GenomeNet

Database: Pfam
Entry: LtuB
LinkDB: LtuB
Original site: LtuB 
#=GF ID   LtuB
#=GF AC   PF17455.7
#=GF DE   Late transcription unit B
#=GF AU   El-Gebali S;0000-0003-1378-5495
#=GF SE   PRODOM:PD066315
#=GF GA   25.00 25.00;
#=GF TC   34.20 193.40;
#=GF NC   23.70 21.60;
#=GF BM   hmmbuild  HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 90746521 -E 1000 --cpu 8 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   16436211
#=GF RT   BLAST screening of chlamydial genomes to identify signature
#=GF RT   proteins that are unique for the Chlamydiales, Chlamydiaceae,
#=GF RT   Chlamydophila and Chlamydia groups of species.
#=GF RA   Griffiths E, Ventresca MS, Gupta RS;
#=GF RL   BMC Genomics. 2006;7:14.
#=GF DR   INTERPRO; IPR020502;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This is a family of unknown function. Family members include the
#=GF CC   Chlamydia late transcription unit B protein [1].
#=GF SQ   1
#=GS LTUB_CHLTR/19-97  AC Q46404.1
LTUB_CHLTR/19-97             NYFPASIEGETKKEHKHHYSTASKEKESLRKRAKEFDVLVHSLLDKHVPQNSDQVLIFTYQNGFVETDFHNFGRYSVKL
#=GC seq_cons                NYFPASIEGETKKEHKHHYSTASKEKESLRKRAKEFDVLVHSLLDKHVPQNSDQVLIFTYQNGFVETDFHNFGRYSVKL
//
DBGET integrated database retrieval system