GenomeNet

Database: Pfam
Entry: IL4
LinkDB: IL4
Original site: IL4 
#=GF ID   IL4
#=GF AC   PF00727.21
#=GF DE   Interleukin 4
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Pfam-B_833 (release 2.1)
#=GF GA   23.00 23.00;
#=GF TC   23.20 23.20;
#=GF NC   21.60 22.90;
#=GF BM   hmmbuild --amino HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Interleukin_4
#=GF CL   CL0053
#=GF DR   INTERPRO; IPR002354;
#=GF DR   PROSITE; PDOC00655;
#=GF DR   SCOP; 2int; fa;
#=GF DC   This family is a subset of the SCOP family
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF SQ   195
#=GS A0A2K5J0S1_COLAP/26-77      AC A0A2K5J0S1.1
#=GS A0A2K5NTL6_CERAT/26-149     AC A0A2K5NTL6.1
#=GS A0A485N2D3_LYNPA/26-131     AC A0A485N2D3.1
#=GS A0A2R9A020_PANPA/26-93      AC A0A2R9A020.1
#=GS A0A2U3WHS5_ODORO/26-130     AC A0A2U3WHS5.1
#=GS A4ZXA4_CALJA/26-149         AC A4ZXA4.1
#=GS A0A1U7TBB6_CARSF/26-145     AC A0A1U7TBB6.1
#=GS Q5W4U0_CHICK/28-130         AC Q5W4U0.1
#=GS A0A2I0LT98_COLLI/26-132     AC A0A2I0LT98.1
#=GS A0A093ICZ5_DRYPU/28-129     AC A0A093ICZ5.1
#=GS A0A452F7W6_CAPHI/26-133     AC A0A452F7W6.1
#=GS A0A2R8P2P6_CALJA/26-107     AC A0A2R8P2P6.2
#=GS A0A384AN61_BALAS/26-131     AC A0A384AN61.1
#=GS A0A6P3QHY4_PTEVA/26-132     AC A0A6P3QHY4.1
#=GS A0A4W2D7D2_BOBOX/26-117     AC A0A4W2D7D2.1
#=GS A0A2Y9PNT9_DELLE/26-131     AC A0A2Y9PNT9.1
#=GS R0L8U2_ANAPL/31-133         AC R0L8U2.1
#=GS A0A2Y9EPJ1_PHYMC/26-131     AC A0A2Y9EPJ1.1
#=GS A0A1V4KU53_PATFA/28-130     AC A0A1V4KU53.1
#=GS A0A6I9ZLE3_ACIJB/26-131     AC A0A6I9ZLE3.1
#=GS A0A2K5ZQL7_MANLE/26-149     AC A0A2K5ZQL7.1
#=GS A0A087VBD1_BALRE/28-130     AC A0A087VBD1.1
#=GS W5PZU4_SHEEP/26-133         AC W5PZU4.1
#=GS A0A673UGG8_SURSU/26-134     AC A0A673UGG8.1
#=GS A0A2K6RC32_RHIRO/42-133     AC A0A2K6RC32.1
#=GS A0A2K5J183_COLAP/42-133     AC A0A2K5J183.1
#=GS A0A0Q3T8S7_AMAAE/28-130     AC A0A0Q3T8S7.1
#=GS A0A6I9IKM8_VICPA/26-131     AC A0A6I9IKM8.1
#=GS A0A091K5G2_COLST/28-130     AC A0A091K5G2.1
#=GS IL4_CAPHI/26-133            AC P79155.1
#=GS A0A671FLF1_RHIFE/26-128     AC A0A671FLF1.1
#=GS L5M4Y9_MYODS/23-130         AC L5M4Y9.1
#=GS A0A2R8ZXQ5_PANPA/26-149     AC A0A2R8ZXQ5.1
#=GS V9NJM6_CAVPO/25-62          AC V9NJM6.1
#=GS IL4_MOUSE/25-140            AC P07750.1
#=GS L8J2E0_9CETA/26-133         AC L8J2E0.1
#=GS A0A226MPQ0_CALSU/30-130     AC A0A226MPQ0.1
#=GS A0A2K6FUD8_PROCO/35-133     AC A0A2K6FUD8.1
#=GS Q9MZR7_RABIT/43-127         AC Q9MZR7.1
#=GS Q6U8C1_MACMU/26-149         AC Q6U8C1.1
#=GS A0A493TV98_ANAPP/90-192     AC A0A493TV98.1
#=GS A0A2K6C9D1_MACNE/26-77      AC A0A2K6C9D1.1
#=GS G5ASQ0_HETGA/24-138         AC G5ASQ0.1
#=GS A0A140T8F0_FELCA/26-132     AC A0A140T8F0.2
#=GS A0A5N4ECH0_CAMDR/26-148     AC A0A5N4ECH0.1
#=GS A0A2I3LUF9_PAPAN/26-78      AC A0A2I3LUF9.1
#=GS A0A3Q0DXX0_CARSF/44-129     AC A0A3Q0DXX0.1
#=GS A0A2K5ZQN0_MANLE/26-78      AC A0A2K5ZQN0.1
#=GS A0A2K6C9C6_MACNE/26-149     AC A0A2K6C9C6.1
#=GS A0A093BPN9_9AVES/28-122     AC A0A093BPN9.1
#=GS A0A2I0TT55_LIMLA/28-130     AC A0A2I0TT55.1
#=GS IL4_PAPAN/26-149            AC Q865Y0.1
#=GS A0A2K5Q5V8_CEBIM/26-149     AC A0A2K5Q5V8.1
#=GS IL4_TURTR/26-131            AC Q9XS58.1
#=GS A0A6P3JCS7_BISBI/26-133     AC A0A6P3JCS7.1
#=GS A0A2K5Q5X4_CEBIM/26-65      AC A0A2K5Q5X4.1
#=GS A0A091EWH9_CORBR/1-80       AC A0A091EWH9.1
#=GS A0A212D2E7_CEREH/26-133     AC A0A212D2E7.1
#=GS A0A663F5Y1_AQUCH/32-134     AC A0A663F5Y1.1
#=GS H2PGI4_PONAB/26-149         AC H2PGI4.1
#=GS IL4_MACMU/26-149            AC P51492.1
#=GS A0A671FS15_RHIFE/26-113     AC A0A671FS15.1
#=GS A0A1S2ZIR4_ERIEU/26-132     AC A0A1S2ZIR4.1
#=GS A0A2Y9E0J2_TRIMA/26-132     AC A0A2Y9E0J2.1
#=GS IL4_HORSE/25-131            AC P42202.2
#=GS U3KG92_FICAL/27-129         AC U3KG92.1
#=GS IL4_FELCA/26-131            AC P55030.1
#=GS A0A2K5ZQM5_MANLE/42-133     AC A0A2K5ZQM5.1
#=GS A0A2Y9I0P4_NEOSC/26-129     AC A0A2Y9I0P4.1
#=GS G1U6T7_RABIT/26-140         AC G1U6T7.2
#=GS A0A2P4SCE0_BAMTH/28-130     AC A0A2P4SCE0.1
#=GS A0A671FRG3_RHIFE/26-128     AC A0A671FRG3.1
#=GS A0A2K6FUD4_PROCO/26-149     AC A0A2K6FUD4.1
#=GS A0A093Q0I7_9PASS/1-80       AC A0A093Q0I7.1
#=GS A0A2I3LJV6_PAPAN/42-133     AC A0A2I3LJV6.1
#=GS C4PAF0_CHICK/27-132         AC C4PAF0.1
#=GS G0WM66_CAVPO/25-140         AC G0WM66.1
#=GS A0A669QEJ7_PHACC/27-136     AC A0A669QEJ7.1
#=GS A0A452QK50_URSAM/26-130     AC A0A452QK50.1
#=GS A0A337RWU7_FELCA/26-131     AC A0A337RWU7.2
#=GS A0A2K6MWH8_RHIBE/26-77      AC A0A2K6MWH8.1
#=GS A0A2K6MWI4_RHIBE/42-133     AC A0A2K6MWI4.1
#=GS IL4_SHEEP/26-133            AC P30368.2
#=GS A0A093CG74_TAUER/29-131     AC A0A093CG74.1
#=GS A0A093NQ14_PYGAD/1-80       AC A0A093NQ14.1
#=GS A0A2I3GPD2_NOMLE/26-72      AC A0A2I3GPD2.1
#=GS A0A2K5NT42_CERAT/42-133     AC A0A2K5NT42.1
#=GS IL4_BOVIN/26-133            AC P30367.2
#=GS U3LVN1_HUMAN/26-93          AC U3LVN1.1
#=GS A0A087RF51_APTFO/28-130     AC A0A087RF51.1
#=GS A0A673UGN8_SURSU/26-118     AC A0A673UGN8.1
#=GS A0A341BKZ4_NEOAA/26-131     AC A0A341BKZ4.1
#=GS A0A1U7QAD7_MESAU/25-140     AC A0A1U7QAD7.1
#=GS A0A091M6I4_CARIC/1-79       AC A0A091M6I4.1
#=GS V9NJM6_CAVPO/58-88          AC V9NJM6.1
#=GS A0A6A1QH00_BALPH/26-148     AC A0A6A1QH00.1
#=GS A0A3Q7WFH7_URSAR/26-130     AC A0A3Q7WFH7.1
#=GS IL4_PANTR/26-149            AC Q8HYB1.2
#=GS G3UXB0_MOUSE/1-45           AC G3UXB0.1
#=GS A0A672TWJ7_STRHB/27-130     AC A0A672TWJ7.1
#=GS A0A6J2N3G4_9CHIR/1-86       AC A0A6J2N3G4.2
#=GS A0A3Q7RYM4_VULVU/26-130     AC A0A3Q7RYM4.1
#=GS A3FBF0_MUSPF/26-130         AC A3FBF0.1
#=GS A0A671FKM8_RHIFE/26-140     AC A0A671FKM8.1
#=GS A0A218V3Z5_9PASE/26-133     AC A0A218V3Z5.1
#=GS A0A091IRC6_EGRGA/1-80       AC A0A091IRC6.1
#=GS A0A6J3G3V7_SAPAP/26-115     AC A0A6J3G3V7.1
#=GS A0A4U1EK20_MONMO/26-131     AC A0A4U1EK20.1
#=GS A0A0G2JVY1_RAT/39-120       AC A0A0G2JVY1.1
#=GS A0A2K5CG77_AOTNA/26-149     AC A0A2K5CG77.1
#=GS A0A2K6SAE6_SAIBB/26-65      AC A0A2K6SAE6.1
#=GS A0A2Y9IP66_ENHLU/26-130     AC A0A2Y9IP66.1
#=GS A0A673U4Y8_SURSU/26-132     AC A0A673U4Y8.1
#=GS U3IWH3_ANAPP/26-133         AC U3IWH3.2
#=GS A0A093JBQ7_FULGA/1-80       AC A0A093JBQ7.1
#=GS A0A2K5J181_COLAP/26-149     AC A0A2K5J181.1
#=GS A0A2U3XTG1_LEPWE/26-129     AC A0A2U3XTG1.1
#=GS A0A3Q7NDD4_CALUR/26-130     AC A0A3Q7NDD4.1
#=GS A0A3M0J7J8_HIRRU/30-136     AC A0A3M0J7J8.1
#=GS V9NK57_CAVPO/14-72          AC V9NK57.1
#=GS IL4_RABIT/26-143            AC Q9MZR8.1
#=GS A0A4W2ES45_BOBOX/26-133     AC A0A4W2ES45.1
#=GS A0A226P9G2_COLVI/28-151     AC A0A226P9G2.1
#=GS IL4_RAT/25-140              AC P20096.2
#=GS A0A093CI62_9AVES/1-80       AC A0A093CI62.1
#=GS A0A091G752_9AVES/28-129     AC A0A091G752.1
#=GS A0A663MPP3_ATHCN/28-130     AC A0A663MPP3.1
#=GS A0A091MAL1_CARIC/28-130     AC A0A091MAL1.1
#=GS H2QRG7_PANTR/42-133         AC H2QRG7.1
#=GS G1RQL3_NOMLE/26-122         AC G1RQL3.2
#=GS A0A2I2YFB5_GORGO/26-93      AC A0A2I2YFB5.1
#=GS A0A091NFC6_9PASS/1-79       AC A0A091NFC6.1
#=GS A0A1A6GIQ2_NEOLE/25-137     AC A0A1A6GIQ2.1
#=GS A0A2K6RBZ7_RHIRO/26-149     AC A0A2K6RBZ7.1
#=GS A0A2K6C9D0_MACNE/42-133     AC A0A2K6C9D0.1
#=GS A0A2K5Q5Y5_CEBIM/44-133     AC A0A2K5Q5Y5.1
#=GS IL4_CANLF/26-130            AC O77762.1
#=GS G1PUX7_MYOLU/25-134         AC G1PUX7.1
#=GS IL4_AILME/26-130            AC Q3S4V6.1
#=GS A0A5J5N8M6_MUNRE/26-133     AC A0A5J5N8M6.1
#=GS A0A6J2IUB6_9PASS/30-137     AC A0A6J2IUB6.1
#=GS IL4_CERAT/26-149            AC P46652.1
#=GS D2GVH8_AILME/26-61          AC D2GVH8.1
#=GS G3QSC0_GORGO/26-149         AC G3QSC0.1
#=GS A0A091S3Q0_NESNO/28-130     AC A0A091S3Q0.1
#=GS A0A226MIA9_CALSU/29-151     AC A0A226MIA9.1
#=GS A0A1U7RHQ0_ALLSI/30-137     AC A0A1U7RHQ0.1
#=GS A0A3P4NML3_GULGU/26-130     AC A0A3P4NML3.1
#=GS A0A6I9KI10_CHRAS/26-132     AC A0A6I9KI10.1
#=GS A0A091W076_OPIHO/29-130     AC A0A091W076.1
#=GS IL4_MESAU/25-140            AC Q60440.1
#=GS A0A151M734_ALLMI/1317-1443  AC A0A151M734.1
#=GS G1N9Y5_MELGA/29-131         AC G1N9Y5.1
#=GS A0A6I9MFL2_PERMB/25-140     AC A0A6I9MFL2.1
#=GS A0A2I3HR84_NOMLE/44-115     AC A0A2I3HR84.1
#=GS A0A673UGF9_SURSU/26-131     AC A0A673UGF9.1
#=GS F6U5N6_HORSE/26-135         AC F6U5N6.2
#=GS A0A091V0G0_NIPNI/28-130     AC A0A091V0G0.1
#=GS H0XDE1_OTOGA/26-149         AC H0XDE1.1
#=GS A0A226PAQ9_COLVI/30-130     AC A0A226PAQ9.1
#=GS A0A099YVI1_TINGU/28-100     AC A0A099YVI1.1
#=GS A0A1S3GBZ7_DIPOR/27-147     AC A0A1S3GBZ7.1
#=GS IL4_PIG/26-131              AC Q04745.1
#=GS A0A553PUD9_9TELE/24-126     AC A0A553PUD9.1
#=GS A0A099ZYT9_CHAVO/28-130     AC A0A099ZYT9.1
#=GS A0A6P6HXZ0_PUMCO/26-131     AC A0A6P6HXZ0.1
#=GS S9YLP2_CAMFR/59-124         AC S9YLP2.1
#=GS A0A6J0X689_ODOVR/26-133     AC A0A6J0X689.1
#=GS A0A2I2ZNV2_GORGO/42-133     AC A0A2I2ZNV2.1
#=GS IL4_HUMAN/26-149            AC P05112.1
#=GS IL4_HUMAN/26-149            DR PDB; 4YDY J; 3-125;
#=GS IL4_HUMAN/26-149            DR PDB; 5FHX A; 6-125;
#=GS IL4_HUMAN/26-149            DR PDB; 1HIK A; 2-125;
#=GS IL4_HUMAN/26-149            DR PDB; 1HZI A; 2-125;
#=GS IL4_HUMAN/26-149            DR PDB; 1ITI A; 6-129;
#=GS IL4_HUMAN/26-149            DR PDB; 2INT A; 2-125;
#=GS IL4_HUMAN/26-149            DR PDB; 1RCB A; 2-125;
#=GS IL4_HUMAN/26-149            DR PDB; 1CYL A; 2-125;
#=GS IL4_HUMAN/26-149            DR PDB; 3QB7 A; 3-125;
#=GS IL4_HUMAN/26-149            DR PDB; 1BBN A; 6-129;
#=GS IL4_HUMAN/26-149            DR PDB; 2B8Z A; 2-125;
#=GS IL4_HUMAN/26-149            DR PDB; 1ITM A; 2-125;
#=GS IL4_HUMAN/26-149            DR PDB; 6OEL A; 3-125;
#=GS IL4_HUMAN/26-149            DR PDB; 4YDY I; 2-125;
#=GS IL4_HUMAN/26-149            DR PDB; 2B8X A; 2-125;
#=GS IL4_HUMAN/26-149            DR PDB; 1BCN A; 6-129;
#=GS IL4_HUMAN/26-149            DR PDB; 1IAR A; 2-125;
#=GS IL4_HUMAN/26-149            DR PDB; 2B8U A; 2-125;
#=GS IL4_HUMAN/26-149            DR PDB; 1HIJ A; 2-125;
#=GS IL4_HUMAN/26-149            DR PDB; 2B90 A; 2-125;
#=GS IL4_HUMAN/26-149            DR PDB; 2CYK A; 2-125;
#=GS IL4_HUMAN/26-149            DR PDB; 1ITL A; 2-125;
#=GS IL4_HUMAN/26-149            DR PDB; 2B91 A; 2-125;
#=GS IL4_HUMAN/26-149            DR PDB; 3BPL A; 3-125;
#=GS IL4_HUMAN/26-149            DR PDB; 3BPN A; 3-125;
#=GS IL4_HUMAN/26-149            DR PDB; 2D48 A; 2-125;
#=GS IL4_HUMAN/26-149            DR PDB; 3QB7 B; 3-125;
#=GS IL4_HUMAN/26-149            DR PDB; 2B8Y A; 2-125;
#=GS A0A0D9RMS8_CHLSB/26-149     AC A0A0D9RMS8.1
#=GS A0A2K5NTM1_CERAT/26-78      AC A0A2K5NTM1.1
#=GS A0A2K6RC06_RHIRO/26-77      AC A0A2K6RC06.1
#=GS A0A2K5CFR9_AOTNA/26-65      AC A0A2K5CFR9.1
#=GS A0A6J3DTA3_AYTFU/26-133     AC A0A6J3DTA3.1
#=GS A0A2K6SAD8_SAIBB/26-149     AC A0A2K6SAD8.1
#=GS G3T4B8_LOXAF/26-133         AC G3T4B8.1
#=GS A0A340XPY0_LIPVE/26-131     AC A0A340XPY0.1
#=GS L5JX76_PTEAL/1-84           AC L5JX76.1
#=GS A9CB13_PAPAN/26-149         AC A9CB13.1
#=GS A0A663F7M3_AQUCH/26-136     AC A0A663F7M3.1
#=GS IL4_MACFA/26-149            AC P79339.2
#=GS A0A2R8ZVJ1_PANPA/42-133     AC A0A2R8ZVJ1.1
#=GS A0A2K6MWH2_RHIBE/26-149     AC A0A2K6MWH2.1
#=GS A0A384C641_URSMA/26-130     AC A0A384C641.1
#=GS G1N9Y7_MELGA/27-131         AC G1N9Y7.1
#=GS A0A2I3SZ99_PANTR/26-93      AC A0A2I3SZ99.1
#=GS A0A2K5CFR4_AOTNA/44-133     AC A0A2K5CFR4.1
#=GS A0A140TAX8_PANTR/26-149     AC A0A140TAX8.1
#=GS A0A093IQU7_EURHL/29-130     AC A0A093IQU7.1
#=GS A0A3L8SJA7_CHLGU/1-73       AC A0A3L8SJA7.1
#=GS A0A6P5KQG6_PHACI/28-151     AC A0A6P5KQG6.1
#=GS A0A2K6SAD1_SAIBB/44-133     AC A0A2K6SAD1.1
#=GS A0A091LWK4_CATAU/1-80       AC A0A091LWK4.1
#=GS A0A6P5C0Z5_BOSIN/26-133     AC A0A6P5C0Z5.1
A0A2K5J0S1_COLAP/26-77                 ................NCHNALREIIETLN.SL.T..E.Q.K.................TL...CTELTV.TDIL..AASK............Q------------..------------..-------.........----------.-----..--......----......-------..--------------------haclptsrhsgsicr......................................
A0A2K5NTL6_CERAT/26-149                ................NCHIALREIIETLN.SL.T..E.Q.K.................TL...CTKLTI.TDIL..AASK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGASAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAS..QSTLEDFLERLKTIMKEKYS.....................................................
A0A485N2D3_LYNPA/26-131                ...............n-FNNTLKEIIKTLN.IL.T..A.R.N.................DS...CMELTV.MDVL..AVPK............NTSDKEIFCRATT..VLRQIYTHHN--..-CST---.........---KFLKGLD.RNLSS..MA......NR-T......CSVNEVK..KSTLKDFLERLKAIMQKKYS.....................................................
A0A2R9A020_PANPA/26-93                 ................KCDITLQEIIKTLN.SL.T..E.Q.K.................TL...CTELTV.TDIF..AASK............QH-----------..------------..-------.........----------.-----..--......----......-------..--------------------aclptsrhtgticrppsarvpststrlqsp.......................
A0A2U3WHS5_ODORO/26-130                ...............n-FSIAIKEIIRTLN.IL.T..A.R.N.................DL...CMELTV.TDIF..AAAK............NTTEKEIFCRATT..VLQQLSTQN---..-CYN---.........---KLLGGLH.RNLRK..MA......NM-T......CSVNEVK..KSTLKDFLERLKAIMQRKYY.....................................................
A4ZXA4_CALJA/26-149                    ................NCDIALEEIIKTLN.IV.T..E.Q.K.................TL...CTKLTI.MDIF..AASK............NTTEKETFCRAAT..VLRQFYSHHEKD.tHCLGATAqql..hshkQLIRSLKRLD.RNLCS..LA......GLNS......CPVKEAD..QTMLKDFLERLKMIMKEIYS.....................................................
A0A1U7TBB6_CARSF/26-145                ................KCDITLNEIIKTLN.IL.T..E.R.K.................TP...CTELPV.ADVF..AVSK............STTEKETFCRAAT..VLRQFYSHPEKR.sLCRGAHGh......hkPLTKFLKGLD.RNLYS..MA......NLSY......CPVNEAR..KSTLEDFLKRLKMIMKEKYS.....................................................
Q5W4U0_CHICK/28-130                    .....sklklsditqg------------IQ.KL.N.rG.V.Q.................VP...CNDTRV.AQVA..FKDR............KLSEQELLCQAAT..VLDNMTD-----..-CKK---.........----DYEPLI.TSLKS..LH......GMTN......CPPSTDN..EIYLRNFLPALGN-------ytqalyr..............................................
A0A2I0LT98_COLLI/26-132                .............qts---TLLKESITLLS.EL.L..A.A.Q.................VS...CDKMNA.TNIF..AGDK............N-DDMEILCKASA..VALEGQSCHN--..----HLE........gIYMNLLSLLQ.I--KG..TA......LKAP......CPVATGN..TMSLHDFLLNLRRVLQ----rll..................................................
A0A093ICZ5_DRYPU/28-129                ..............pk---QKLFEIIRHIHlYL.S..G.A.Q.................MP...CSDTRV.AQVV..FTDH............KLSEQVLLCQAVK..ALSRVSRCKK--..-------.........----DYEPII.SNLQS..LQ......GKET......CSLSHDN..EIYLRHFLPAL---------gnftqglf.............................................
A0A452F7W6_CAPHI/26-133                ................KCDITLEEIIKMLN.IL.T..S.R.K.................NS...CMELPV.ADVF..AAPK............NATEKETFCRAGI..ELRRIYRNHM--..-CLN---.........---KFLGGLD.RNLSS..LA......SK-T......CSVNEAKtsTSTLRDLLERLKTIMKEKYS.....................................................
A0A2R8P2P6_CALJA/26-107                ................NCDIALEEIIKTLN.IV.T..E.Q.K.................TL...CTKLTI.MDIF..AASK............H------------..------------..-------.........----------.-----..--......----......-------..--------------------gclpcsrhtgsvcpahvlstlpqspertqlrrkpsaglrlcsgss........
A0A384AN61_BALAS/26-131                ................KCDITLQEIIKTLN.IL.T..A.R.K.................NS...CMELPV.ADVF..AAPK............NTTEKETFCRAAT..VLRHIYGYHK--..-CLN---.........---KPLNGLH.RNLSS..MA......NM-T......CSVNEAK..KSTLKDFLERLKTIMKEKYS.....................................................
A0A6P3QHY4_PTEVA/26-132                ...............r-YSITLEEIIKTLN.IL.T..T.R.K.................DW...CMELMV.ADVF..AAPK............NTAEEEIFCRAVT..VLRKVYKHHE--..-CVN---.........--RKFLGKLD.RNLRS..MA......RD-Y......CPVEEAK..KDTLKNVLETLRKTMQEKYS.....................................................
A0A4W2D7D2_BOBOX/26-117                ................KCDITLAEIIKTLN.IL.T..T.R.-.................--...------.----..---K............NTTEKETFCRVGI..ELRRIYRSHT--..-CLN---.........---KFLGGLD.RNLNS..LA......SK-T......CSVNEAKtsTSTLKDLLERLKTIMKEKYS.....................................................
A0A2Y9PNT9_DELLE/26-131                ................KCDITLQEIIKTLN.IL.T..A.R.K.................NL...CMELPV.EDVF..ATTK............NTTEKETFCRAGT..VLRHIYRYHK--..-CFN---.........---KPLSGLH.RNLSS..MA......NM-T......CSVNEAK..KSTLKDFLETLKTIMKEKYS.....................................................
R0L8U2_ANAPL/31-133                    .............srl----KLSEITHRIQ.QLnT..G.V.Q.................VP...CNDTRV.AQVA..FTDR............KLSEHDLLCQAAT..ALAKVTRCK---..---N---.........----DYEPLI.INLKS..LH......GKAG......CSLSTDN..EIYLRNFLPELGNFTQ----alyr.................................................
A0A2Y9EPJ1_PHYMC/26-131                ..............kg--DITLQEIIKTLN.IL.T..A.R.K.................NS...CMELPV.ADVF..ATPK............NTTEKETFCRAAT..VLWHIYRYHK--..-CLN---.........---NPLRGLH.RNLSS..MA......NM-T......CSVNEAK..KSTLKDFLERLKTIMKEKYS.....................................................
A0A1V4KU53_PATFA/28-130                .............phl----KLSEITQRIQ.QL.N.sG.V.Q.................VP...CNDTRV.AQVA..FTDR............KLSEQELLCQAAT..ALTKVTKCK---..---K---.........----DYEPFI.INLQS..LH......GSRS......CSLSNEN..EIYLRNFLPELGNFT-----qglyr................................................
A0A6I9ZLE3_ACIJB/26-131                ...............n-FNNTLKEIIKTLN.IL.T..A.R.N.................DS...CMELTV.MDVL..AAPK............NTSDKEIFCRATT..VLRQIYTHHN--..-CST---.........---KFLKGLD.RNLSS..MA......NR-T......CSVNEVK..KSTLKDFLERLKAIMQKKYS.....................................................
A0A2K5ZQL7_MANLE/26-149                ................NCHIALREIIETLN.SL.T..E.Q.K.................TL...CTKLTI.TDIL..AASK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAS..QSTLEDFLERLKTIMKEKYS.....................................................
A0A087VBD1_BALRE/28-130                .............pkl----KLSEITHRIQ.QL.N.sG.V.Q.................VP...CNDTRV.AQVV..FTDR............KLSEQELLCQAAT..ALTKVTRCK---..---KD--.........-----YEPFI.VNLQS..LH......GKTN......CSLSNEN..EIYLRNFLPELGNFTQGM--yr...................................................
W5PZU4_SHEEP/26-133                    ................KCDITLEEIIKTLN.IL.T..S.R.K.................NS...CMELPV.ADVF..AAPK............NATEKETFCRAGI..ELRRIYRSHM--..-CLN---.........---KFLGGLD.RNLSS..LA......SK-T......CSVNEAKtsTSTLRDLLERLKTIMKEKYS.....................................................
A0A673UGG8_SURSU/26-134                ..............ns--NNGLREIIKTLN.IL.T..A.K.N.................DS...CMEQTV.MDVL..AAPK............NTSDKEIFCRASA..VLRQIHTHHN--..-CLA---.........---RFLSGLY.RNLSTneVF......LLQT......CSVNEVK..KTTLKDFLERLKAIMQKIYS.....................................................
A0A2K6RC32_RHIRO/42-133                ..............te--------------.--.-..-.-.-.................--...------.----..--QK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAS..QSTLEDFLERLKTIMKEKYS.....................................................
A0A2K5J183_COLAP/42-133                ..............te--------------.--.-..-.-.-.................--...------.----..--QK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAS..QSTLEDFLERLKTIMKEKYS.....................................................
A0A0Q3T8S7_AMAAE/28-130                .............pkl----KLSEITHRIQ.QL.N.sG.V.Q.................VP...CNDTRV.AQVA..FTDR............KLSEQELLCQAAX..ALTSITR-----..-CRK---.........----DYEPLI.INLQS..LH......GDTS......CSLSDEN..EIYLRNFLPELGNFTQGM--yr...................................................
A0A6I9IKM8_VICPA/26-131                ................KCDITLQEIIKTLN.TL.T..A.R.K.................NS...CMELTV.ADVF..AAPK............NTTEKETFCKAAT..ALRHIYRHHN--..-CLS---.........---KHLSGLD.RNLSG..LA......NT-T......CSVNDSK..KSTLRDFLERLKKIMKEKYS.....................................................
A0A091K5G2_COLST/28-130                .............akl----KLSEITHRIQ.QL.N.sG.V.Q.................VP...CNDTRV.AQVA..FTDR............KLSEQELLCQAAM..ALTKITRCK---..---K---.........----DYEPLI.INLQK..LH......SKRN......CSLSNEN..EIYLRNFLPELGNFTQGM--yr...................................................
IL4_CAPHI/26-133                       ................KCDITLEEIIKMLN.IL.T..S.Q.K.................NS...CMELPV.ADVF..AAPK............NATEKETFCRAGI..ELRRIYRNHM--..-CLN---.........---KFLGGLD.RNLSS..LA......SK-T......CSVNEAKtsTSTLRDLLERLKTIMKEKYS.....................................................
A0A671FLF1_RHIFE/26-128                ..............el---ILLQEIIKTLN.NL.T..E.T.K.................DR...YMELTV.AEVL..PVPK............NTTEKEAFCRAAM..ELRKIYPPHPKD..-VTG---.........---KHLSKLD.RNLSR..LA......NMVS......KLVSNK-..--------------------hammsssdkcfeeeyr.....................................
L5M4Y9_MYODS/23-130                    .............hgr---NTLQETIKMLN.VL.T..A.K.K.................DP..rCMELTV.SDVL..AAPK............NTTENETLCRAAT..VLRQVYRHHK--..-CLT---.........---KILSGLD.RNLSS..MA......NKTS......CPVNEAK..KRTLKDFLERLKTIMQEKYS.....................................................
A0A2R8ZXQ5_PANPA/26-149                ................KCDITLQEIIKTLN.SL.T..E.Q.K.................TL...CTELTV.TDIF..AASK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAN..QSTLEDFLERLKTIMREKYS.....................................................
V9NJM6_CAVPO/25-62                     .............cnh---HTLQEIIQHLN.TL.S..R.E.K.................SP...CAELLV.TDVF..ADPQ............N------------..------------..-------.........----------.-----..--......----......-------..--------------------c....................................................
IL4_MOUSE/25-140                       ..............cd--KNHLREIIGILN.EV.T..G.E.G.................TP...CTEMDV.PNVL..TATK............NTTESELVCRASK..VLRIFYLKHGKT..PCLKKNS.........SVLMELQRLF.RAFRC..LD......SSIS......CTMNESK..STSLKDFLESLKSIMQMDYS.....................................................
L8J2E0_9CETA/26-133                    ................KCDITLAEIIKTLN.IL.T..T.R.K.................NS...CMELPV.ADVF..AAPK............NTTEKETFCRVGI..ELRRIYRSHT--..-CLN---.........---KFLGGLD.RNLNS..LA......SK-T......CSVNEAKtsTSTLKDLLERLKTIMKEKYS.....................................................
A0A226MPQ0_CALSU/30-130                lklsdithsiqqfnrg--------------.--.-..-.A.Q.................VP...CNDTRV.AQVV..FTDR............KLSEYELLCQAAR..VLAKVTH-----..-CKK---.........----DYEPLI.TNLQS..LH......RKES......CSLSTDN..EIYLRNFLPALGNFTQ----alyr.................................................
A0A2K6FUD8_PROCO/35-133                .............ikt--------------.--.-..-.-.-.................--...------.LNVL..TESK............NTSEKETFCRAAT..ALRRFYSQRQDG..VCGGAAAlprl.hshpHVIKLLKGLD.RNLCS..MA......HASH......CPVSEAK..QSTLRDFLERLKTILKEKYS.....................................................
Q9MZR7_RABIT/43-127                    ..............er--------------.--.-..-.-.-.................--...------.----..---K............NTTEREAVCRAAT..ALRQFYLHHKVS..WCFKEHGe.......lGDLRLLRGLD.RNLCS..MA......KLSN......CPGKEAR..QTTLEDFLDRLKTAMQEKYS.....................................................
Q6U8C1_MACMU/26-149                    ................NCHIALREIIETLN.SL.T..E.Q.K.................TL...CTKLTI.TDIL..AASK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAS..QSTLEDFLERLKTIMKEKYS.....................................................
A0A493TV98_ANAPP/90-192                .............srl----KLSEITHRIQ.QLnT..G.V.Q.................VP...CNDTRV.AQVA..FTDR............KLSEHDLLCQAAT..ALAKVTRCK---..---N---.........----DYEPLI.INLKS..LH......GKAG......CSLSTDN..EIYLRNFLPELGNFTQ----alyr.................................................
A0A2K6C9D1_MACNE/26-77                 ................NCHIALREIIETLN.SL.T..E.Q.K.................TL...CTKLTI.TDIL..AASK............R------------..------------..-------.........----------.-----..--......----......-------..--------------------haclptsrhsgsmcr......................................
G5ASQ0_HETGA/24-138                    ...............g-CNDALQEIINDLN.VL.S..S.Q.K.................TP...CAELAA.ADVF..AAPK............DTAEK--LCQAVT..VLHRTSYLGVGL..SCLNRHRe.......sVFLVLLKKVY.RNLRS..MV......QP-N......CSVSELK..QTTLKDFLENLKTILKKKYS.....................................................
A0A140T8F0_FELCA/26-132                ...............n-FNNTLKEIIKTLN.IL.T..A.R.N.................VS...KISGTIsPDVL..VMPW............NTSDKEIFCRATT..VLRQIYTHHN--..-CST---.........---KFLKGLD.RNLSS..MA......NR-T......CSVNEVK..KCTLKDFLERLKAIMQKKYS.....................................................
A0A5N4ECH0_CAMDR/26-148                ................KCDITLQEIIKTLN.TL.T..A.R.KvsklsgtispdvlvmlcNS...CMELTV.ADVF..AAPK............NTTEKETFCKAAT..ALRHIYRHHN--..-CLS---.........---KHLSGLD.RNLSG..LA......NT-T......CSVNDSK..KSTLRDFLERLKKIMKEKYS.....................................................
A0A2I3LUF9_PAPAN/26-78                 ................NCHIALREIIETLN.SL.T..E.Q.K.................TL...CTKLTI.TDIL..AASK............Q------------..------------..-------.........----------.-----..--......----......-------..--------------------haylptsrhsgsicrp.....................................
A0A3Q0DXX0_CARSF/44-129                ...............r--------------.--.-..-.-.-.................--...------.----..---K............STTEKETFCRAAT..VLRQFYSHPEKR.sLCRGAHGh......hkPLTKFLKGLD.RNLYS..MA......NLSY......CPVNEAR..KSTLEDFLKRLKMIMKEKYS.....................................................
A0A2K5ZQN0_MANLE/26-78                 ................NCHIALREIIETLN.SL.T..E.Q.K.................TL...CTKLTI.TDIL..AASK............Q------------..------------..-------.........----------.-----..--......----......-------..--------------------haclptsrhsgsicrp.....................................
A0A2K6C9C6_MACNE/26-149                ................NCHIALREIIETLN.SL.T..E.Q.K.................TL...CTKLTI.TDIL..AASK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAS..QSTLEDFLERLKTIMKEKYS.....................................................
A0A093BPN9_9AVES/28-122                .............prh----KLSEITHRIQ.QL.N.sG.A.Q.................VP...CNDTRV.AQVP..FTDH............KLSEQELLCQAAT..ALARVTRCRKDYepFCSLSNE.........----------.-----..--......----......-------..--------------------neiylrnflpelgnftqglyrrlaa............................
A0A2I0TT55_LIMLA/28-130                .............pkl----KLSEITHRIQ.QL.H.sG.V.Q.................VP...CNDTRV.AQVS..FTDR............KLSEQELLCQAAT..ALTKVTRCK---..---K---.........----DYEPFI.INLQS..LH......GKRN......CSLSNEN..EIYLRNFLPELGNFTQGM--yr...................................................
IL4_PAPAN/26-149                       ................NCHIALREIIETLN.SL.T..E.Q.K.................TL...CTKLTI.TDIL..AASK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAS..QSTLEDFLERLKTIMKEKYS.....................................................
A0A2K5Q5V8_CEBIM/26-149                ................NCDVALEEIIKTLN.IV.T..E.Q.K.................TL...CTELTV.MDIF..AASK............NTTEKETFCRAAT..VLRQFYSHHEKG.tRCLGATTqhf..hshkQLIRSLKRLD.RNLCS..LV......GLNS......CPVKEAN..QTMLKDFLERLKMIMKEKYS.....................................................
IL4_TURTR/26-131                       ................KCDVTLQEIIKTLN.IL.T..A.K.K.................NL...CMELPV.EDVF..ATTK............NTTEKETFCRAGT..VLRHIYRHHK--..-CFN---.........---QPLSGLH.RNLSS..MA......NM-T......CSVNEAK..KSTLKDFLERLKMIMKEKYS.....................................................
A0A6P3JCS7_BISBI/26-133                ................KCDITLAEIIKTLN.IL.T..T.R.K.................NS...CMELPV.ADVF..AAPK............NTTEKETFCRVGI..ELRRIYRSHT--..-CLN---.........---KFLGGLD.RNLNS..LA......SK-T......CSVNEAKtsTSTLKDLLERLKTIMKEKYS.....................................................
A0A2K5Q5X4_CEBIM/26-65                 ................NCDVALEEIIKTLN.IV.T..E.Q.K.................TL...CTELTV.MDIF..AASK............Q------------..------------..-------.........----------.-----..--......----......-------..--------------------hgc..................................................
A0A091EWH9_CORBR/1-80                  ...............v--------------.--.-..-.-.-.................-S...CNKMNV.TNIF..ADDK............RGNNMEILCKAAT..IARESQSCHR--..----YLE.........GIYHNLLSLG.WGTRA..GH......KT-P......CSVAAGS..TTSLKNFLKQL---------.....................................................
A0A212D2E7_CEREH/26-133                ................KCDITLEEIIKTLN.IL.T..A.R.K.................NS...CMELPV.ADVF..AAPK............NTTEKETLCRAGI..ELRRIYRSHT--..-CLN---.........---RFLSRLD.RNLSG..LA......SK-T......CSVNEAKtsTSTLKNLLERLKTIMKEKYS.....................................................
A0A663F5Y1_AQUCH/32-134                .............lpq----KLKEITKLVH.NL.Q..S.RvQ.................VP...CNDSRV.AQVT..FTDQ............KLSDQELLCQAAM..ALMKVTRCKT--..-------.........----DYEPVI.ANLQS..QH......GKTN......CSLSNDN..EIYLRHFLPELGNFTQ----gmyr.................................................
H2PGI4_PONAB/26-149                    ................KCDIALQEIIKTLN.SL.T..E.Q.K.................TL...CTELTV.TDIF..AASK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAN..QSTLEDFLERLKTIMREKYS.....................................................
IL4_MACMU/26-149                       ................NCHIALREIIETLN.SL.T..E.Q.K.................TL...CTKLTI.TDIL..AASK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAN..QSTLEDFLERLKTIMREKYS.....................................................
A0A671FS15_RHIFE/26-113                ..............el---ILLQEIIKTLN.NL.T..E.T.K.................DR...YMELTV.AEVL..PVPK............NTTEKEAFCRAAM..ELRKIYPPHPKD..-VTG---.........---KHLSKLD.RNLSR..LA......NMV-......-------..--------------------sklvcrql.............................................
A0A1S2ZIR4_ERIEU/26-132                ..............tr--NAILKEIIKTLN.IL.T..E.K.K.................DP...CMEMTV.ADIF..ANSE............NTTEKETFCRAAS..VLRQVYKQQP--..KCRP---.........---VDLRKLD.RNLTS..MT......NM-N......CPVNEAR..RRTLKDFLERLKTIMKAKYS.....................................................
A0A2Y9E0J2_TRIMA/26-132                ................KCGITLREIIKTLN.FL.T..E.K.K.................HG...CTELTV.ADAF..AASK............NTTEKETICRATT..VLWQVYTRHK--..-CFS---.........---KYLRGLR.RSLSS..MT......NLTY......CPVSEDR..TSTLKDFLERLKTIMKEKYS.....................................................
IL4_HORSE/25-131                       ................KYDITLQEIIKTLN.LT.D.gK.G.K.................NS...CMELTV.ADAF..-GPK............NTDGKE-ICRAAK..VLQQ-YKRHDR-..SLIK---.........---ECLSGLD.RNLKG..MA......NGTC......CTVNEAK..KSTLKDFLERLKTIMKEKYS.....................................................
U3KG92_FICAL/27-129                    ..............pq---QILKEIILLIQ.QL.H..SgG.Q.................VP...CNDTRV.AQVA..FTDR............QLPEQELLCQAEM..ALAKVTKCK---..---K---.........----SYEPLI.TNLKS..LH......GKKD......CLLSDDN..EIYLRHFLPALGN-------ftqglyr..............................................
IL4_FELCA/26-131                       ...............n-FNNTLKEIIKTLN.IL.T..A.R.N.................DS...CMELTV.MDVL..AAPK............NTSDKEIFCRATT..VLRQIYTHHN--..-CST---.........---KFLKGLD.RNLSS..MA......NR-T......CSVNEVK..KCTLKDFLERLKAIMQKKYS.....................................................
A0A2K5ZQM5_MANLE/42-133                ..............te--------------.--.-..-.-.-.................--...------.----..--QK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAS..QSTLEDFLERLKTIMKEKYS.....................................................
A0A2Y9I0P4_NEOSC/26-129                ...............n-FSIAIKEIIRTLN.IL.T..A.R.N.................DS...CMELTV.TDVF..AAPK............NTTEKE-ICRATT..VLQQLSTHN---..-CSN---.........---RLLRGLH.RNLRK..MA......NM-T......CSVNEVK..KSTLKDFLERLKAIMQRKYY.....................................................
G1U6T7_RABIT/26-140                    ..............rg--DIILPEVIKTLN.IL.T..E.R.K.................TP...CTKLMI.ADAL..A---............NTTEREAVCRAAT..ALRQFYLHHKVS..WCFKEHGe.......lGDLRLLRGLD.RNLCS..MA......KLSN......CPGKEAR..QTTLEDFLDRLKTAMQEKYS.....................................................
A0A2P4SCE0_BAMTH/28-130                .........sklklsd--------ITQGIQ.KL.N.rG.A.Q.................VP...CNDTRV.AQVA..FKDR............KLSEQELLCQAAT..VLDNMTD-----..-CKK---.........----DYEPLI.TSLKS..LH......GMMN......CPPSSDN..EIYLRNFLPALG--------nytqalyr.............................................
A0A671FRG3_RHIFE/26-128                ..............el---ILLQEIIKTLN.NL.T..E.T.K.................VS...KLSGTI.----..-SPD............NTTEKEAFCRAAM..ELRKIYPPHPKD..-VTG---.........---KHLSKLD.RNLSR..LA......NMNS......CPVNETK..KITLKELLERLKQTMKKKY-a....................................................
A0A2K6FUD4_PROCO/26-149                ...............r-CGVILTESIKTLN.VL.T..E.S.K.................TP...CADLTV.ADVF..AAPK............NTSEKETFCRAAT..ALRRFYSQRQDG..VCGGAAAlprl.hshpHVIKLLKGLD.RNLCS..MA......HASH......CPVSEAK..QSTLRDFLERLKTILKEKYS.....................................................
A0A093Q0I7_9PASS/1-80                  ...............v--------------.--.-..-.-.-.................-S...CNEMNV.TNIF..ADYK............AGDTMEILCKAAT..VARQGRSCHR--..----SLE.........GIYDNLLGLL.RG-NR..ME......HKAP......CPVAAGS..TTSLKDFIKEL---------.....................................................
A0A2I3LJV6_PAPAN/42-133                ..............te--------------.--.-..-.-.-.................--...------.----..--QK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAS..QSTLEDFLERLKTIMKEKYS.....................................................
C4PAF0_CHICK/27-132                    ............qlsv----PLMESIRIVN.DI.Q..G.-.E.................VS...CVKMNV.TDIF..ADNK............TNNKTELLCKAST..IVWESQHCHK--..----NLQ........gLFLNMRQLLN.ASSTS..LK......AP--......CPTAAGN..TTSMEKFLADLRTFFH----ql...................................................
G0WM66_CAVPO/25-140                    .............cnh---HTLQEIIQHLN.TL.S..R.E.K.................SP...CAELLV.TDVF..ADPQ............GPASGD-LCTAAT..VLHHTAYLRGPQ..SCPNREGd.......pLYPSVLRQVF.RNLRS..MA......QS-N......CPVSELR..QTTLKDFLENLKRIMQKRYS.....................................................
A0A669QEJ7_PHACC/27-136                ............qtsv----LLKESIRIVK.DM.-..Q.K.E.................VS...CGKMKV.TDIF..EDSK............TKNRTELLCEAST..IIWESQHCHK--..----NLQ.........GLFLNMRQLVnASSTS..LR......A--P......CPMAAGN..TTSMEKFLRDLHGFLQQ---vvkek................................................
A0A452QK50_URSAM/26-130                ...............n-FNITIKEIIKTLN.IL.T..A.R.N.................DT...CMELTV.TNIF..TAPK............NTTDTETFCRATT..VLRQLSTHS---..-CSN---.........---KLLGGLH.RNLKT..MA......NM-T......CSVNEVK..KSTLRDFLERLKAIVQRKYY.....................................................
A0A337RWU7_FELCA/26-131                ...............n-FNNTLKEIIKTLN.IL.T..A.R.N.................DS...CMELTV.MDVL..AAPK............NTSDKEIFCRATT..VLRQIYTHHN--..-CST---.........---KFLKGLD.RNLSS..MA......NR-T......CSVNEVK..KCTLKDFLERLKAIMQKKYS.....................................................
A0A2K6MWH8_RHIBE/26-77                 ................NCHNALREIIETLN.SL.T..E.Q.K.................TL...CTELTV.TDIL..AASK............Q------------..------------..-------.........----------.-----..--......----......-------..--------------------haclptsrhsgsicr......................................
A0A2K6MWI4_RHIBE/42-133                ..............te--------------.--.-..-.-.-.................--...------.----..--QK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAS..QSTLEDFLERLKTIMKEKYS.....................................................
IL4_SHEEP/26-133                       ................KCDITLEEIIKTLN.IL.T..S.R.K.................NS...CMELPV.ADVF..AAPK............NATEKETFCRAGI..ELRRIYRSHM--..-CLN---.........---KFLGGLD.RNLSS..LA......SK-T......CSVNEAKtsTSTLRDLLERLKTIMREKYS.....................................................
A0A093CG74_TAUER/29-131                .............pkl----KLSEITHRIH.QL.N.sG.V.Q.................VP...CNDTRV.AQVA..FMDR............KLPEQELLCQAAA..ALTKVTR-----..-CRK---.........----DYEPLI.INLQS..LH......DEMS......CSLSNDN..EIYLRNFLPELGNFT-----qglyr................................................
A0A093NQ14_PYGAD/1-80                  ...............v--------------.--.-..-.-.-.................-S...CDKMNV.TSIF..AGDK............KENDMEILCKATT..VAWEGRSCHRH-..--LE--G.........VYLNLLSLV-.RRKST..VH......KA-P......CPVAAGN..TTSLNDFLVNL---------.....................................................
A0A2I3GPD2_NOMLE/26-72                 ................NCDIALQEIIKTLN.SL.T..E.Q.K.................TL...CTELTV.TDIF..AASK............Q------------..------------..-------.........----------.-----..--......----......-------..--------------------hvclstsrht...........................................
A0A2K5NT42_CERAT/42-133                ..............te--------------.--.-..-.-.-.................--...------.----..--QK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGASAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAS..QSTLEDFLERLKTIMKEKYS.....................................................
IL4_BOVIN/26-133                       ................KCDITLAEIIKTLN.IL.T..T.R.K.................NS...CMELPV.ADVF..AAPK............NTTEKETFCRVGI..ELRRIYRSHT--..-CLN---.........---KFLGGLD.RNLNS..LA......SK-T......CSVNEAKtsTSTLKDLLERLKTIMKEKYS.....................................................
U3LVN1_HUMAN/26-93                     ................KCDITLQEIIKTLN.SL.T..E.Q.K.................TL...CTELTV.TDIF..AASK............QH-----------..------------..-------.........----------.-----..--......----......-------..--------------------aclptsrhtgticrppsarvpststrlqsp.......................
A0A087RF51_APTFO/28-130                .............pkl----KLSEITHRIQ.QL.N.aG.V.Q.................VP...CNDTRV.AQVA..FTDR............TLSEQELLCQAAT..ALTKVTKCK---..---K---.........----DYEPFI.INLQS..LH......GKTN......CSLSNEN..EIYLRNFLPELGNFTQGM--yr...................................................
A0A673UGN8_SURSU/26-118                ..............ns--NNGLREIIKTLN.IL.T..A.K.N.................DS...CMEQTV.MDVL..AAPK............NTSDKEIFCRASA..VLRQIHTHHN--..-CLA---.........---RFLSGLY.RNLSS..LS......RKVS......CVRPSQK..-HT-----------------liqv.................................................
A0A341BKZ4_NEOAA/26-131                ................KCDITLQEIIKTLN.IL.T..A.R.K.................NL...CMELPV.EDVF..ATTK............NTTEKETFCRAGT..VLRHIYRYQK--..-CFN---.........---KPLSGLH.RNLSS..MA......NM-T......CSVNEAK..KSTLKDFLETLKTIMKEKYS.....................................................
A0A1U7QAD7_MESAU/25-140                ............chhg----ALKEIIHILN.QV.T..E.K.G.................TP...CTEMVV.PDAL..SARK............NSTEKDLICRASQ..VLRKFYFQHEVT..LCLKNNS.........RVLKDLKKLY.RGISS..LF......PQKS......CNVNEST..YTTLKDFLESLRRIMQKKY-w....................................................
A0A091M6I4_CARIC/1-79                  ...............v--------------.--.-..-.-.-.................-S...CDKMNV.TNIF..ADDK............R-NDTEILCEATT..VAWEGRSCHK--..----QLE.........GIYLNLRYLV.GR-KS..AA......HKTL......CPVAAGN..TTSLRDFLADL---------.....................................................
V9NJM6_CAVPO/58-88                     ..............dp--------------.--.-..-.-.-.................--...------.----..----............-------------..------------..-------.........----------.-----..--......--QN......CPVSELR..QTTLKDFLENLKRIMQKRYS.....................................................
A0A6A1QH00_BALPH/26-148                ................KCDITLQEIIKTLN.IL.T..A.R.KvsklsgtispdvlvmlcNS...CMELPV.ADVF..AAPK............NTTEKETFCRAAT..VLRHIYGYHK--..-CLN---.........---KPLNGLH.RNLSS..MA......NM-T......CSVNEAK..KSTLKDFLERLKTIMKEKYS.....................................................
A0A3Q7WFH7_URSAR/26-130                ...............n-FSITIKEIIKTLN.IL.T..A.R.N.................DT...CMELTV.TNIF..AAPK............NTTDTETFCRATT..VLRQLSTHS---..-CSN---.........---KLLGGLH.RNLKT..MA......NM-T......CSVNEVK..KSTLRDFLERLKAIVQRKYY.....................................................
IL4_PANTR/26-149                       ................KCDITLQEIIKTLN.SL.T..E.Q.K.................TL...CTELTV.TDIF..AASK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAN..QSTLENFLERLKTIMREKYS.....................................................
G3UXB0_MOUSE/1-45                      ...............m--------------.--.-..-.-.-.................--...------.----..----............-------------..------------..-------.........----ELQRLF.RAFRC..LD......SSIS......CTMNESK..STSLKDFLESLKSIMQMDYS.....................................................
A0A672TWJ7_STRHB/27-130                .............spk---IKLSEITHCIQ.QL.N.sG.V.Q.................VP...CNDTRV.AQVA..FTDR............KLSEQELLCQAAA..ALTSITQ-----..-CRK---.........----DYEPLI.INLQS..LH......GDTS......CSLSDEN..EIYLRNFLPELGNFTQ----gvyr.................................................
A0A6J2N3G4_9CHIR/1-86                  ................--------------.--.-..-.-.-.................--...-MELPI.ADVL..AAPK............NMTEKETFCRVAV..VLRQVYMHHN--..-CEE---.........-TNRSLRKLD.RNLNG..MA......NKIT......CSVNEVR..MSTLRDFLERLRRMMQQKY-a....................................................
A0A3Q7RYM4_VULVU/26-130                ...............n-FNITIKEIIKMLN.IL.T..A.R.N.................DL...CMELTV.KDVF..TAPK............NTSDKEIFCRAAT..VLRQIYTHN---..-CSN---.........---RYLRGLY.RNLSS..MA......NK-T......CSMNEVK..KSTLKDFLERLKVIMQKKYY.....................................................
A3FBF0_MUSPF/26-130                    ...............n-FSIAIKEIIKTLN.IL.T..A.R.N.................DS...CMELTV.TEVF..SAPK............NTSEKEIFCRAAT..VLQQLSTHN---..-CSN---.........---RLLRGLH.RNLRN..MA......NM-T......CSVNEVK..KSTLKDFLERLKVIMQQKYY.....................................................
A0A671FKM8_RHIFE/26-140                ..............el---ILLQEIIKTLN.NL.T..E.T.Knl.............tmNS...CRHLPQ.KEQL..APCKr.........twNTTEKEAFCRAAM..ELRKIYPPHPKD..-VTG---.........---KHLSKLD.RNLSR..LA......NMNS......CPVNETK..KITLKELLERLKQTMKKKY-a....................................................
A0A218V3Z5_9PASE/26-133                ..............rt---NILKESIKLLD.QL.Q..Q.M.E.................VS...CNKMNV.INIF..ADHK............RGNNTEIYCKAAT..IAQE----HQ--..SCHR---.........----YLGGLY.YNLLS..LAwgsrarHKKP......CPVAAGS..TTSLKNFLNDLHHVLQEEY-k....................................................
A0A091IRC6_EGRGA/1-80                  ...............v--------------.--.-..-.-.-.................-S...CDKMNV.TNIF..AGDK............KANDTEMLCKAAT..IALESRDCHTHL..E-----G.........IYLNLLSLIQ.RKSTA..YK......A--P......CPVAAGN..TTSLKQFLADL---------.....................................................
A0A6J3G3V7_SAPAP/26-115                ................NCDVALEEIIKTLN.IV.T..E.Q.K.................TL...CTKLTV.MDIF..AASK............Q------------..------------..-------.........----------.-----..--......----......-------..--------------------hgclpsrhtgsvcxpprvlststgpqspertqlrrkpsaelrlcsgsstatmr
A0A4U1EK20_MONMO/26-131                ................KCDITLQEIIKTLN.IL.T..A.R.K.................NL...CMELPV.EDVF..ATTK............NTTEKETFCRAGT..VLRHIYRYHK--..-CFN---.........---KPLSGLH.RNLSS..MA......NM-T......CSVNEAK..KSTLKDFLETLKTIMKEKYS.....................................................
A0A0G2JVY1_RAT/39-120                  ..............qv--------------.--.-..-.-.-.................--...------.----..----............NTTENELICRASR..VLRKFYFPRDVP..PCLKNKS.........GVLGELRKLC.RGVSG..LN......SLRS......CTVNEST..LTTLKDFLESLKSILRGKY-l....................................................
A0A2K5CG77_AOTNA/26-149                ................NCDIALEEIIRTLN.TV.T..E.Q.K.................TL...CTELTV.MDIF..AASK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hshkQLIRSLKRLD.RNLCS..LA......GLNS......CPVKEAN..QTMLKDFLERLKMIMKEKYS.....................................................
A0A2K6SAE6_SAIBB/26-65                 ................NCDVALEEIIKTLN.IV.T..E.Q.K.................TL...CTELTV.MDIF..AASK............Q------------..------------..-------.........----------.-----..--......----......-------..--------------------hgc..................................................
A0A2Y9IP66_ENHLU/26-130                ...............n-FSIAIKEIIKTLN.IL.T..A.R.N.................DS...CMKLTI.TEVF..TAPK............NTSEKEIFCRAAT..VLQQLSTHN---..-CSN---.........---RLLRGLH.RNLRN..MA......NT-T......CSVNEVK..KSTLKDFLERLKVIMQQKYY.....................................................
A0A673U4Y8_SURSU/26-132                ..............ns--NNGLREIIKTLN.IL.T..A.K.N.................VS...KLSGAIsPDVL..VMPW............NTSDKEIFCRASA..VLRQIHTHHN--..-CLA---.........---RFLSGLY.RNLSS..LS......RK-T......CSVNEVK..KTTLKDFLERLKAIMQKIYS.....................................................
U3IWH3_ANAPP/26-133                    ..............er--SIFLKESIRLLG.EI.L..S.T.Q.................VS...CDKANV.TNVF..AGNE............TGTDMELLCKAST..VVFESLSCHK--..P-LK--G.........IYLNLLHIVT.KS-TS..LK......AP--......CPVAAGN..TTSLQEFLRGLHRTLQ----rvak.................................................
A0A093JBQ7_FULGA/1-80                  ...............v--------------.--.-..-.-.-.................-S...CDKMNV.TSIF..AGDK............KDNDTEILCKATT..VAWEGRSCHR--..----HLE.........GIYLNLFNLI.RSRST..VH......KA-P......CPVAAGN..TTSLNDFLVD----------l....................................................
A0A2K5J181_COLAP/26-149                ................NCHNALREIIETLN.SL.T..E.Q.K.................TL...CTELTV.TDIL..AASK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAS..QSTLEDFLERLKTIMKEKYS.....................................................
A0A2U3XTG1_LEPWE/26-129                ...............n-FSIAIKETIKTLN.IL.T..A.R.N.................DS...CMELTV.TDVF..AAPK............NTTEKE-ICRATT..VLQQLSTHN---..-CSN---.........---KLLKGLH.RNLRK..MA......NM-T......CSVNEVK..KSTLKDFLERLKAIMQRKYY.....................................................
A0A3Q7NDD4_CALUR/26-130                ...............n-FSIAIKEIIRTLN.IL.T..A.R.N.................DL...CMELTV.TDIF..AAPK............NTTEKEIFCRATT..VLQQLSTHN---..-CYN---.........---KLLGGLH.RNLRK..MA......NM-T......CSVNEVK..KSTLKDFLERLKAIMQRKYY.....................................................
A0A3M0J7J8_HIRRU/30-136                ..............et---NMLKESMRLLD.DL.Q..Q.K.E.................VS...CNRMNV.TNIF..ADDK............RGNNTDIFCKAAT..IAREGQSCHR--..----NFK.........GIYLNLLGLV.RSREG..YK......KQ--......CPVAAGS..TTSLKNFLKELHQVLQEDY-k....................................................
V9NK57_CAVPO/14-72                     ..llacasavvrgcnh--------------.--.-..-.-.-.................--...------.----..----............-------------..------------..-------.........---HTLQEII.QHLNT..LS......REKN......CPVSELR..QTTLKDFLENLKRIMQKRYS.....................................................
IL4_RABIT/26-143                       ..............rg--DIILPEVIKTLN.IL.T..E.R.K.................TP...CTKLMI.ADAL..AVPK............NTTEREAVCRAAT..ALRQFYLHHKVS..WCFKEHGe.......lGDLRLLRGLD.RNLCS..MA......KLSN......CPGKEAR..QTTLEDFLDRLKTAMQEKYS.....................................................
A0A4W2ES45_BOBOX/26-133                ................KCDITLAEIIKTLN.IL.T..T.R.K.................NS...CMELPV.ADVF..AAPK............NTTEKETFCRVGI..ELRRIYRSHT--..-CLN---.........---KFLGGLD.RNLNS..LA......SK-T......CSVNEAKtsTSTLKDLLERLKTIMKEKYS.....................................................
A0A226P9G2_COLVI/28-151                .............psl----LLKESIQMIA.KN.V..Q.K.E.................AS...CVKLNV.TDIF..AGSE............TNNRTELLCKASM..VVRESQHCHKDL..QGLFLNMyqlv.nadsTSLKENQGRH.PDI-T..LP......SQAP......CPVAAGN..TTSMAKFLEDLHRFLQQ---lmken................................................
IL4_RAT/25-140                         ..............cn--DSPLREIINTLN.QV.T..E.K.G.................TP...CTEMFV.PDVL..TATR............NTTENELICRASR..VLRKFYFPRDVP..PCLKNKS.........GVLGELRKLC.RGVSG..LN......SLRS......CTVNEST..LTTLKDFLESLKSILRGKY-l....................................................
A0A093CI62_9AVES/1-80                  ...............v--------------.--.-..-.-.-.................-S...CDKMNV.TNIF..AGNK............EDDDMEVLCKATT..IAWEGRSCHMHL..E-----G.........IYVNLLALLR.RQ--S..PE......HQAP......CPVAAGN..TTSLNAFF------------mdl..................................................
A0A091G752_9AVES/28-129                .............pkv----KLSEITQHIQ.QL.S..S.RvQ.................VP...CNDTRV.PQVT..-FTD............QKPDQELLCQATT..ALSKVTRCK---..---K---.........----DYELLI.INLKS..LH......SITS......CSLSNEN..EIYLRNFLPELGNFTQGM--yr...................................................
A0A663MPP3_ATHCN/28-130                .............pkl----KLSEITHRIQ.QL.N.sG.V.Q.................VP...CNDTRV.AQVT..FTDR............KLTEQELLCQAAT..ALAKVEK-----..-CKK---.........----DYQPFI.INLQS..LH......GQRN......CSLSNEN..EIYLRNFLPELGNFTQGM--yr...................................................
A0A091MAL1_CARIC/28-130                ............pkvt-----LSELTHGIQ.QL.N.sG.V.Q.................VP...CNDTRV.AQVA..FTDR............KLSEQELLCQAAT..ALTKVTRCK---..---K---.........----DYEPFI.KNLQS..LH......GKMN......CSLSDDN..EIYLRNFLPELGNFTQGM--yr...................................................
H2QRG7_PANTR/42-133                    ..............te--------------.--.-..-.-.-.................--...------.----..--QK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAN..QSTLEDFLERLKTIMREKYS.....................................................
G1RQL3_NOMLE/26-122                    ................NCDIALQEIIKTLN.SL.T..E.Q.K.................TL...CTELTV.TDIF..AASK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATGrqfh.rqhkQLIGFLKRLD.RNLCG..LA......G---......-------..--------------------ll...................................................
A0A2I2YFB5_GORGO/26-93                 ................KCDIALQEIIKTLN.SL.T..E.Q.K.................TL...CTELTV.TDIF..AASK............QH-----------..------------..-------.........----------.-----..--......----......-------..--------------------aclptsrhtgticrppsarvpststrlqsp.......................
A0A091NFC6_9PASS/1-79                  ...............v--------------.--.-..-.-.-.................-S...CDKMNV.TNIF..AGDK............R-DNMEILCKATT..VTSESQS-----..-CHR---.........----FLKDIH.RNLLC..LV......QRSRtvhkapCPVAPGS..TTSLKDFLKDL---------.....................................................
A0A1A6GIQ2_NEOLE/25-137                .............cna---KALKEIIHILN.QV.T..E.K.G.................TP...CTEMVV.PDVL..TARKaansflygfslqNTTEKELTCRASQ..VLRKFYFPHEVT..LCLKNNS.........AVLQALRRLY.RGISN..LS......----......-------..--------------------ppdgapgvprvenkta.....................................
A0A2K6RBZ7_RHIRO/26-149                ................NCHNALREIIETLN.SL.T..E.Q.K.................TL...CTELTV.TDIL..AASK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAS..QSTLEDFLERLKTIMKEKYS.....................................................
A0A2K6C9D0_MACNE/42-133                ..............te--------------.--.-..-.-.-.................--...------.----..--QK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAS..QSTLEDFLERLKTIMKEKYS.....................................................
A0A2K5Q5Y5_CEBIM/44-133                ...............q--------------.--.-..-.-.-.................--...------.----..---K............NTTEKETFCRAAT..VLRQFYSHHEKG.tRCLGATTqhf..hshkQLIRSLKRLD.RNLCS..LV......GLNS......CPVKEAN..QTMLKDFLERLKMIMKEKYS.....................................................
IL4_CANLF/26-130                       ...............n-FNITIKEIIKMLN.IL.T..A.R.N.................DS...CMELTV.KDVF..TAPK............NTSDKEIFCRAAT..VLRQIYTHN---..-CSN---.........---RYLRGLY.RNLSS..MA......NK-T......CSMNEIK..KSTLKDFLERLKVIMQKKYY.....................................................
G1PUX7_MYOLU/25-134                    .............rky---NTLQETIKMLN.VL.T..A.K.K.................AKdprCMELTV.SDVL..AAPK............NTTEKETLCRAAT..VLRQVYRHHK--..-CLT---.........---RILSGLD.RNLSS..MA......NKTS......CPVNEAK..KRTLKDFLERLKTIMQEKYS.....................................................
IL4_AILME/26-130                       ...............n-FNITIKEIIKTLN.IL.T..A.R.N.................DT...CMELTV.TNIF..AAPK............NTTDTETFCRATT..VLQQLSTHS---..-CSN---.........---KLLGGLH.RNLKT..MA......NM-T......CSVNEVK..KSTLRDFLERLKAIVQRKYY.....................................................
A0A5J5N8M6_MUNRE/26-133                ................KCDITLEEIIKTLN.IL.T..A.R.K.................NS...CMELPV.ADVF..AAPK............NTTEKETFCRAGI..ELRRIYRSHT--..-CLN---.........---RFLSGLD.RNLSG..LA......SK-I......CSVNEAKtsTSTLKGLLERLKTIMKEKYS.....................................................
A0A6J2IUB6_9PASS/30-137                ..............rt---NMLKESIRLLH.QL.Q..Q.T.E.................VS...CNEMNV.TNIF..ADYK............PGDTMEILCKAAT..VARQGRSCHR--..----SLE.........GIYDNLLGLL.RG-NR..ME......HKAP......CPVAAGS..TTSLKNFLKELHQVLQKQY-k....................................................
IL4_CERAT/26-149                       ................NCHIALREIIETLN.SL.T..E.Q.K.................TL...CTKLTI.TDIL..AASK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGASAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAS..QSTLEDFLERLKTIMREKYS.....................................................
D2GVH8_AILME/26-61                     ...............n-FNITIKEIIKTLN.IL.T..A.R.N.................DT...CMELTV.TNIF..AAPK............-------------..------------..-------.........----------.-----..--......----......-------..--------------------.....................................................
G3QSC0_GORGO/26-149                    ................KCDIALQEIIKTLN.SL.T..E.Q.K.................TL...CTELTV.TDIF..AASK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAN..QSTLEDFLERLKTIMREKYS.....................................................
A0A091S3Q0_NESNO/28-130                ............pklk-----LSEITHCIQ.QL.N.sG.V.Q.................VP...CNDTRV.AQVA..FTDR............NLSEQELLCQAAA..ALTSITR-----..-CRK---.........----DYEPLI.INLQS..LH......GDTS......CSLSDEN..EIYLRNFLPELGNFTQ----gvyr.................................................
A0A226MIA9_CALSU/29-151                .............pll-----LKESIQMIA.KN.I..Q.K.E.................AS...CVKLNV.TDIF..AGSE............TNNRTELLCKASM..VVRESQHCHKDL..QGLFLNMyqlv.nadsTSLKENQGRH.PDI-T..LP......SQAP......CPVAAGN..TTSMAKFLEDLHRFLQQ---lmken................................................
A0A1U7RHQ0_ALLSI/30-137                ..............wy---KVLQEIIRSLN.FL.K..E.Q.K.................VS...CKQMNV.SDIF..EDPK............ENNQSEMLCKAAA..VLTKAQ------..-CFC---.........QECRHLKVIR.VNLLE..LT......RTVR......CPVNTTS..NTTLHGFLERLTD-------lsqmimkqnl...........................................
A0A3P4NML3_GULGU/26-130                ...............n-FSIAIKEIIKTLN.IL.T..A.R.N.................DS...CMELTV.TEVF..TAPE............NTSEKEIFCRAAT..VLQQLSTHN---..-CSN---.........---RLLRGLH.RNLRN..MA......NM-A......CPVNEAK..KSTLKDFLEKLKAIMQQKYY.....................................................
A0A6I9KI10_CHRAS/26-132                ................KCGIVLKEIIKTLN.FL.T..E.K.E.................NA...CTQLTV.PDAF..AAPK............NTTEKETFCRATV..VLWQAYKQHK--..-CLT---.........---QYLSGLY.RGIRS..MT......NVTY......CPVNENR..TNTLSEFLEKLKTIMKEKYS.....................................................
A0A091W076_OPIHO/29-130                .............rlk-----LSEITHRIQ.QL.N.sG.V.Q.................VP...CNDTRV.AQVA..FTDR............QLSEQELLCQAAA..ALTKVTLCKK--..-------.........----DYEPFI.INLQS..LH......GKTD......CSLSNEN..EIYLRNFLPELGNFTQG---myr..................................................
IL4_MESAU/25-140                       ............chhg----ALKEIIHILN.QV.T..E.K.G.................TP...CTEMVV.PDAL..SARK............NSTEKDLICRASQ..GFRKFYFQHEVT..LCLKNNS.........RVLKDLKKLY.RGISS..LF......PQKS......CNVNEST..YTTLKDFLESLRRIMQKKY-w....................................................
A0A151M734_ALLMI/1317-1443             ................KCKTDYQAIITNLF.EV.Y..G.Y.R.................VS...CKQMNV.SDIF..EDPK............SMTSASSATKSTVppCSPPILEKNQSE..MLCKAAAvltkaqcfcQEHRHLKAIR.VNLLE..LT......HTVR......CPVNTTS..NTTLHGFLERLTD-------lsqmimm..............................................
G1N9Y5_MELGA/29-131                    .............pkm----KLSDITRSIQ.QL.N.kG.E.Q.................VP...CNDTRV.AQVA..FTDR............KLSEQELLCQAAT..VLTKVTR-----..-CKKD--.........-----YEPLI.TSLQS..LH......GQMS......CQLSTDN..EIYLRNFLPTLG--------nftqalyr.............................................
A0A6I9MFL2_PERMB/25-140                ..............cn--DKALKEIIHILN.QV.T..E.K.G.................TP...CTEMVV.PDVL..TARK............NTTEKELICRASQ..VLRKFYFPHEVT..PCLKNNS.........GVLKALKRLH.RSISN..LS......PQKS......CTGNEST..HTTLKDFLESLRRTMQKKY-w....................................................
A0A2I3HR84_NOMLE/44-115                ...............q--------------.--.-..-.-.-.................--...------.----..---K............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATGrqfh.rqhkQLIGFLKRLD.RNLCG..LA......GLLK......TIMR---..--------------------ekys.................................................
A0A673UGF9_SURSU/26-131                ..............ns--NNGLREIIKTLN.IL.T..A.K.N.................DS...CMEQTV.MDVL..AAPK............NTSDKEIFCRASA..VLRQIHTHHN--..-CLA---.........---RFLSGLY.RNLSS..LS......RK-T......CSVNEVK..KTTLKDFLERLKAIMQKIYS.....................................................
F6U5N6_HORSE/26-135                    ................KYDITLQEIIKTLN.NL.TdgK.G.K.................NS...CMELTV.ADAF..AGPK............NTDGKE-ICRAAK..VLQQLYKRHDRS..-LIK---.........---ECLSGLD.RNLKG..MA......NGTC......CTVNEAK..KSTLKDFLERLKTIMKEKYS.....................................................
A0A091V0G0_NIPNI/28-130                .............pkl----KLSEITHRIH.QL.N.sG.V.Q.................VP...CNDTRV.AQVA..FTDQ............KLSEQELLCQAAT..ALMKVTRCK---..---KD--.........-----YEMFI.INLQS..LH......GKTN......CSLNNDN..EIYLRNFLPELGNFTQGM--yr...................................................
H0XDE1_OTOGA/26-149                    ...............k-RGIVLKECIKALN.IL.T..E.N.K.................TP...CDELTV.ADIF..AASK............NTTEKEIFCRAAT..VLRQVYSHHQKE..PCRGATErqql.yrhqQVIRFLKGLD.RNLCS..LA......NSRY......CPVNDAM..QSTLKDFLERLKTTMKEKYS.....................................................
A0A226PAQ9_COLVI/30-130                lklsdithsiqqfnrg--------------.--.-..-.A.Q.................VP...CNDTRV.AQVV..FTDR............KLSEYELLCQAAR..VLAKVTH-----..-CKKD--.........-----YEPLI.TNLQS..LH......RKES......CLLNTDN..EIYLRNFLPALG--------nftqalyr.............................................
A0A099YVI1_TINGU/28-100                .............prq----KLSEITHLIQ.QL.N..A.RpQ.................IP...CNDTRV.AQVV..FTDR............KLSEQELLCQAST..ALSKVTKCK---..-------.........----------.-----..--......----......-------..--------------------mdykpllvnlqslhs......................................
A0A1S3GBZ7_DIPOR/27-147                ..............cd--DDALREIIKTLN.TL.S..G.R.K.................TP...CTELTV.ADIFdfAGPQ............NTSEMENLCRAMT..VLQQTYQNGSEL.tQCLTRRKe.......hDILHHLRRLY.RALYS..RV......TLKH......CPVNDST..KSTWKHFLENLKRLMKKKY-l....................................................
IL4_PIG/26-131                         ................KCDITLQEIIKTLN.IL.T..A.R.K.................NS...CMELPV.TDVF..AAPE............NTTEKETFCRAST..VLRHIYRHHT--..-CMK---.........---SLLSGLD.RNLSS..MA......NM-T......CSVHEAK..KSTLKDFLERLKTIMKEKYS.....................................................
A0A553PUD9_9TELE/24-126                ...........aekvl-----LEEIIESID.DF.V..R.H.P.................DT...QSKSIL.GMFV..KDQA............ESCSKEALCRAGH..ALKEIPMENN--..---K---.........-----LQRQL.LAYAH..YT......TLGN......CSVSNAD..ESMVKDFLQKVKACSREQY-a....................................................
A0A099ZYT9_CHAVO/28-130                .............pkr----KLSEITHRIQ.QL.N.sG.V.Q.................VP...CNDTRV.AQVA..FTDR............KLSEQELLCQAAT..ALTKVTR-----..-CKKD--.........-----YEPFI.VNLQS..LH......GKMN......CSLSNEN..EIYLRNFLPELGNFTQG---myr..................................................
A0A6P6HXZ0_PUMCO/26-131                ...............n-FNNTLKEIIKTLN.IL.T..A.R.N.................DS...CMELTV.MDVL..AAPK............NTSDKEIFCRATT..VLRQIYTHHN--..-CST---.........---KFLKGLD.RNLSS..MA......NR-T......CSVNEVK..KSTLKDFLERLKAIMQKKYS.....................................................
S9YLP2_CAMFR/59-124                    ...............t--------------.--.-..-.-.-.................--...------.---L..TARK............NTTEKETFCKAAT..ALRHIYRHHN--..-CLS---.........---KHLSGLD.RNLSG..LA......NTE-......-------..--------------------gthaeslsavqaatqka....................................
A0A6J0X689_ODOVR/26-133                ................KCDITLEEIIKTLN.IL.T..A.R.K.................NS...CMELPV.ADVF..AAPK............NTTEKETFCRAGI..ELRRIYRSHS--..-CLN---.........---RFLSGLD.RNLSG..LA......SK-T......CSVNEAKtsTSTLKDLLERLKTIMKEKYS.....................................................
A0A2I2ZNV2_GORGO/42-133                ..............te--------------.--.-..-.-.-.................--...------.----..--QK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAN..QSTLEDFLERLKTIMREKYS.....................................................
IL4_HUMAN/26-149                       ................KCDITLQEIIKTLN.SL.T..E.Q.K.................TL...CTELTV.TDIF..AASK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAN..QSTLENFLERLKTIMREKYS.....................................................
#=GR IL4_HUMAN/26-149            SS    ................TTSTHHHHHHHHHH.HH.H..T.S.-.................SS...GTTSEE.E-GG..GSSS............SSSHHHHHHHHHH..HHHHHHHHHTTS.TTTS-SSHHHH..HHHHHHHHHHHHHH.HHHHH..HH......TSS-......----SSS..EEEHHHHHHHHHHHHHHHHH.....................................................
A0A0D9RMS8_CHLSB/26-149                ................NCHIALQEIIETLN.SL.T..E.Q.K.................TL...CTKLTV.TDIL..AASK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkKLIRFLKRLD.RNLWG..LA......GLSS......CPVKEAS..QSTLEDFLERLKTIMKEKYS.....................................................
A0A2K5NTM1_CERAT/26-78                 ................NCHIALREIIETLN.SL.T..E.Q.K.................TL...CTKLTI.TDIL..AASK............Q------------..------------..-------.........----------.-----..--......----......-------..--------------------haclptsrhsgsicrp.....................................
A0A2K6RC06_RHIRO/26-77                 ................NCHNALREIIETLN.SL.T..E.Q.K.................TL...CTELTV.TDIL..AASK............Q------------..------------..-------.........----------.-----..--......----......-------..--------------------haclptsrhsgsicr......................................
A0A2K5CFR9_AOTNA/26-65                 ................NCDIALEEIIRTLN.TV.T..E.Q.K.................TL...CTELTV.MDIF..AASK............Q------------..------------..-------.........----------.-----..--......----......-------..--------------------hgc..................................................
A0A6J3DTA3_AYTFU/26-133                ..............er--SIFLKESIRLLG.EI.L..S.T.Q.................VS...CDKTNV.TNVF..AGNE............TDTDMELLCKAST..VVFESLSCHK--..PLKG---.........IYLNLLHIVT.---KS..TD......LKAP......CPVAAGN..TTSLQEFLGGLHRALQ----rvak.................................................
A0A2K6SAD8_SAIBB/26-149                ................NCDVALEEIIKTLN.IV.T..E.Q.K.................TL...CTELTV.MDIF..AASK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqhf..hshkQLIRSLKRLD.RNLCS..LA......GLNS......CPVKEAN..QTMLKDFLERLKMIMKEKYS.....................................................
G3T4B8_LOXAF/26-133                    ...............t-CGNILREIIKTLN.FL.T..E.K.K.................HA...CTELTV.ADAF..AAPK............NTTEKETFCRATT..VLWQVSKRHE--..-CFT---.........---KYLRGLS.RSLSS..MT......NLDY......CPVNEDRnlFKTAR-VIEKLKTIYYTKF-e....................................................
A0A340XPY0_LIPVE/26-131                ................KCDITLQEIIKTLN.IL.T..A.R.K.................NL...CMELPV.EDVF..ATTK............NTTEKETFCRAAT..VLWHIYRYHK--..-CLN---.........---KHLSGLH.RNLSS..MA......NM-T......CSVNEAK..KSTLKDFLERLKTIMKEKYS.....................................................
L5JX76_PTEAL/1-84                      ................--------------.--.-..-.-.-.................--...-MELMV.ADVF..AAPK............NTAEDEIFCRAVT..VLRKVYKHHE--..-CVN---.........--RKFLGKLD.RNLRS..MA......RD-Y......CPVEEAK..KDTLKNVLETLRKTMQEKYS.....................................................
A9CB13_PAPAN/26-149                    ................NCHIALREIIETLN.SL.T..E.Q.K.................TL...CTKLTI.TDIL..AASK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAS..QSTLEDFLERLKTIMKEKYS.....................................................
A0A663F7M3_AQUCH/26-136                ............qtst----LLKESIRLLS.D-.P..E.M.K.................VS...CDKMNV.TNIF..AGNK............KVDDMEILCKATT..VTLEAQSCH---..---KHLR.........GIYINLVKLV.Q-MKS..AV......HKAP......CPVAAGN..TTSLCDFLEDLQKVLQR---lvkdys...............................................
IL4_MACFA/26-149                       ................KCDITLQEIIKTLN.SL.T..E.Q.K.................TL...CTKLTI.TDIL..AASK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAN..QSTLENFLERLKTIMREKYS.....................................................
A0A2R8ZVJ1_PANPA/42-133                ..............te--------------.--.-..-.-.-.................--...------.----..--QK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAN..QSTLEDFLERLKTIMREKYS.....................................................
A0A2K6MWH2_RHIBE/26-149                ................NCHNALREIIETLN.SL.T..E.Q.K.................TL...CTELTV.TDIL..AASK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAS..QSTLEDFLERLKTIMKEKYS.....................................................
A0A384C641_URSMA/26-130                ...............n-FSITIKEIIKTLN.IL.T..A.R.N.................DT...CMELTV.TNIF..AAPK............NTTDTETFCRATT..VLRQLSTHS---..-CSN---.........---KLLGGLH.RNLKT..MA......NM-T......CSVNEVK..KSTLRDFLERLKAIVQRKYY.....................................................
G1N9Y7_MELGA/27-131                    ...........qhpvl-----LKESIRIVK.DM.-..Q.K.E.................VS...CGKMNV.TDIF..EGSK............TKNRTELLCEASA..IILESQH-----..-CHKNLQ.........GLFLNVRQL-.--LNS..TS......LKAP......CPVTAGN..TTSMEKFLSDLHRLLQQ---lv...................................................
A0A2I3SZ99_PANTR/26-93                 ................KCDITLQEIIKTLN.SL.T..E.Q.K.................TL...CTKLTV.TDIF..AASK............QH-----------..------------..-------.........----------.-----..--......----......-------..--------------------aclptsrhtgticrppsarvpststrlqsp.......................
A0A2K5CFR4_AOTNA/44-133                ...............q--------------.--.-..-.-.-.................--...------.----..---K............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hshkQLIRSLKRLD.RNLCS..LA......GLNS......CPVKEAN..QTMLKDFLERLKMIMKEKYS.....................................................
A0A140TAX8_PANTR/26-149                ................KCDITLQEIIKTLN.SL.T..E.Q.K.................TL...CTKLTV.TDIF..AASK............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqqf..hrhkQLIRFLKRLD.RNLWG..LA......GLNS......CPVKEAN..QSTLEDFLERLKTIMREKYS.....................................................
A0A093IQU7_EURHL/29-130                .............rlk-----LSEITHRIQ.QL.N.sG.V.Q.................VP...CNDTRV.AQVA..FTDR............KLSEQELLCQAAT..ALTEVTKCK---..---ND--.........-----YEPFI.VNLQS..LH......GKTN......CSLSHEN..EIYLRNFLPELGNFTQG---myr..................................................
A0A3L8SJA7_CHLGU/1-73                  ...........rannt--------------.--.-..-.-.-.................--...------.----..----............-----EILCEAAT..IA----------..---QEHQ.........SCHRYLGGLY.YNLLS..LAwgsrarHKKP......CPVAEGS..TTSLKNFLKDLHHVLQEEY-k....................................................
A0A6P5KQG6_PHACI/28-151                ...............t-CQPSLREIVHMAN.SL.T..M.K.K.................FP...CFEMEV.PDIF..EDTE............NSSTPKLFPEESS..CSQLVMTMNDFE..TLCRAVTvlqq.vsnsCPFPKLSNML.RNLMH..LV......NQTK......CPVNETK..ITKLQDFLSKLKTINQKIFS.....................................................
A0A2K6SAD1_SAIBB/44-133                ...............q--------------.--.-..-.-.-.................--...------.----..---K............NTTEKETFCRAAT..VLRQFYSHHEKD.tRCLGATAqhf..hshkQLIRSLKRLD.RNLCS..LA......GLNS......CPVKEAN..QTMLKDFLERLKMIMKEKYS.....................................................
A0A091LWK4_CATAU/1-80                  ...............v--------------.--.-..-.-.-.................-S...CDNVNV.TNIF..AGNM............KDSNMETLCKATT..VAWESRSCHRHL..E-----G.........IYLNLLS-LV.RRKSA..VH......KA-P......CPVAAGN..TTSLKYFLMEL---------.....................................................
A0A6P5C0Z5_BOSIN/26-133                ................KCDITLAEIIKTLN.IL.T..T.R.K.................NS...CMELPV.ADVF..AAPK............NTTEKETFCRVGI..ELRRIYRSHX--..-CLN---.........---KFLGGLD.RNLNS..LA......SK-T......CSVNEAKtsTSTLKDLLERLKTIMKEKYS.....................................................
#=GC SS_cons                           ................TTSTHHHHHHHHHH.HH.H..T.S.-.................SS...GTTSEE.E-GG..GSSS............SSSHHHHHHHHHH..HHHHHHHHHTTS.TTTS-SSHHHH..HHHHHHHHHHHHHH.HHHHH..HH......TSS-......----SSS..EEEHHHHHHHHHHHHHHHHH.....................................................
#=GC seq_cons                          ....................tLpEII+pLN..L.o..t.p.p.................s....Ch-hsV.s-lh..AssK............NsoEpEhhC+AuT..lLpphhpp+p.....Cht...............p.LptLt.RNLpu..hs......sh.s......CsVs-sp..pooL+-FL-cL+shhpphY......................................................
//
DBGET integrated database retrieval system