEDCRT.S.....YTCR...S...DW.....LG.S.WD..........................WSGA-.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------aqrggrsvgarglqrlllhqeqsapsq.....................................
A0A384BN01_URSMA/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggeilC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................EEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCLQ................................................................
A0A398AT13_BRACM/1-125               ..........................................................m-----....------.-----.....---.--.........................C.SM.FHEK...............................TCCSASQM.FS.AS...S.AL.........QN...LA.TH----..-..............G..E.....A...SK..........DCL.YLF...ELL..ECSI-CHP.DVGVQ....PRP...........................................----..---.-LR..IC....AS....FCDTVFEACSD.A.....YFNT...S...D-.....--.-.--..........................-----.....-A..TS.E..D..TIC........EKASMLE.TN..GT...A.FC......EAVGFT.VVQTA....-DDSV................EEPC--yg..............................................................
A0A674GDH4_TAEGU/30-203              .......................................................hgrq-----....-TPQER.AGPEG.....RLY.QQ.........................C.SP.WKDN...............................ACCTANTS.LE.AH...K.DQ.........SY...LY.NFNWNH..C..............G..V.....M...PA..........KCK.RHF...IQD..TCLYECSP.NLGPW....IEQvd.......................................ssWRRE..RIL.HVP..LC....RE....DCEEWWEDCKD.A.....LTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFSQVF.PR..PQ...D.LC......EKIWSN.SFRYS....PEPRG................SGRCIQ................................................................
A0A2K5WE79_MACFA/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A670IXM2_PODMU/30-211              ...........................................................RCLPG....GKHKAS.PSPEG.....QLG.I-.........................C.QI.YAESeywl......................rarrqQEGEATRL.EE.LW...A.SR.........KW...TN.DIYWNR..C..............G..S.....L...SS..........RCE.GYL...QQL..ECFYRCSP.IAAQW....PHP...........................................QRPT..AVL.AVP..LC....QS....FCDQWYDACKE.D.....LTCA...R...NW.....LT.D.WH..........................WGPEG.....NN..C-.-..S..QDCls...yalSPRNHMS.HE..EI...P.VL......SHVWEK.QLLEE....-----................------keelhhsqea......................................................
A0A669DJM7_ORENI/37-208              .................................................chpqcldykp-----....----PF.EPRQP.....LA-.-F.........................C.KE.YSKF...............................GCCDVEKD.EE.IS...G.RF.........YT..iME.N--FDH..S..............G..-.....-...YA..........ACG.KYV...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.VLP.gLC....GD....YCSDYWRQCRY.T.....LGL-...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------lledvgnsqqfanltatieedhrrfceflvlkdkeycypsvltnaelnanlgllnedpegcl..
G3SXL0_LOXAF/35-210                  ...........................................................ICMDA....KHHKGK.PSPED.....KLH.DQ.........................C.TP.WKKN...............................SCCSVNTS.QE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...EP..........ACK.WHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.NVP..LC....KD....DCQRWWEDCRT.S.....NTCK...I...NW.....HK.G.WN..........................WTSGY.....NQ..CP.A..E..AKC........APFHVYF.PT..PD...V.LC......NEIWSQ.SYKVS....NYSRG................SGRCIQ................................................................
A0A1S3JMB2_LINUN/29-196              ..........................................................e-CLAG....VNHKSR.PGPEP.....YLR.A-.........................C.RT.YRNS...............................ACCTPQFT.RQ.LA...A.SP.........IT..kVG.DTNWNL..C..............G..Q.....L...SA..........RCE.RHM...VAT..ECFYRCSP.NIVHW....ASP...........................................NYPA..ATV.RVP..IC....AS....DCDAWFDACKD.D.....FTCA...E...NW.....LT.D.WN..........................FTKSG....eKQ..C-.-..K..GPC........KTFAETY.KD..GR...G.LC......QKMWAL.SLDYS....---TD................SNRCM-k...............................................................
A0A2P5AD84_PARAD/27-185              .........................................cvsqggrfppfssegkpp-----....----KK.VSKGP.....KDL.TL.........................C.RV.FRQK...............................TCCDVAQT.HP.AL...L.NI.........RK...LA.S-----..T..............G..E.....A...SQ..........ECL.QLW...ELL..ECSI-CDP.QVG--....VQP...........................................----..---.GPP.vVC....TS....FCDRVFEACSD.A.....YFSM...E...PM.....-T.Q.VL..........................SPCGV.....ND..F-.-..-..-VC........GRASQWV.HN..GT...D.LC......HAA---.-----....-----................------gfavkddllveetscy................................................
A0A3P9DJM5_9CICH/33-194              ..................................................qcldfkppf-----....------.--RPQ.....KEL.EF.........................C.IM.YKEF...............................GCCDYQKD.QE.LM...S.KY.........YQ..iMD.NFD---..-..............Y..S.....G...YT..........SCA.GFI...FDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....SE....YCFQFWNKCSF.T.....IPF-...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------lsgdpyianfrenqtslchyleiqdkdycypyllnnqqltqnlggiqvnsdgclq.........
U6ITH9_ECHGR/36-215                  ...........................................................MCPDS....GELKDH.PSPEP.....DLK.E-.........................C.SE.WKSR...............................TCCSPETA.EQ.IA...-.-N.........AT...LH.GFSFDF..C..............G..N.....M...SE..........QCR.NYF...HYD..YCMIKCSP.DLGPW....IVKmt.......................................ssRFKE..RAF.RVP..LC....ES....DCYAWYEACKW.D.....KACS...T...NW....rSG.G.FD..........................WSEGT.....NK..CR.K..G..FEC........LNISMVY.GS..PI...A.FC......EHVWDH.AYRVV....PVESVavw..........gssDKHCM-h...............................................................
A0A087V3F6_BALRE/3-165               ..............................................qcldygppfqppf-----....------.-----.....-HL.EF.........................C.SA.YENF...............................GCCDQERD.NS.IA...A.KY.........WD...IM.DYIDP-..-..............-..R.....G...HK..........LCG.TYI...KDI..LC-QECSP.YAAHL....YDA...........................................ENPW.tPLR.NLP.gLC....FE....YCSEFHFNCRS.A.....ISLL...-...--.....--.-.-T..........................SDKHI.....QE..CC.E..T..NKT........RFCNLLH.LH..DE...D.YCf....pNVLKNT.ALNRNl..gSVVED................RKGCL-q...............................................................
A0A2I2ZUF7_GORGO/37-193              ..........................................................a-C---....GGSRPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagPCCPSEMD.TT.ES...S.GP.........GN...--.--HPER..C..............G..V.....P...SP..........QCK.SFL...EHL..QRALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFVNCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
G3WWL0_SARHA/29-194                  ......................................sahpqcldfkppfrpprplpf-----....------.-----.....---.--.........................C.EQ.DSAF...............................GCCDAEQD.AA.LS...R.RY.........WA..vTS.RLE---..-..............P..D.....T...FA..........VCA.AYV...RGL..LC-QECSP.YAAHL....FDA..........................................eDPST..PLR.TVP.gLC....KD....YCVDVWHNCRT.I.....FRHL...S...PD.....PE.L.WA..........................LETNR....aKF..C-.-..-..---........RYLS---.LD..DA...D.YCf....pRLLVNE.NLNVNl..gQVRAD................TEGCL-e...............................................................
A0A2I2UXU2_FELCA/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FNSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A452EP42_CAPHI/44-206              ...............................................qcldyrppfqpl-----....------.-----.....QHL.EF.........................C.SD.YESF...............................GCCDQRKD.HL.IA...A.RY.........WD...IM.DYFD--..-..............L..K.....G...HE..........LCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....SD....YCSAFHSDCHS.A.....IALL...T...ND.....-R.R.LQ..........................ESPGK.....DG..A-.-..-..---........RFCHLLN.LP..DK...D.YC......------.-----....-----................------fpnilrsdhlnrnlgavaedrrgclq......................................
A0A093CYM0_TAUER/31-206              ...........................................................ICMDA....KHHKVK.PGPEG.....MLY.DQ.........................C.AP.WKDN...............................ACCTANTS.SE.AH...K.DQ.........SN...LY.NFNWNH..C..............G..V.....M...PP..........KCK.RHF...VQD..TCLYECSP.NLGPW....INQvd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKD.Y.....VTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFSHVF.PR..PK...D.LC......EKIWSN.SYKYT....TEHRG................SGRCIQ................................................................
A0A453NZF6_AEGTS/36-189              ...............................................fssegkppgkaa-----....------.--KGR.....RDL.AL.........................C.RI.FRQN...............................TCCDVTQT.FP.AL...L.SV.........RK...LS.S-----..T..............G..E.....G...SG..........ECL.HLW...ELL..ECSV-CDP.RVG--....VRP...........................................----..---.GPP.vIC....AS....FCDMVFEACSE.A.....YFSI...-...--.....-D.T.KT..........................QALSP.....CG..L-.G..D..ILC........GKAHKWV.SN..GT...E.LC......RLA-GF.SVQVS....DASPS................------evvetfcyg.......................................................
A0A4W6F4E9_LATCA/23-198              ...........................................................MCMDG....KHHKTE.PGPEG.....DLY.SQ.........................C.AP.WSDN...............................ACCTANTS.TA.AH...N.DN.........SY...LY.NFNWNH..C..............G..V.....M...SE..........QCK.KHF...IQD..TCFYECSP.HLGPW....IQEad.......................................esWRRE..RIL.DVP..LC....ME....DCHSWWEDCKN.D.....LTCK...T...NW.....HK.G.WD..........................WTSGT.....NK..CP.E..G..SKC........RKWTDIF.PT..PK...S.MC......EQIWSN.SYIYT....THSNT................SGRCMQ................................................................
A0A3B5KKC2_TAKRU/27-196              ....................................................qcldykp-----....----PF.QPQQ-.....PLV.F-.........................C.KE.YSKF...............................GCCDLQKD.EE.IR...I.RF.........YT..iME.--NFDH..S..............G..Y.....V...--..........TCS.RYI...HSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.ILP.gLC....GN....YCADYWHRCRY.T.....MSLL...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------ledlgvlhqyanitmaieedrkrfcdflelkdkqycypnvltsaelnanlgfvrenpkgcle..
A0A2U3V495_TURTR/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........SK...MF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lLC....KD....YCKEFFYTCRG.H.....VPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2I2Z774_GORGO/36-206              ...........................................................VCMNT....KHHKTQ.PSPED.....ELC.G-.........................-.--.QKKN...............................ACCMTNTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....T...EP..........ACK.RHF...IQD..TCLYECSP.NLRPW....IWQin.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGI.....NE..CP.A..G..ALC........HTFEPYF.PT..PA...A.LC......EVLWSH.SFKMW....-----................------fdsaqgnpne......................................................
A0A078G1E7_BRANA/37-201              ...........................................vcvskggrshqpyele-----....-----G.KLPESadlefRDL.NM.........................C.GM.FHEK...............................TCCSASRM.LS.SS...L.AL.........QN...LA.TH----..-..............G..E.....A...SK..........DCL.FWF...ELL..ECSI-CHP.DVGVQ....SGP...........................................----..---.-LR..VC....AS....FCDTVFEACSD.A.....YFNT...S...DS.....TN.Q.VI..........................V---P.....CV..AS.N..D..TIC........EKASKLE.TN..GT...A.FC......EAV---.-----....-----................------gftvvqpagdsveepcyg..............................................
A0A397Z1Q3_BRACM/37-197              ..........................................vcvskggrfppyesegk-----....------.-PPKPvgkgsKDL.TL.........................C.QV.FRKR...............................TCCSPAQT.NP.AF...V.AV.........RN...LA.TF----..-..............G..E.....A...SQ..........ECQ.HLF...ELL..ECSI-CNP.NIG--....VQP...........................................----..---.GPP.rIC....AS....FCNKVFAACKD.A.....YFAS...N...AL.....--.-.--..........................TQMIG....pCG..V-.N..D..IIC........VKTSSWE.SN..GT...S.FC......EAA-GF.SVQTN....-DDSR................KEPC--yg..............................................................
A0A1S3JFL3_LINUN/34-209              ...................................................mcitlpve-----....GASKTE.ASPEP.....DLE.--.........................C.PS.FREK...............................SCCNTNAT.AD.FL...K.TH.........VW...ES.VINFDH..Cp...........gkP..R.....L...SP..........DCA.RLM...HQE..MCFYACSP.NLGPW....IVKay.......................................ahPDLD..HLN.HAP..LC....AS....QCEEWWNACKE.E.....YTCH...K...DW.....IT.D.MV..........................W--GK....lHS..CK.K..D..AVC........KKYKEFY.SS..AA...D.FC......STIWHG.DYKVV....---PD................SEPCL-v...............................................................
A0A287BJS7_PIG/82-257                ...........................................................VCMDA....KHHKVE.PGPED.....ELH.DQ.........................C.VP.WKKN...............................ACCSARVS.HE.LH...R.DK.........SS...LY.NFSWEH..C..............G..R.....M...EP..........ACK.RHF...IQN..NCLYECSP.NLGPW....FQEvn.......................................qkWRKE..RFL.NVP..LC....KE....DCLDWWEDCRT.S.....YTCK...S...SW.....HK.G.WN..........................WSSGS.....NQ..CP.T..G..TTC........DTFESFF.PT..PA...A.LC......EGIWNH.DYKFT....NYSRG................SGRCIQ................................................................
A0A3P9DIJ7_9CICH/33-194              ..................................................qcldfkppf-----....------.--RPQ.....KEL.EF.........................C.IM.YKEF...............................GCCDYQKD.QE.LM...S.KY.........YQ..iMD.NFD---..-..............Y..S.....G...YT..........SCA.GFI...FDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PVR.TIP.gLC....SE....YCFQFWNKCSF.T.....IPF-...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------lsgdpyianfrenqtslchyleiqdkdycypyllnnqqltqnlggiqvnsdgclq.........
A0A673CHN1_9TELE/28-190              ................................................qcldfeppfqp-----....------.--PW-.....-HL.EF.........................C.TQ.YQDF...............................GCCDQRTD.NT.IA...E.RY.........WD..iID.LLE---..-..............A..Q.....G...QE..........LCA.DTL...KEI..MC-QECSP.YAAHL....YDA..........................................eDPYT..PVR.ELP.gLC....LN....FCSEFHSKCRH.V.....LKYL...T...D-.....-N.R.LL..........................QDTCD.....RD..M-.-..S..TFC........SMVD---.LS..DQ...D.YCy....pNVLKTS.DLNGKl..gRVAED................PGGCL-q...............................................................
A0A498LKF0_LABRO/1-143               .......................................................myky-----....------.-----.....---.--.........................-.--.---F...............................GCCDYARD.RE.LM...A.KY.........YR..vMD.NFD---..-..............Y..Y.....G...YS..........NCA.SYV...QDL..IC-QECSP.YAAHL....FDA..........................................eDPST..PLR.TIP.gLC....PD....YCSQFHSKCRS.F.....LTLL...S...DD.....PR.L.SE..........................LEHD-.....--..--.Q..S..RLC........QY---LE.LD..DP...D.YCy....pHLLSNE.RLTKNl..gRTVED................SDGCL-q...............................................................
H2Q8W9_PANTR/22-183                  ...................................................qcldfrpp-----....-----F.RPPQ-.....-PL.RL.........................C.AQ.YSDF...............................GCCDEGRD.AE.LT...R.RF.........WA...LAsRVD---..-..............A..A.....E...WA..........ACA.GYA...RDL..LC-QECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRG.L.....FRHL...S...TD.....QE.L.WA..........................LEGNR....aRF..C-.-..-..---........RY---LS.LD..DT...D.YC......------.-----....-----................------fpyllvnknlnsnlghvvadakgclq......................................
F6SQN2_HORSE/31-192                  ..........................................................q-CL--....DFRPPF.RPPEP.....LRF.--.........................C.AQ.YSAF...............................GCCAPEQD.AA.LA...H.RF.........GA..lAA.RVD---..-..............A..D.....E...WA..........ACA.GYA...LDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PLR.TLP.gLC....ED....YCLDMWQTCRG.L.....IRHL...S...PD.....RE.L.WA..........................LEDNR....aKF..C-.-..-..---........---HYLS.LD..DT...D.YCf....pRLLVNE.NLNSNl..gRVVAD................AKGCLQ................................................................
A0A6A5FKF9_PERFL/31-204              ..................................................cchpqcldy-----....--KPPF.EPRQP.....LVF.--.........................C.KE.YSKF...............................GCCDLEKD.EE.IS...V.KF.........YT..iMD.N--FDH..S..............G..Y.....V...--..........TCA.KYI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.MLP.gIC....GD....YCSDYWQQCRY.T.....LSLL...L...EE.....LG.G.TQ..........................QFANM.....TA..TI.E..E..DRR........KFCDFLE.LK..DK...Q.YCy....pNVLTNA.A----....-----................------lnanlglvsedpkgcle...............................................
A0A0D2U8N0_CAPO3/45-225              ..........................................................s-CISH....PSHARH.GKPTV.....KDL.SSpet..................tlefC.TP.WAGN...............................GCCRPELT.RL.IN...S.VP.........DYd.aVY.DFNWAV..C..............G..E.....L...SA..........DCA.TYM...KHE..ACFVECSP.YLTPF....EDR...........................................SFGY..YFS.SVP..VC....SS....WADRWFDACRN.D.....KTCV...D...NWy...dDN.A.WD..........................YTPDG....wNI..CK.P..D..SQC........TTYADRF.GS..PK...K.ML......ETLWGI.SFTYS....---TD................ESRC--ym..............................................................
A0A673C9A7_9TELE/19-181              ................................................qcldfeppfqp-----....------.--PW-.....-HL.EF.........................C.TQ.YQDF...............................GCCDQRTD.NT.IA...E.RY.........WD..iID.LLE---..-..............A..Q.....G...QE..........LCA.DTL...KEI..MC-QECSP.YAAHL....YDA..........................................eDPYT..PVR.ELP.gLC....LN....FCSEFHSKCRH.V.....LKYL...T...D-.....-N.R.LL..........................QDTCD.....RD..M-.-..S..TFC........SMVD---.LS..DQ...D.YCy....pNVLKTS.DLNGKl..gRVAED................PGGCL-q...............................................................
FOLR1_MOUSE/34-209                   ...........................................................VCMDA....KHHKEK.PGPED.....NLH.DQ.........................C.SP.WKTN...............................SCCSTNTS.QE.AH...K.DI.........SY...LY.RFNWNH..C..............G..T.....M...TS..........ECK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RIL.DVP..LC....KE....DCQQWWEDCQS.S.....FTCK...S...NW.....HK.G.WN..........................WSSGH.....NE..CP.V..G..ASC........HPFTFYF.PT..SA...A.LC......EEIWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A452Q700_HUMAN/34-104              ...........................................................VCMNA....KHHKTQ.PSPED.....ELY.GQ.........................C.SP.WKKN...............................ACCTASTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........TCK.RHF...IQD..SC------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------l...............................................................
A0A670HR88_PODMU/26-201              ...........................................................TCMDG....KHHKTE.PGKED.....ELH.GQ.........................C.SP.WKEN...............................ACCTNSTS.HA.AH...D.DQ.........SY...LY.NFNWNH..C..............G..I.....M...SP..........ACK.RHF...IQD..TCLYECSP.NLGPW....INKvd.......................................qtWRKE..RIL.DVP..LC....KE....DCEQWWNDCRN.D.....MTCK...E...NW.....HV.G.WD..........................WSQGY.....NQ..CP.H..T..SKC........QLWESVF.PS..PQ...D.LC......EKIWSN.SYKYT....TFTRG................SKRCIQ................................................................
K7EKV3_HUMAN/27-183                  ..........................................................a-C---....GGSRPL.QARSQ.....QHH.GL.........................A.AD.LGKGklh.........................lagPCCPSEMD.TT.ET...S.GP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
F6PEI8_DANRE/34-195                  .................................................qcldfkppfq-----....------.--PQQ.....EL-.QF.........................C.QM.YKNF...............................GCCDYARD.QE.LM...K.KY.........YR..vMD.NFD---..-..............Y..Y.....G...YS..........NCA.SYV...QDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PLR.TIP.gLC....PD....YCAQFHSKCRS.F.....LTLL...S...DD.....PR.L.AE..........................LEHDQ.....--..--.-..R..KLC........QYLE---.LD..DP...D.YCy....pHLLSNE.HLNKNl..gRTAAD................SEGCLQ................................................................
A0A1R3K877_9ROSI/29-193              ........................................vcisqggrfppfssegkpp-----....----KK.VGKGQ.....KDL.TL.........................C.RL.FRKR...............................TCCDAAQT.HP.AL...L.SI.........RR...LA.V-----..T..............G..E.....A...SQ..........ECL.QLW...ELL..ECSI-CDP.RVG--....VQP...........................................----..---.GPP.lIC....TS....FCDKVFQACSS.A.....YFSM...D...AK.....TQ.A.L-..........................A----.....PC..GA.S..D..FVC........GRASEWV.SN..GT...E.LC......RAA---.-----....-----................------gflveqtdvtrngveerfcyg...........................................
S7NLK6_MYOBR/1-174                   ..........................................................m---KT....KHHKPE.PGPED.....QLY.DE.........................C.SP.WKGN...............................ACCTTNTS.WE.AH...L.DE.........AG...LY.NFSLIH..C..............G..L.....M...IP..........DCQ.KHF...IQA..KCLHQCSP.NLGPW....IQQva.......................................pcEQEE..RIL.DAP..LC....QE....DCVQWWADCRT.S.....YTCK...S...NW.....LG.G.WD..........................WSRGK.....SH..CP.A..R..ARC........CPLPYYF.PT..PA...A.LC......EKIWGN.SFKAS....PERRN................SGRCLQ................................................................
A0A315UWT1_GAMAF/144-319             ...........................................................VCLQD....GKHKAT.PGAEP.....HLS.E-.........................C.GL.YADN...............................SCCTEEDI.QD.IA...Y.VP.........SD..sNK.NEPWDK..C..............G..P.....L...SS..........ECE.GYL...KRV..SCFYRCSP.DASRW....PHP...........................................RRRS..YIQ.AVP..LC....HS....FCRDWFDACRM.D.....MTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GTC........VQYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDDQQeagen......gaegrPCGCL-t...............................................................
A0A674BBD6_SALTR/34-195              .................................................qcldfkppfk-----....------.--PQ-.....DDL.QF.........................C.AM.YRNF...............................GCCDSAKD.KE.LM...A.KF.........YK..iMD.NFD---..-..............Y..Y.....G...YA..........SCA.GYV...QDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PIR.TLP.gLC....PD....YCSQFWLKCRS.T.....ITLL...S...DD.....PQ.L.AE..........................AEPDQ....dRF..C-.-..-..---........---QHLE.LE..DP...D.YC......------.-----....-----................------yphlvsneqltqnlgrvradpegclq......................................
A0A0D9S1B0_CHLSB/26-201              ...........................................................ICMNA....KHHKRV.PGPED.....KLY.EE.........................C.IP.WKDN...............................ACCTLTTS.WE.AH...L.DV.........SP...LY.NFSLFH..C..............G..L.....L...MP..........GCR.KHF...IQA..ICFYECSP.NLGPW....IQPva.......................................psGQGE..RVV.NAP..LC....QE....DCEEWWEDCHL.S.....YTCK...S...NW.....RG.G.WD..........................WSQGK.....NR..CP.K..G..AQC........LPFSHYF.PT..PA...D.LC......EKTWSN.SFKAS....PERRN................SGRCLQ................................................................
H9GJK4_ANOCA/31-192                  .............................................qcldfkppfkpsrp-----....------.-----.....-L-.AF.........................C.VQ.YSDF...............................GCCEAERD.AA.LL...R.RY.........YS...VS.---THL..D..............Q..G.....A...YA..........ACA.SHL...QNL..LC-QECSP.YAAHL....YDA..........................................eDPST..PER.TLP.gLC....RD....YCTQVWQNCRS.M.....FRHL...T...SD.....EE.L.LS..........................LENNQ....aK-..--.-..-..-FC........RYLS---.LD..DT...D.YCf....pQLLVNE.NLNQNl..gLVTAD................SEGCLQ................................................................
A0A1S3NQ50_SALSA/33-194              ..........................................................q-CL--....DYKPPF.QPREP.....LVF.--.........................C.KE.YAKF...............................GCCDLEKD.DK.IS...Q.NF.........YK...IM.DY-FDY..S..............G..Y.....-...-M..........TCA.KYI...RTI..LC-QECSP.YSAHL....YDA..........................................eDANT..PMR.ELP.gLC....GD....YCSEFWHQCRY.T.....ISLL...T...DN.....NA.T.LG..........................IEEDR....nKF..C-.-..-..---........NF---LE.LK..DR...E.YC......------.-----....-----................------ypnvlsddklnanlgdvradpegclq......................................
M3VY61_FELCA/41-200                  .................................................dygppfqpll-----....------.-----.....-HL.EF.........................C.SD.YESF...............................GCCDQQKD.HR.LA...A.RY.........RV...IM.DYL-D-..-..............L..K.....G...HE..........LCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHS.A.....ISLL...T...ND.....--.-.--..........................--RRL.....RE..TR.E..K..DSA........HFCHLLN.LP..DK...D.YCf....pNVLRN-.-----....-----................------dhlnrnlgvvaedgrgclq.............................................
A0A2K5P851_CERAT/36-211              ...........................................................VCMNA....KHHKEK.PGPED.....KLH.EQ.........................C.RP.WKKN...............................ACCSTNTS.QE.AH...K.DV.........SY...LY.RFNWNH..C..............G..E.....M...AP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvd.......................................qsWRKE..RVL.NVP..LC....KE....DCEQWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGF.....NK..CP.V..G..AAC........QPFHFYF.PT..PT...V.LC......NEIWTY.SYKVS....NYSRG................SGRCIQ................................................................
A0A3Q3AF00_KRYMA/92-253              ...............................................qcldfkppfrpl-----....------.-----.....RDL.QL.........................C.VM.YNEF...............................GCCDHQKD.QE.LL...A.RF.........YR...VM.---GNL..D..............E..R.....G...YA..........DCA.GLV...LEL..LC-QECSP.YAAHL....FDA..........................................eDPST..PLR.TIP.gLC....PD....YCTRFWNQCRS.T.....LPFL...S...DD.....--.-.--..........................--PRV.....RE..A-.E..H..DRR........RFCKLME.LD..DA...D.YCy....pHLLANQ.DLTKNl..gRVQTD................SDGCLQ................................................................
A0A2K6Q6I7_RHIRO/37-193              ..........................................................a-C---....GGSHPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagTCCPSEMD.TT.EI...S.GT.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.HLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFTNCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A2F0AW75_ESCRO/62-237              ...........................................................ICMNA....KPHKPE.PSPEA.....KLY.EE.........................C.IP.WKDS...............................ACCTANTS.WE.AH...L.DV.........SL...LY.NFSLVH..C..............G..L.....M...MP..........DCQ.KHF...LQA..ICFYECSP.NLGPW....IQRld.......................................psGQAE..RIL.DAP..LC....RE....DCEQWWADCRT.S.....YTCK...S...NW.....HG.G.WT..........................WSRGK.....PR..CP.A..R..ALC........HPFLHYF.PT..PA...D.LC......EKIWSN.SFKAS....PEHRT................SGRCLQ................................................................
A0A5A9NYT3_9TELE/65-226              ..........................................................q-CL--....DYKPPF.QPPEP.....LVF.--.........................C.KE.YAKF...............................GCCDLDKD.NQ.IS...Q.RF.........YQ...IM.DY-FDH..T..............G..F.....M...--..........ACG.KYI...RNI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.ELP.gLC....GN....YCNDYWVYCRY.T.....LSLL...T...NN.....NQ.T.YA..........................IEEDR....nKF..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------kylelkdpeycypnvlmsaelnanlgdvqadpqgciq...........................
A0A3M0K652_HIRRU/21-188              ..........................................................g-CLEG....DTQKLN.PSPEP.....HMQ.E-.........................C.TL.YSKS...............................SCCYADFT.EQ.LA...H.SP.........VI..kVS.DSYWNR..C..............G..Q.....L...SK..........SCE.DFT...KKI..ECFYRCSP.HAAHW....IHP...........................................NDTA..AIQ.AVP..LC....QS....FCDDWYEACKD.D.....SICV...R...NW.....LT.D.WE..........................WDESG....eNH..C-.-..K..NKC........IPYHEMY.AN..GT...D.MC......QSMWGK.SFKVS....---ES................SCLCLQ................................................................
D3Z631_MOUSE/26-172                  ...........................................................VCMNS....KRHKQE.PGPED.....ELY.QE.........................C.RP.WEDN...............................ACCTRSTS.WE.AH...L.EE.........PL...LF.NFSMMH..C..............G..L.....L...TP..........ACR.KHF...IQA..ICFHECSP.NLGPW....IQPvv......................................pngQEEQ..RVW.GVP..LC....QE....DCEDWWRACHS.S.....LTCK...S...NW.....LH.G.WD..........................WSEGS.....PP..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------lapsplvwmaag....................................................
A0A2Y9F773_PHYMC/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........SK...MF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lFC....KD....YCKEFFYTCRG.H.....VPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A1L8F099_XENLA/22-183              ...............................................qcldfkppfrpi-----....------.-----.....KEL.TF.........................C.IQ.YKDF...............................GCCDSVRD.GE.IM...Q.NF.........YC..vLS.HFD---..-..............L..S.....G...YE..........SCA.AHV...QDI..LC-QECSP.YAAHL....YDA..........................................eDPST..PVR.TIA.gLC....ED....YCWDVWQTCRS.I.....FQYL...T...TD.....KE.L.LA..........................LESNK....aKF..C-.-..-..---........---RHLA.LQ..DT...D.YC......------.-----....-----................------fprllansnlnqnlglvtadaegclq......................................
A0A672Z3F7_9TELE/23-195              ...................................................chpqcldy-----....--KPPF.EPRQP.....LVF.--.........................C.KE.YSKF...............................GCCDLERD.EE.IS...V.RF.........YS..iMD.NF--DH..S..............G..F.....-...-V..........TCG.KFI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.LLP.gLC....GD....YCTDYWHQCRY.T.....LSLL...L...ED.....LG.N.PQ..........................QFANM....tAG..L-.-..E..EDS.......rRFCDFLE.LK..DR...Q.YCy....pNVMTNE.DLNANl..gSVRED................ATGCL-e...............................................................
A0A452GH52_9SAUR/6-159               ......................................................qhply-----....------.-----.....---.--.........................-.--.---N...............................ACCTAETS.TG.AH...Q.DQ.........SY...LY.NFNWNH..C..............G..V.....M...PE..........MCK.RHF...IQD..TCLYECSP.NLGPW....IDQad.......................................tsWRRE..RIL.NVP..LC....KE....DCELWWEACKD.A.....VTCK...E...NW.....HK.G.WN..........................WTSGT.....NQ..CP.H..S..STC........QLFKYIF.PR..PA...D.LC......EKIWSN.SYKYT....TEHWG................SGRCIQ................................................................
A0A2K6KI95_RHIBE/3-164               ......................................................paame-----....------.-----.....---.VQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.HLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........LTFESYF.PT..PV...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
A0A3Q2ECL3_CYPVA/38-210              ...............................................chpqcldykppf-----....------.-EPQQ.....QLV.F-.........................C.KD.YTKF...............................GCCDLQKD.EE.IS...R.KF.........HS..iMK.NFD---..-..............S..L.....G...SK..........TCG.EYI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.VLP.gLC....GD....YCSSYWLQCRY.T.....LSLL...L...E-.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------dmgnpqqfanwtasieedrnrfcdflelkdkqycypnvltdaelnanlglvredpkgcle....
A0A067JV92_JATCU/29-192              ..........................................vcvskggrfppfssegk-----....--PPKK.VSRGS.....KDL.TL.........................C.RV.FRRK...............................TCCDVAQT.YP.AL...L.SI.........RR...LA.S-----..T..............G..E.....A...SQ..........ECL.HLW...ELL..ECSI-CDP.QIG--....VQP...........................................----..---.GPP.lIC....SS....FCDRVYQACAN.A.....YFSM...D...S-.....NK.Q.VL..........................APCGV.....ND..--.-..-..YVC........GKAAEWV.SN..GT...E.LC......RTA---.-----....-----................------gfavklsdyvhidteeascy............................................
H2Q4C3_PANTR/36-211                  ...........................................................VCMNA....KHHKTQ.PSPED.....ELY.GQ.........................C.SP.WKKN...............................ACCTASTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........TCK.HHF...IQD..GCLYECSP.NLGPW....IRQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCERWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WTSGI.....NE..CP.A..A..ALC........STFESYF.PT..PA...A.LC......EGLWSH.SFKVS....NYSRG................SGRCIQ................................................................
A0A1Z5K225_FISSO/84-225              ..........................................................e-CNVQ....FFHKDV.PSPEG.....DDM.GE.........................C.HP.WKQR...............................SCCHGSTV.AS.TE...E.LK.........-T...LY.GGGPDK..C..............G..V.....M...SD..........ACE.RFF...VFE..YCFYECEP.SVGLFr..kFNDsqt....................................dhpdFNTW..QLY.QMP..MK....KS....YCDAWFDACKN.D.....FYSE...E...SF.....T-.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------seepkevnklsismgv................................................
A0A3S3R303_9MAGN/40-191              ..................................................fssegkppr-----....-----K.VAKGP.....KDL.TL.........................C.RV.FRKS...............................TCCDAAQT.HP.AL...L.SI.........RR...LA.-----S..A..............G..E.....G...SP..........ECL.HLW...EML..ECSI-CDP.RVG--....VQP...........................................----..---.GPP.lIC....AS....LCDMVLQACAN.A.....YFSI...D...A-.....KT.Q.VL..........................S-PCG.....FG..--.-..D..IVC........GRATEWA.SN..GT...E.LC......HQA---.-----....-----................------gfsvplnehsyqdtgdpic.............................................
H3B327_LATCH/36-213                  ...........................................................RCLDG....TAPRRL.KKRDR.....KWS.QDts....................vdiC.HK.LYPR..............................lSCCTRSGR.QG.PS...S.DA.........KI...FS.------..-..............V..T.....N...NT..........ECV.KLL...EEI..KCAY-CSP.QAQNL....FYPpd.......................................ieEASG..REL.VIP.fLC....RD....YCKEFFQTCRG.H.....VPG-...-...-L.....FP.T.TT..........................DEFCL....nYG..RR.D..G..GVCf.....pdFPRNQVR.GP..AS...N.YL......DQMEEY.DKAEEn..sRKHKH................NCFCVQ................................................................
A0A1U7R1V5_MESAU/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RVM.SQlells...............ggeilC.GG.FYPR..............................vSCCLQSDS.PG.LG...R.LE.........NK..iFS.------..-..............S..T.....N...NT..........ECD.RLL...EEI..KCAP-CSP.HSQSL...fCSPe.........................................rEVLD..GDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-L.....LQ.T.TA..........................DEFCF....yYT..RK.D..G..GACf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.EKVEEl..sRKHKH................SCFCVQ................................................................
A0A674NA43_TAKRU/61-220              ................................................qcldfkppfrp-----....------.----M.....KEL.EL.........................C.VM.YKDF...............................GCCDYQKD.QE.LL...L.KF.........YH..vME.HFD---..-..............Y..N.....G...YS..........NCA.GYV...LEL..LC-QECSP.YAAHL....FDT..........................................eDTQT..PVR.TIP.gLC....PD....YCEEFWKKCNS.T.....VPLL...-...--.....--.-.--..........................--LGK.....PH..MG.K..Q..QPA........ERCQDLV.LD..DM...D.YC......------.-----....-----................------yprllsnqklnknlgrvqadgdgclq......................................
A0A384DFQ4_URSMA/1-168               ........................................................mel-----....------.KDKSG.....VFP.TQ.........................C.TP.WKEK...............................ACCSASTS.QE.LH...K.DI.........SL...LY.NFTWDH..C..............G..K.....M...EP..........ACR.RHF...IQD..NCLYECSP.NLGPW....IREvn.......................................qsWRRE..RFL.HVP..LC....KE....DCQRWWEDCRT.S.....YTCK...A...NW.....HR.G.WD..........................WTSGI.....NK..CP.A..K..TTC........RTFEAYF.PT..PA...A.LC......EGLWSH.SYQAS....NYSRG................SGRCIQ................................................................
A0A226PHG7_COLVI/27-188              ..................................................qcldfkppf-----....------.RPPR-.....-AL.AF.........................C.RR.YGAF...............................GCCDARRD.RA.LL...E.RF.........YR...LS.---AHL..D..............G..A.....T...YA..........ACA.GHL...QDL..LC-QECSP.YAAHL....YDA..........................................eDPST..PVR.TIP.gLC....QD....YCQQVWQKCRS.I.....FHYL...S...TD.....PE.L.IA..........................LENNM....aKF..--.-..-..--C........RYLS---.LE..DT...D.YCf....pH-----.-----....-----................------llanenlnqnlglvtadaegclq.........................................
A0A1V4L0L5_PATFA/141-276             ...........................................................VCMDA....KHHKTE.PGPEG.....ELY.GQ.........................C.SP.WRDN...............................ACCTANTS.LE.AH...R.DQ.........SY...LY.NFNWDH..C..............G..A.....M...SS..........KCK.RHF...IQD..TCLYECDP.NLGPW....IDEsd.......................................tsWRRE..RIL.HVP..LC....RE....DCEQWWDDCQD.S.....VTCK...V...NW.....HK.G.WN..........................WTSVT.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------pgppp...........................................................
A0A093IZS2_EURHL/3-129               ........................................................lsv-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..T.....N...NT..........ECA.KLL...EEI..KCAH-CSP.HAQNL....FHSpe.......................................kgETPE..REL.TLP.yLC....KD....YCKEFYYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GVCf.....pdFPRKQVR.GP..AS...N.SL......DHMEEY.DKEEEi..sRKHKH................NCFCIQ................................................................
A0A1S3K2Z7_LINUN/34-177              .......................................................ycsf-----....-FNNRA.PKPQP.....DLK.N-.........................C.TW.YKEN...............................SCCLQREI.DA.TF...G.KV.........KP...LQ.------..-..............-..G.....A...SK..........DCS.DYI...NYL..MC-YICAP.NQNLY....YRI...........................................----..--E.RLY..VC....EG....FCDSLYSACNS.A.....ILKG...S...V-.....IR.D.L-..........................YSNGK.....EF..CE.S..-..---........-------.--..--...-.--......------.-----....-----................------rrfivrnasaescfdlheslvksgsichsnps................................
A0A485MMK9_LYNPA/31-206              ...........................................................VCMDA....KHHKEK.PSPED.....ELH.EQ.........................C.SP.WKKN...............................SCCFANTS.RE.AH...K.DI.........SY...LY.RFNWDH..C..............G..Q.....M...AP..........ACK.QHF...IQD..TCLYECSP.NLGPW....IQQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCQQWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WSSGH.....NR..CP.V..G..AAC........HHFHFYF.PT..PA...A.LC......EGIWSH.SYKLS....NYSRG................SGRCIQ................................................................
A0A6G0IV69_LARCR/65-240              ...........................................................MCMDG....THHKVE.PGPEG.....DLY.SQ.........................C.TP.WRDN...............................ACCTANTS.SA.AH...N.DN.........SY...LY.NFNWNH..C..............G..V.....M...SA..........KCK.EHF...IQD..TCFYECSP.HLGPW....IQKvd.......................................qsWRRE..RIL.NVP..LC....NE....DCHKWWEDCKN.D.....YTCK...T...NW.....HV.G.WD..........................WSSGT.....NK..CP.T..G..SKC........RKWTDVY.PT..AK...S.MC......EEIWSN.SYIYT....TYSKT................SGRCMQ................................................................
F1Q4J6_CANLF/38-220                  ...........................................................RCLNG....NPPKRL.KRRDR.....RLM.SQlells...............ggevlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........TK...IF.S-----..-..............M..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.YSQSL....FHSp........................................erEALE..RDL.VLP.lLC....KD....YCKEFFYTCRS.H.....IPG-...-...-F.....IQ.T.TA..........................EEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
H2N3N0_PONAB/47-205                  .................................................dygppfqpll-----....------.-----.....-HL.EF.........................C.SD.YESF...............................GCDQHKDR.RI.AA...R.YW.........DI...ME.YFD---..-..............L..K.....R...HE..........LCG.DYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNTQT..PLR.NLP.gLC....SD....YCSAFHSNCHS.A.....ISLL...T...ND.....-R.G.LQ..........................ESHGR.....DG..T-.-..-..---........RFCHLLD.LP..DK...D.YC......------.-----....-----................------fpnvlrndylnrqlgmvaqdpqgclq......................................
A0A665UJN7_ECHNA/48-221              .............................................rchpqcldykppfe-----....------.--PQQ.....PLV.F-.........................C.KE.YSKF...............................GCCDLEKD.EQ.IS...V.RF.........YS..iME.N--FDH..S..............G..F.....-...-I..........TCG.KYI...RNI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.ILP.gLC....GD....YCYNYWHQCRY.T.....LSLL...L...EN.....MG.S.PQ..........................QLSNL.....TA..AI.E..E..DRR........RFCDLLE.LK..DK...Q.YC......------.-----....-----................------ypnvltnaelnanlglmredpegcle......................................
F1S9I3_PIG/147-306                   ...............................................dygppfqpllpl-----....------.-----.....---.EF.........................C.SD.YDNF...............................GCCDQRKD.RR.IA...A.RY.........WD...IM.EYF-D-..-..............L..K.....G...HE..........LCG.GYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....SD....YCSAFHSNCHS.A.....ISLL...T...SD.....-R.R.L-..........................-----.....QQ..SH.Q..K..DGA........RFCHLLN.LP..DQ...D.YC......------.-----....-----................------fpnvlrsnhltgklgvvaedprgclq......................................
A0A4S2LY33_OPIFE/95-237              ...........................................................ICING....THHKKA.PSPEP.....TDD.HI.........................C.TD.WASM...............................SCCEHKTM.RS.VQ...-.-D.........SL...LY.GFNHSH..C..............K..P.....M...SQ..........KCI.NMF...KRE..LCFYECSP.HVGPW...lV-Ktq.......................................slRRRE..RSY.LVP..LC....EE....DCNKWYEACKN.E.....ETCV...R...DW.....SV.E.FE..........................WSEVC.....RK..S-.-..-..---........-------.--..--...-.--......------.-----....-----................------sdhktygpgsq.....................................................
A0A3N0Z353_ANAGA/25-186              ..........................................................q-CL--....DYKPPF.QPPEP.....LLF.--.........................C.KE.YAKF...............................GCCNLDRD.NQ.IS...Q.RF.........YQ...IM.DY-FDH..T..............G..F.....M...--..........ACG.KYI...RSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.ELP.gLC....GN....YCGDYWLHCRY.T.....LSLL...I...NN.....NE.T.YA..........................IEEDR....sKF..C-.-..-..---........-------.--..--...-.--......------.-----....-----................------kylelkdpeycypnvlsndelnanlgdvkadpqgciq...........................
A0A2Y9M9H7_DELLE/27-177              ..........................................................a-C---....GGSHPL.PARSQ.....RHH.RL.........................A.SN.LGTS...............................QLHLAEMN.TP.EA...S.DP.........GI...VS.----GS..C..............G..E.....L...SP..........GCE.SFL...GHL..QVALRSRF.HLLLL...gVRQ...........................................----..---.TQP..LC....SE....LCDAWFATCES.D.....TIC-...-...--.....CP.T.WL..........................PLLEK.....RG..C-.-..E..PGC........TTYGQTF.AD..GA...E.LC......RSFLGY.AVPVA....--DPG................SGHCLN................................................................
A0A2K6L4W1_RHIBE/59-198              ..........................................................a-C---....GGSHPL.QARSQ.....GHH.GL.........................A.AD.LGKGklh.........................lagTCCPSEMD.TT.EI...S.GT.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.HLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFTNCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQAR.VQ..WH...D.LC......S-----.-----....-----................------lq..............................................................
A0A3B5KMZ9_TAKRU/46-215              ....................................................qcldykp-----....----PF.QPQQ-.....PLV.F-.........................C.KE.YSKF...............................GCCDLQKD.EE.IR...I.RF.........YT..iME.--NFDH..S..............G..Y.....V...--..........TCS.RYI...HSI..LC-QECSP.YAAHL....YDA..........................................eDANT..PMR.ILP.gLC....GN....YCADYWHRCRY.T.....MSLL...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------ledlgvlhqyanitmaieedrkrfcdflelkdkqycypnvltsaelnanlgfvrenpkgcle..
A0A673ZDL0_SALTR/29-207              ...........................................................ACLQD....GRQKTT.PSQEP.....HLK.E-.........................C.TI.YAEN...............................ACCSEDDI.QD.LI...P.TT.........SE...-K.NSPWDK..C..............G..K.....L...SP..........KCE.DFL...KRV..TCFYRCSP.DAARW....PHS...........................................HLQS..SMQ.AVP..LC....HS....FCRDWYEACRM.D.....MTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GNC........VPYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDEEE................------ereggegisngnggrpcgclt...........................................
A0A093QTR6_PYGAD/3-165               ..............................................qcldygppfqppf-----....------.-----.....-HL.EF.........................C.SA.YENF...............................GCCDQERD.NS.IA...A.KY.........WD...IM.DYVDPR..-..............-..-.....G...HK..........LCG.TYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPRT..PLR.NLP.gLC....FD....YCSEFHFNCRS.A.....ISLL...-...--.....--.-.-T..........................SDKHI.....QE..CC.E..T..NKT........RFCNLLH.LH..DE...D.YCf....pNVLKNT.ALNRNl..gSVVQD................RKGCL-q...............................................................
G5E8D3_MOUSE/26-170                  ...........................................................VCMNS....KRHKQE.PGPED.....ELY.QE.........................C.RP.WEDN...............................ACCTRSTS.WE.AH...L.EE.........PL...LF.NFSMMH..C..............G..L.....L...TP..........ACR.KHF...IQA..ICFHECSP.NLGPW....IQPvv......................................pngQEEQ..RVW.GVP..LC....QE....DCEDWWRACHS.S.....LTCK...S...NW.....LH.G.WD..........................WSEE-.....NG..T-.-..-..---........-------.--..--...-.--......------.-----....-----................------pskvlvktaee.....................................................
U3I6W0_ANAPP/48-153                  ...........................................................VCMDA....KHHKTK.PGPEG.....TLH.GQ.........................C.AP.WKDN...............................ACCTANTS.SE.AH...R.DQ.........SY...LY.NFNWNH..C..............G..V.....M...PP..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQ...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------mwfdpakgnpnvvvakyyawkk..........................................
R0JWY8_ANAPL/31-206                  ...........................................................VCMDA....KHHKTK.PGPEG.....TLH.GQ.........................C.AP.WKDN...............................ACCTANTS.SE.AH...R.DQ.........SY...LY.NFNWNH..C..............G..V.....M...PP..........KCK.RHF...IQD..TCLYECSP.NLGPW....IDQvd.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKD.Y.....VTCK...D...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SIC........RPFSEVF.PE..PK...D.LC......EKIWSN.SYKYT....TERRG................SGRCIQ................................................................
A0A5F8H9K8_MONDO/33-194              ..................................................qcldfkppf-----....------.RPPRP.....LP-.-F.........................C.EQ.YTAF...............................GCCDAEQD.AA.LS...R.RY.........WA..vTS.RLE---..-..............P..D.....T...FA..........VCA.AYV...RDL..LC-QECSP.YAAHL....FDA..........................................eDPST..PLR.TVP.gLC....KD....YCIDVWQKCRI.I.....FRHL...S...PD.....PE.L.WA..........................LETNR....aKF..C-.-..-..---........RYLS---.LD..DA...D.YCf....pRLLVNE.NLNVNl..gQVRAD................TEGCL-e...............................................................
G1R071_NOMLE/38-220                  ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LE.........NK...IF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
G1QJ55_NOMLE/22-183                  ...................................................qcldfrpp-----....-----F.RPPQ-.....-PL.RL.........................C.AQ.YSDF...............................GCCDEGRD.AE.LT...R.RF.........WA...LAsRVD---..-..............A..A.....E...WA..........ACA.GYA...RDL..LC-QECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRG.L.....FRHL...S...TD.....QE.L.WA..........................LEGNR....aRF..C-.-..-..---........RY---LS.LD..DT...D.YC......------.-----....-----................------fpyllvnknlnsnlghvvadakgclq......................................
A0A6I8PWX7_XENTR/25-186              ......................................................qcldy-----....--KPPF.QPSQP.....LDF.--.........................C.SA.YSSF...............................GCCDSAQD.EA.IA...S.RY.........HY...IT.DF-LDH..S..............G..-.....-...VT..........ACG.DYI...RDI..LC-QECSP.YAAHL....YDA..........................................eDVNT..PLR.DLP.gLC....GN....YCTEFWHRCRY.T.....LSL-...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------iieerdvteiegdlgkfcsflslddvnycypnvltnaelnsglgevkedeegclq.........
A0A093NQN6_PYGAD/31-206              ...........................................................ICMDA....KHHKTK.PGPEG.....MLY.DQ.........................C.AP.WKDN...............................ACCTANTS.LE.AH...K.DQ.........SN...LY.NFNWNH..C..............G..L.....M...PP..........KCK.SHF...IQD..TCLYECSP.NLGPW....IDQad.......................................ssWRRE..RIL.HVP..LC....KE....DCEEWWEDCKD.Y.....VTCK...E...NW.....HK.G.WN..........................WATGT.....NR..CP.W..G..SMC........RPFSHVF.PQ..PK...D.LC......EKIWSN.SYKYT....TEHRG................SGRCIQ................................................................
A0A2K6N9T0_RHIRO/36-211              ...........................................................VCMNA....KHHKAQ.PSPED.....ELY.GQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DI.........SR...LY.NFNWDH..C..............G..K.....M...QP..........ACK.RHF...IQD..ACLYECSP.NLGPW....IWQvn.......................................qsWRKE..RIL.NVP..LC....KE....DCEHWWEDCRT.S.....YTCK...S...NW.....HK.G.WN..........................WSSGI.....NE..CP.A..G..ALC........RTFESYF.PT..PA...A.LC......EGLWGH.SFKVS....NYSGG................SGRCIQ................................................................
A0A1Q9DPC2_SYMMI/287-454             ........................................................sch----L....KGEQER.PGQMS.....PTL.AE.........................C.HP.WRSS...............................ACCSQSEV.AT.LE...K.LK.........QR..lGA.GFQWDR..C..............G..P.....L...SQ..........ECE.RFF...VQE..ACFYECDP.NAGLYr..kYNEsaydprcdaenk..................ayqpiyaasllcsHNQW..ELH.QLP..VR....AS....YCDAWFAACHK.E.....HFCA...D...AS.....GD.F.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------fscegvfkavdmeaqivnntw...........................................
A0A3Q2HIS8_HORSE/26-201              ...........................................................VCMNT....QHHKRE.PGPED.....KLH.KE.........................C.IP.WKDS...............................ACCTANTS.WK.AH...L.NV.........SL...LY.NFSLVH..C..............G..L.....M...MP..........GCQ.RHF...IQA..VCFYECSP.NLGPW....IQQvd.......................................lsGQGE..RIL.DAP..LC....RE....DCEQWWEDCRT.S.....YTCK...S...NW.....HG.G.WD..........................WSGGK.....NR..CP.A..R..ARC........HPFPHYF.PT..PA...D.LC......ERIWSN.SFKAS....PEHRN................SGRCLQ................................................................
A0A3Q2DXE5_CYPVA/26-204              ...........................................................VCLQD....GKHKAT.PGPEP.....NLS.E-.........................C.GL.YADN...............................SCCTEEDI.QD.IA...Y.VP.........SD..sNK.NEPWDK..C..............G..P.....L...SP..........ECE.GYL...KRV..SCFYRCSP.DASRW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRM.D.....MTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GTC........VQYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDDQQevgeag...etvgegrPCGC--lt..............................................................
A0A2K5R2D8_CEBCA/48-206              ..................................................ygppfrpll-----....------.-----.....-HL.EF.........................C.SD.YESF...............................GCCDQHKD.RR.IA...A.RY.........WD..iME.YFD---..-..............L..K.....R...HK..........LCG.DYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....SD....YCSAFHSNCHS.A.....ISLL...T...S-.....DR.G.LQ..........................ESPGT.....DG..A-.-..-..---........RFCHRLD.LP..DK...D.YCf....pN-----.-----....-----................------vlrndylnrnlgvvaqdprgclq.........................................
C3Y0S4_BRAFL/3-162                   .................................................pfepaeplvf-----....------.-----.....---.--.........................C.RE.YGDF...............................GCCTRRQD.YE.LQ...R.QF.........DD..iMR.RMP---..-..............Y..H.....L...QT..........SCH.HHV...MNI..LC-QECSP.YASHL....YDL...........................................ETTQ..VKK.PLP.gMC....PQ....YCPTVFDSCKD.I.....IPF-...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------itgdptvqhaitlsnytqfcevtsitdmdycypnllaneqlsgdiqeavqgtggegclcfq...
A0A341ARR8_NEOAA/38-220              ...........................................................RCLNG....NPPKRL.KRRER.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........SK...MF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lLC....KD....YCKEFFYTCRG.H.....VPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A2K6RR53_RHIRO/47-222              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCTANTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.HLGPW....IRQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........LTFESYF.PT..PV...A.LC......EGLWSH.SYKVS....NYSRG................SGRCIQ................................................................
F7CKM1_MONDO/37-213                  ...........................................................VCMDG....KHHKYK.PGQED.....NLH.QQ.........................C.SP.WKKR...............................ACCTASTS.IA.AH...E.DA.........SH...LY.KFNFSH..C..............G..M.....L...TP..........ACK.RHF...VQD..LCLYECSP.NLGPW....IQPvn.......................................ssWRKE..RVM.NIP..LC....KE....DCNMWWEDCKT.S.....YTCK...E...NW.....HK.G.WN..........................WSSGI.....NE..CP.V..K..AAC........HPFSFYF.PT..PT...S.LC......ENIWSR.SYNAS...hSYGRG................SGKCIQ................................................................
G1NDJ8_MELGA/23-190                  ..........................................................g-CLEG....DTHKVK.PSPEP.....NMH.E-.........................C.TL.YSES...............................SCCYANFT.EQ.LA...H.SP.........VI..kVS.NSYWNR..C..............G..Q.....L...SK..........SCE.DFT...KKI..ECFYRCSP.HAAHW....INP...........................................RYTA..AIQ.SVP..LC....QS....FCDDWYEACKD.D.....SICA...R...NW.....LT.D.WE..........................RDESG....eNH..C-.-..K..SKC........MPYGEMY.AN..GT...D.MC......QSMWGE.SFKVS....---ES................SCLCLQ................................................................
A0A3M6V5B8_9CNID/42-193              ..........................................................y-CP--....YFKNRG.PSRQE.....NLR.N-.........................C.SW.YKEN...............................SCCHDEEI.EF.AF...R.QL.........SP...LE.------..-..............-..G.....A...NG..........QCA.QYM...NYL..YC-YICAP.NQNTF....FKD...........................................----..--F.TLT..VC....EE....FCDHIYNACQN.A.....ILKG...R...KL.....EH.V.YKsgq....................efcKARRF....kTD..KE.A..H..GKC........FTYK---.--..--...-.--......------.-----....-----................------gkpntksasqqlsvnskyaghne.........................................
A0A4U1ECT0_MONMO/30-205              ...........................................................VCMDA....KHHKIK.PGPED.....KLH.DQ.........................C.IP.WKKN...............................ACCSAKVS.QE.LH...R.DT.........SS...LY.NFNWEH..C..............G..K.....M...KP..........ACK.RHF...IQD..NCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RFL.NVP..LC....KE....DCQSWWEDCRT.S.....YTCK...T...NW.....QK.G.WN..........................WTSGS.....NK..CP.T..G..TTC........GTFEFYF.PT..PA...A.LC......EGLWSN.SYKLS....NYSRG................SGRCIQ................................................................
A0A3Q0FNI2_ALLSI/26-201              ...........................................................VCMDD....KHHKAN.LGPVG.....ELH.GQ.........................C.TP.WKAN...............................ACFTGNTS.TE.AH...R.DQ.........SY...LY.RFKWNH..C..............G..V.....M...LH..........KCQ.HHF...IQD..NFLYECSP.NLGPW....ILKtd.......................................ssWQRE..RIL.HVP..LC....KE....DCEEWWENCKD.Y.....VTCK...E...NW.....HK.G.WN..........................WATGT.....NH..CP.W..G..TVC........RPFKLVF.PR..AA...V.LC......EKIWSD.SYKYT....TAPRD................RGRCIQ................................................................
A0A1S3G802_DIPOR/228-357             ....................................................sesifsa-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..T.....N...NT..........ECG.RLL...EEV..KCAP-CSP.HSQSL....FHSp........................................erEVLE..RDL.VLP.lLC....PD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................EEFCF....yYA..RK.D..G..GLCf.....pdFPRKQVR.GP..AS...N.YL......DQMEEY.DKAEEi..sRKHKP................NCFCVQ................................................................
A0A384APX0_BALAS/38-220              ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQlells...............ggemlC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........SK...MF.S-----..-..............V..T.....N...NT..........ECG.KLL...EEI..KCAL-CSP.HSQSL...fYSPe.........................................tESLE..RDL.ALP.lLC....KD....YCKEFFYTCRG.H.....VPG-...-...-F.....LQ.T.TA..........................DEFCF....yYA..RK.D..G..GLCf.....pdFPRKQIR.GP..AS...N.YL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A4W5LT33_9TELE/29-207              ...........................................................ACLQD....GRQKAT.PSQEP.....HLK.E-.........................C.TI.YAEN...............................ACCSEDDI.QD.LN...P.TT.........SE...-K.NSPWDK..C..............G..K.....L...SP..........KCE.DFL...KRV..TCFYRCSP.DAARW....PHS...........................................HLQS..SMQ.AVP..LC....HS....FCRDWYEACRM.D.....MTC-...-...--.....AR.H.WA..........................RDPRG.....QN..C-.-..T..GNC........VPYQQMY.QH..GR...N.LC......ESLWGD.AFMTV....EDEEE................------ereggegisngnggrpcgclt...........................................
A0A2I4H1H5_JUGRE/32-195              ........................................vcvsqggrfppfssegkpp-----....----RK.VSKGA.....KDL.TL.........................C.RV.FRRK...............................TCCDVAQT.YP.AL...L.SV.........RR...LA.S-----..T..............G..E.....G...SP..........ECM.HLW...ELL..ECSI-CHP.RVG--....VQA...........................................----..---.GPP.lIC....SS....FCARVYEACSN.A.....YFSM...D...AK.....-A.Q.VL..........................APCGL.....K-..--.-..D..FIC........GRASKWV.SN..GT...E.LC......LA----.-----....-----................------agfsvnptdemymstedtscy...........................................
A0A5N5KFU0_9ROSI/13-175              ...........................................vcvskggrfppysseg-----....------.KPPKKvgkgaRDL.TL.........................C.RL.FHKK...............................TCCDVAQT.YP.AS...L.SV.........RR...LA.S-----..T..............G..E.....A...SQ..........ECL.QLW...ELL..ECSI-CDP.QIG--....VQP...........................................----..---.GPP.lIC....AS....FCDRVYQACAS.A.....YFSM...D...AN.....--.-.--..........................KRVIA....pCG..V-.N..D..FVC........GQASEWV.SN..GT...E.LC......HAA---.-----....-----................------gfavklsddayvdveevsc.............................................
M3YLD8_MUSPF/27-201                  ...........................................................VCMNT....KHHKRE.PGPED.....QLY.KE.........................C.NP.WRGN...............................ACCRADTS.LN.TH...L.DL.........PL...LY.NFSLHH..C..............G..V.....M...LP..........DCE.KHF...LQA..ICLYQCSP.NLGPW....IQKld.......................................sgGPGE..RIL.EVP..LC....WE....DCEQWWEDCRT.S.....YTCK...A...DW.....-H.G.WD..........................RTEGK.....NL..CP.A..Q..AFC........HPFPHYF.PT..PV...D.LC......EKIWSH.SFKAS....PEHRN................SGQCLQ................................................................
H9GQT5_ANOCA/10-102                  ...................................lhafyvlsretsqskatfynlsls-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.------..-..............-..-.....-...--..........---.---...---..--------.-----....---...........................................----..---.---..--....-S....LCR--YDACKN.D.....FICV...K...NA.....LT.D.WE..........................IDERG....eNH..C-.-..K..NEC........ISYRKMY.AN..GT...E.MC......ETMWGV.SLKVS....---DS................NCLCLQ................................................................
A0A2Y9F2Q7_PHYMC/34-209              ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCSVNTS.QE.AH...K.DI.........SY...LY.RFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQEvn.......................................qsWRKE..RVL.NVP..LC....KE....DCQIWWEDCRT.S.....YTCK...T...NW.....HK.G.WN..........................WTAGY.....NQ..CP.V..R..AAC........HRFDFYF.PT..PA...A.LC......NEIWSH.SYKVS....NYGRG................SGRCIQ................................................................
A0A3Q7SWQ2_VULVU/56-197              ......................................stalssvsssvkrgadqfmqt-----....------.-----.....---.--.........................-.--.----...............................--------.--.--...-.--.........--...--.----VE..C..............P..A.....C...VR..........RCT.PGV...QQPgpLPSEECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....ED....YCLDMWQTCRG.L.....FRHL...S...PD.....RE.L.WA..........................LEGNR....aKF..C-.-..-..---........RYLS---.LD..DA...D.YCf....pRLLVNK.NLNSNl..gRVVAD................AKGCL-q...............................................................
A0A2K5RGK0_CEBCA/20-181              ..................................................qcldfrppf-----....------.--RPQ.....RLL.AL.........................C.SR.YSVF...............................GCCDEKRD.AE.LT...S.RF.........WA...LA.NR---M..L..............A..A.....E...WA..........DCA.GYA...REL..LC-QECSP.YAAHL....YDA..........................................eDPST..PLR.TVP.gLC....QD....YCLTMWQKCRR.L.....LRHL...S...TD.....KK.L.WA..........................LEDNR....dKF..C-.-..-..---........---HYLS.LD..DM...D.YCy....pNLMVN-.-----....-----................------knlssdlghmvadatgclq.............................................
S4RHD7_PETMA/30-210                  ...........................................................ICMDA....KHHKTK.PGPEG.....LLY.GQ.........................C.EP.WKDN...............................ACCNANTT.EQ.AH...E.DQ.........SY...LY.NFNWNH..Cws.........lgqP..K.....L...SD..........KCK.KHF...VQD..TCLYECSP.NLGPW....IQKtd.......................................ssWRKE..RIL.NVP..LC....KS....DCQSWWNDCRN.D.....YTCK...E...NW.....HS.G.WE..........................WINGT.....NL..CP.P..D..SQC........QMFDVIF.PT..PK...D.LC......ERIWSS.SYKYT....EDDRG................SDRCIQ................................................................
A0A0A0MVH3_PAPAN/59-215              ..........................................................a-C---....GGSHPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagTCCPSEMD.AT.EI...S.GP.........GN...--.--HPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....LCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A452SU57_URSAM/30-205              ...........................................................VCMDA....KHHKAK.PGPED.....KLH.NQ.........................C.TP.WKEK...............................ACCSASTS.QE.LH...K.DI.........SL...LY.NFTWDH..C..............G..K.....M...EP..........ACR.RHF...IQD..NCLYECSP.NLGPW....IREvn.......................................qsWRRE..RFL.HVP..LC....KE....DCQRWWEDCRT.S.....YTCK...A...NW.....HR.G.WD..........................WTSGI.....NK..CP.A..K..TTC........RTFEAYF.PT..PA...A.LC......EGLWSH.SYQAS....NYSRG................SGRCIQ................................................................
A0A2K6T2M9_SAIBB/59-215              ..........................................................a-C---....GGSHPL.QARSQ.....RHH.GL.........................A.AD.LGKGklh.........................lagPCCPSEMD.TT.ET...S.GP.........GN...--.--YPER..C..............G..V.....P...SP..........ECE.SFL...EHL..QRALRSRF.RLRLL...gVRQ...........................................----..---.AQP..LC....EE....FCQAWFANCED.D.....ITC-...-...--.....GP.T.WL..........................PLSEK.....RG..C-.-..E..PSC........LTYGQTF.AD..GT...D.LC......RSALGH.ALPVA....--APG................ARHCFN................................................................
A0A6Q2YLR5_ESOLU/36-214              ...........................................................RCYDG....SMPKRL.KKRDR.....KLS.VDggas.................sgevC.HR.LYPR..............................vSCCPTRRA.AY.QI...V.HR.........RD...AR.IF----..-..............S..T.....N...NT..........ECS.RLL...EEI..KCA-RCSP.NAQVL....FHSae.......................................sdKVPL..REP.HLP.rLC....QD....YCREFYYTCRG.H.....IPEL...-...-F.....QA.D.V-..........................DEFCQ....yYG..KR.D..G..GLCf.....pdFQRKQTR.GQ..DS...N.YL......GD--EN.VEDIN....RKHKH................NCYCAQ................................................................
A0A1W0X2G5_HYPDU/2-166               .....................................................kvdlsn-----....------.-----.....---.TS.........................C.SA.WASR...............................SCCTRDTA.KH.IS...R.NA.........SDg.tWL.NFDWDH..C..............G..Dk..lpL...SP..........KCR.KHF...VDD..LCFYECSP.NTGPW....IISdl.......................................rtIRKE..RFF.SVP..LC....RS....ECDAWFEDCQG.D.....FTCT...D...NW.....AK.N.FV..........................WTQGK.....NS..CP.N..G..SQC........RTFKDIF.GT..SK...R.FC......ETVFDG.SFKYA....D---D................TQPCM-k...............................................................
W4XKK9_STRPU/19-164                  ....................................................qcldfyp-----....----PF.ELPSD.....SQP.-F.........................C.DG.YKDF...............................GCCTLTQN.EA.IR...E.RY.........QT...LK.R---NL..P..............E..S.....A...AH..........ECR.NFL...KDI..LC-QECSP.YAAHL....FDA...........................................ETTH..RKT.PLP.gLC....GG....YCSSLYNTCPE.L.....IPLV...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------tddaaiidahntnesafcaaveigdmdycypnilqdtf..........................
A0A2K6C7H9_MACNE/22-183              ..................................................qcldfrppf-----....------.--RPP.....QLL.RL.........................C.AQ.YSDF...............................GCCDEGRD.AE.LT...R.RF.........WD...LAsRVD---..-..............T..A.....E...WA..........ACA.GYA...RDL..LC-QECSP.YAAHL....YDA..........................................eDPFT..PLR.TVP.gLC....QD....YCLDMWHKCRG.L.....FRHL...S...TD.....--.-.--..........................--QEL.....RA..L-.E..G..NRA........RFCRYLS.LD..DT...D.YCf....pYLLVNK.NLNSNl..gHVVAD................AKGCL-q...............................................................
A0A0P7ZE86_SCLFO/55-199              ...............................................qcldfeppfglp-----....------.-----.....HHL.EF.........................C.RE.YEKF...............................GCCDQDMD.NR.IA...E.RY.........WD..iMD.LYD---..-..............M..Q.....G...DE..........LCG.QFI...KNI..LC-QECSP.YAAHL....YDA..........................................eDSYT..PIR.HIP.gLC....SN....YCSEFHVNCRS.M.....VKH-...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------ltddkgllevcqkdpikfcnllslpdpdycypdvlhst..........................
L5MEG2_MYODS/38-220                  ...........................................................RCLNG....NPPKRL.KRRDR.....RMM.SQqells...............ggempC.GG.FYPR..............................lSCCLRSDS.PG.LG...R.LD.........HK...IF.S-----..-..............V..N.....N...NT..........ECG.KLL...EEI..KCAL-CSP.YSQNL....FHSp........................................erEALD..RDL.VLP.lLC....KD....YCKEFFYTCRG.H.....IPG-...-...-F.....LQ.T.TA..........................EEFCF....yYA..RR.D..G..GLCf.....pdFPRKQVR.GP..AS...N.SL......DQMEEY.DKVEEi..sRKHKH................NCFCIQ................................................................
A0A094L2Q6_PODCR/21-161              ..........................................................g-CLEG....GTHKLE.PSPEP.....NMH.E-.........................C.TL.YSKS...............................SCCYADFT.EQ.LA...H.SP.........VI..kVN.NSYWNR..C..............G..Q.....L...SK..........SCE.DFT...KKI..ECFYQCSP.HAAHW....IHP...........................................NYTA..AIR.SVP..LC....QS....FCEDWYEACKD.D.....SICV...R...NW.....LT.D.WE..........................WDESG....eNH..C-.-..K..NKC........IPYSK--.--..--...-.--......------.-----....-----................------v...............................................................
A0A4W6F247_LATCA/28-192              ...........................................................MCLQD....GKHKAT.PSPEP.....HLK.D-.........................C.AL.YADN...............................SCCTEDDI.QD.IS...H.VP.........AA..nNK.NEPWDK..C..............G..P.....L...SS..........ECE.GFL...KRV..SCFYRCSP.DAARW....PHP...........................................HRRS..YIQ.AVP..LC....HS....FCRDWFDACRM.D.....LTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GTC........VQYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDEP-................------edvgea..........................................................
A0A3P9B4E6_9CICH/28-209              ...........................................................VCLQD....GKHKAT.PSPEP.....HLT.E-.........................C.SL.YADN...............................SCCTQEQI.QD.IS...H.VP.........SA..nNQ.NEPWDK..C..............G..S.....L...SP..........ECE.GFL...KRV..LCFYRCSP.DAARW....PHP...........................................QRSS..YIQ.AVP..LC....HS....FCRDWFDACRM.D.....LTCA...-...--.....-R.N.WA..........................RDPRG.....QN..C-.-..T..GNC........VQYQQMY.QH..GR...D.LC......ESLWGD.AFMTV....EDEPE................------evgeageigvdvegvrpcgclt..........................................
G1KRJ2_ANOCA/23-190                  ..........................................................k-CLGG....GGHKDI.PTQEN.....NLK.E-.........................C.TL.YTKS...............................SCCHADIT.EE.LA...H.SP.........VI..kVN.TTYWNR..C..............G..N.....H...SK..........LCE.DYL...KKI..ECFYRCSP.HAAFW....AHH...........................................QYEA..AID.SVP..VC....KT....FCDNWYDACKN.D.....FICV...K...NA.....LT.D.WE..........................IDERG....eNH..C-.-..K..NEC........ISYRKMY.AN..GT...E.MC......ETMWGV.SLKVS....---DS................NCLCLQ................................................................
M7BJ70_CHEMY/12-178                  ...........................................................RCLAG....GKHKVA.PSPEG.....QLG.V-.........................C.QL.YAAN...............................ACCSPKVA.QE.IS...S.AP.........LA..kVN.DISWNR..C..............R..S.....L...SP..........RCK.HYL...QRV..ECFYRCSP.SAARW....PHP...........................................QRPT..AVL.EVP..LC....LS....FCEAWYEACKD.D.....LTCA...R...NW.....VS.D.WQ..........................WGPQG.....NN..C-.-..S..RDC........VPYSQMY.RD..GR...E.LC......ENIWGD.SFVAA....---RE................PCPCL-s...............................................................
G3U6S7_LOXAF/49-130                  ...........................................................VCMEA....KYHKTK.PGPED.....KLY.GQ.........................C.SP.WRKN...............................ACCSVNTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ECA.T--...---..--------.-----....---...........................................----..---.---..--....--....-----------.-.....----...-...--.....--.-.--..........................-----.....--..--.-..-..---........-------.--..--...-.--......------.-----....-----................------ssrtpvsmsapptwgpgsk.............................................
A0A3P9C2F5_9CICH/21-183              ................................................qcldfkppfkp-----....------.--PW-.....-HL.EF.........................C.NQ.YEQF...............................GCCDQGTD.NM.IA...E.RY.........WD..iIE.QLE---..-..............A..A.....G...HE..........LCT.DML...KEI..MC-QECSP.YAAHL....YDA..........................................eDPYT..PVR.EIP.gLC....FD....YCSEFHSKCRH.V.....LKYL...-...-T.....VN.Q.LL..........................LYAAE.....RD..V-.-..T..TFC........SMV---D.LP..DQ...D.YC......------.-----....-----................------yptvlkssdlnsnlgqvvedprgclq......................................
A0A091UKA2_PHORB/3-165               ..............................................qcldyrppfqppf-----....------.-----.....-HL.EF.........................C.SA.YENF...............................GCCDQERD.NS.IA...A.KY.........WD...IM.DYIDP-..-..............-..R.....G...HK..........LCG.TYI...KDI..LC-QECSP.YAAHL....YDA..........................................eNPQT..PLR.NLP.gLC....FD....YCSEFHFNCRS.A.....ISLL...-...--.....--.-.-T..........................SDKHI.....QE..CC.E..T..NKT........RFCNLLH.LH..DE...D.YCf....pNVLKNT.ALNRNl..gSVVED................RKGCL-q...............................................................
A0A6A3B4X7_HIBSY/42-205              ............................................vcvsqggrfppfsse-----....-----G.KPPKRvgkghKDL.TL.........................C.RV.FRKN...............................TCCDAAQT.HP.AL...L.SV.........RR...LA.L-----..T..............G..E.....A...NQ..........ECL.HLW...ELL..ECSI-CDP.RVG--....IHP...........................................----..---.GPP.qIC....TS....FCDRVFQACSN.A.....YFSM...D...A-.....KT.Q.VL..........................APCGV.....ND..F-.-..-..-VC........GKASEWA.SN..GT...E.LC......LA----.-----....-----................------agfgvkqsvgihggdeeascy...........................................
U3K058_FICAL/31-207                  ...........................................................VCMDA....KHHKRE.PGPEG.....QLY.EQ.........................C.SP.WKDN...............................ACCTANTS.AE.AH...R.ER.........SL...LY.NFNWRH..C..............G..A.....M...PP..........KCK.RHF...IQD..TCLYECSP.NLGPW....IEQvg.......................................laWALP..GIQ.GCP..PC....QG....TISLQHLGCLN.F.....SHSV...E...SF....qGF.S.WP..........................LTDGR....tNR..CP.W..G..SMC........RPFRQVF.PR..PR...D.LC......EKIWSG.SFSYS....PERRG................SGRCI-................................................................
A0A1U8I9H5_GOSHI/43-205              .........................................cvsqggrfppfssegkpp-----....------.---KRvgkghKDL.TL.........................C.RV.FRKK...............................TCCDAAQT.HP.AL...L.SI.........RR...LA.L-----..T..............G..E.....A...SE..........ECL.HLW...ELL..ECSI-CDP.RVG--....VQP...........................................----..---.GPP.lIC....TS....FCDRVFQACSN.A.....YFSM...D...A-.....KT.Q.VL..........................APCGA.....ND..F-.-..-..-VC........GRASEWA.SN..GT...E.LC......LAA---.-----....-----................------gfrveqsvgmhggieeescy............................................
F5H3Z4_HUMAN/45-198                  ...........................................................VCMDA....KHHKTK.PGPED.....KLH.DQ.........................C.SP.WKKN...............................ACCTASTS.QE.LH...K.DT.........SR...LY.NFNWDH..C..............G..K.....M...EP..........ACK.RHF...IQD..TCLYECSP.NLGPW....IQQvn.......................................qsWRKE..RFL.DVP..LC....KE....DCQRWWEDCHT.S.....HTCK...S...NW.....HR.G.WD..........................WTSGV.....NK..CP.A..G..ALC........RTFESYF.PT..PA...A.LC......------.-----....-----................------................................................................
U6HA89_9EIME/13-154                  ...................................................lssgstvs-----....------.-----.....---.--.........................-.--.---A...............................ACCYPQHT.EL.IK...R.RL.........GS...LE.------..-..............-..-.....D...RG..........NCQ.KVS...EEV..LCVM-CEP.RFGTG...eL--...........................................----..ESK.GKP.iLC....PQ....LCEKWFNACKE.E.....FVSA...S...PS.....GS.G.SA..........................LTFCE.....ES..S-.-..-..LIC........SRLSATL.ED..SL...S.FC......RQMG--.-----....-----................------fhvpedddeglpegavqgrrscfn........................................
A0A1S3ABQ2_ERIEU/54-180              ....................