GenomeNet

Database: Pfam
Entry: Med5
LinkDB: Med5
Original site: Med5 
#=GF ID   Med5
#=GF AC   PF08689.12
#=GF DE   Mediator complex subunit Med5
#=GF AU   Mistry J;0000-0003-2479-5322
#=GF AU   Wood V;0000-0001-6330-7526
#=GF SE   manual
#=GF GA   20.90 20.90;
#=GF TC   21.00 21.10;
#=GF NC   20.70 20.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 57096847 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Mediator_(coactivator)
#=GF RN   [1]
#=GF RM   16230344
#=GF RT   The structural and functional role of Med5 in the yeast Mediator
#=GF RT   tail module. 
#=GF RA   Beve J, Hu GZ, Myers LC, Balciunas D, Werngren O, Hultenby K,
#=GF RA   Wibom R, Ronne H, Gustafsson CM; 
#=GF RL   J Biol Chem. 2005;280:41366-41372.
#=GF RN   [2]
#=GF RM   15175151
#=GF RT   A unified nomenclature for protein subunits of mediator
#=GF RT   complexes linking transcriptional regulators to RNA polymerase
#=GF RT   II. 
#=GF RA   Bourbon HM, Aguilera A, Ansari AZ, Asturias FJ, Berk AJ,
#=GF RA   Bjorklund S, Blackwell TK, Borggrefe T, Carey M, Carlson M,
#=GF RA   Conaway JW, Conaway RC, Emmons SW, Fondell JD, Freedman LP,
#=GF RA   Fukasawa T, Gustafsson CM, Han M, He X, Herman PK, Hinnebusch
#=GF RA   AG, Holmberg S, 
#=GF RL   Mol Cell. 2004;14:553-557.
#=GF DR   INTERPRO; IPR014801;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   The mediator complex is required for the expression of nearly
#=GF CC   all RNA pol II dependent genes in Saccharomyces cerevisiae. 
#=GF CC   Deletion of the MED5 gene leads to increased transcription of
#=GF CC   nuclear genes encoding components of the oxidative
#=GF CC   phosphorylation machinery, and decreased transcription of
#=GF CC   mitochondrial genes encoding components of the same machinery
#=GF CC   [1]. There is no orthologue from pombe, and this subunit appears
#=GF CC   to be fungal specific [2].
#=GF SQ   685
#=GS A0A067QBX1_9AGAM/482-745    AC A0A067QBX1.1
#=GS G7X6H3_ASPKW/2-985          AC G7X6H3.1
#=GS A0A4Z1KET4_9HELO/28-956     AC A0A4Z1KET4.1
#=GS W6MY50_9ASCO/362-691        AC W6MY50.1
#=GS A0A2T6ZUV4_TUBBO/9-855      AC A0A2T6ZUV4.1
#=GS MED5_COCIM/10-991           AC Q1E024.2
#=GS A0A1D2VKM2_9ASCO/715-1128   AC A0A1D2VKM2.1
#=GS U7Q2J6_SPOS1/403-1112       AC U7Q2J6.1
#=GS A0A4Z1JR19_9HELO/27-962     AC A0A4Z1JR19.1
#=GS A0A117NSS8_9EURO/5-950      AC A0A117NSS8.1
#=GS A0A2D3URX7_9PEZI/112-727    AC A0A2D3URX7.1
#=GS K2SAK5_MACPH/14-898         AC K2SAK5.1
#=GS A0A067NUM6_PLEOS/443-697    AC A0A067NUM6.1
#=GS A0A2N5VT39_9BASI/89-163     AC A0A2N5VT39.1
#=GS A0A1B9IFY4_9TREE/595-712    AC A0A1B9IFY4.1
#=GS A0A4U0VRY7_9BASI/359-633    AC A0A4U0VRY7.1
#=GS A0A4Y8DCW2_9HELO/25-960     AC A0A4Y8DCW2.1
#=GS A0A0D9NVL4_METAN/17-958     AC A0A0D9NVL4.1
#=GS A0A2G7FX32_9EURO/2-967      AC A0A2G7FX32.1
#=GS A0A1L9VT81_ASPGL/11-1008    AC A0A1L9VT81.1
#=GS A0A090CIC4_PODAN/52-802     AC A0A090CIC4.1
#=GS A0A0C4F5J7_PUCT1/274-385    AC A0A0C4F5J7.1
#=GS MED5_PHANO/17-252           AC Q0USP2.3
#=GS A2QHS8_ASPNC/646-963        AC A2QHS8.1
#=GS A0A4Q4YPV4_9PEZI/351-866    AC A0A4Q4YPV4.1
#=GS A0A0D0E710_9AGAM/567-732    AC A0A0D0E710.1
#=GS A0A2S6CHL1_9PEZI/268-978    AC A0A2S6CHL1.1
#=GS A0A1Y2ECP1_9BASI/409-722    AC A0A1Y2ECP1.1
#=GS A0A166NH10_9HYPO/28-965     AC A0A166NH10.1
#=GS A0A1X6NFM3_9APHY/439-693    AC A0A1X6NFM3.1
#=GS A0A2S4Q1F9_9PEZI/569-904    AC A0A2S4Q1F9.1
#=GS G3JCY3_CORMM/16-491         AC G3JCY3.1
#=GS A0A1Q8S1Y3_9PEZI/13-989     AC A0A1Q8S1Y3.1
#=GS G2YHD3_BOTF4/27-963         AC G2YHD3.1
#=GS A0A3D8RHI8_9HELO/20-962     AC A0A3D8RHI8.1
#=GS A0A1B8GA04_9PEZI/19-756     AC A0A1B8GA04.1
#=GS A0A0L0NIM4_TOLOC/14-941     AC A0A0L0NIM4.1
#=GS A0A0C2W3K0_9AGAM/440-686    AC A0A0C2W3K0.1
#=GS A0A4S3JBF2_9EURO/1-800      AC A0A4S3JBF2.1
#=GS A0A3D8QBR8_9EURO/529-957    AC A0A3D8QBR8.1
#=GS A0A2N5T6P7_9BASI/440-770    AC A0A2N5T6P7.1
#=GS A0A0D2G1M2_9EURO/445-706    AC A0A0D2G1M2.1
#=GS C4JW55_UNCRE/2-894          AC C4JW55.1
#=GS A0A017SLL4_9EURO/11-1001    AC A0A017SLL4.1
#=GS C6H7Y9_AJECH/477-941        AC C6H7Y9.1
#=GS A0A1Y2M7M8_EPING/3-994      AC A0A1Y2M7M8.1
#=GS A0A0D2XC79_FUSO4/413-655    AC A0A0D2XC79.1
#=GS A0A0D2JJA9_9EURO/385-714    AC A0A0D2JJA9.1
#=GS S7QMQ2_GLOTA/457-712        AC S7QMQ2.1
#=GS A0A397GU15_9EURO/9-655      AC A0A397GU15.1
#=GS A0A3N4HQB4_ASCIM/256-886    AC A0A3N4HQB4.1
#=GS A0A072NWY0_9EURO/389-906    AC A0A072NWY0.1
#=GS A0A164UBQ7_9AGAM/474-741    AC A0A164UBQ7.1
#=GS A0A086SW73_ACRC1/71-946     AC A0A086SW73.1
#=GS A0A1B7NR07_9EURO/9-964      AC A0A1B7NR07.1
#=GS A0A364KKH4_9EURO/2-853      AC A0A364KKH4.1
#=GS A0A2B7YZC3_9EURO/9-971      AC A0A2B7YZC3.1
#=GS A0A1V2L8M3_CYBFA/65-827     AC A0A1V2L8M3.1
#=GS A0A177VTZ5_9BASI/133-251    AC A0A177VTZ5.1
#=GS A0A421J7N1_9ASCO/3-754      AC A0A421J7N1.1
#=GS G4UDR5_NEUT9/146-1112       AC G4UDR5.1
#=GS A0A5C3NJX4_9AGAM/273-713    AC A0A5C3NJX4.1
#=GS A0A5C3M9F9_9AGAR/459-711    AC A0A5C3M9F9.1
#=GS A0A151GI90_9HYPO/16-980     AC A0A151GI90.1
#=GS A0A550CN29_9AGAR/477-678    AC A0A550CN29.1
#=GS A0A367KZ78_9HYPO/322-890    AC A0A367KZ78.1
#=GS A0A135LTE0_PENPA/3-958      AC A0A135LTE0.1
#=GS A0A5C3PTJ1_9APHY/569-695    AC A0A5C3PTJ1.1
#=GS G9NF32_HYPAI/33-902         AC G9NF32.1
#=GS A0A409VYK2_9AGAR/630-866    AC A0A409VYK2.1
#=GS A0A428PPL9_9HYPO/14-928     AC A0A428PPL9.1
#=GS A0A0F4ZCP6_9PEZI/324-977    AC A0A0F4ZCP6.1
#=GS L2FNN4_COLFN/49-984         AC L2FNN4.1
#=GS B6HSV8_PENRW/6-971          AC B6HSV8.1
#=GS A0A0G2HQW4_9PEZI/18-953     AC A0A0G2HQW4.1
#=GS F7VX65_SORMK/50-1013        AC F7VX65.1
#=GS A0A179IHU5_CORDF/483-904    AC A0A179IHU5.1
#=GS D4AZE1_ARTBC/466-627        AC D4AZE1.1
#=GS A0A0D7BT94_9AGAR/450-793    AC A0A0D7BT94.1
#=GS C5FF33_ARTOC/12-986         AC C5FF33.1
#=GS G4TV45_SERID/271-700        AC G4TV45.1
#=GS MED5_PHANO/244-920          AC Q0USP2.3
#=GS A0A0J8RX20_COCIT/10-991     AC A0A0J8RX20.1
#=GS G1XKU5_ARTOA/293-884        AC G1XKU5.1
#=GS A0A1E4RWS7_CYBJN/73-894     AC A0A1E4RWS7.1
#=GS A0A066V4B1_TILAU/568-780    AC A0A066V4B1.1
#=GS M9LYX4_PSEA3/549-884        AC M9LYX4.1
#=GS A0A180FZN5_PUCT1/278-387    AC A0A180FZN5.1
#=GS F9G7R4_FUSOF/36-270         AC F9G7R4.1
#=GS I2G037_USTH4/566-899        AC I2G037.1
#=GS A0A1E3QSH7_9ASCO/182-573    AC A0A1E3QSH7.1
#=GS A7E5V4_SCLS1/162-719        AC A7E5V4.1
#=GS A0A0H2RBR4_9AGAM/457-716    AC A0A0H2RBR4.1
#=GS W6Q159_PENRF/8-989          AC W6Q159.1
#=GS A0A094CU64_9PEZI/21-759     AC A0A094CU64.1
#=GS A0A553I5E0_9PEZI/54-947     AC A0A553I5E0.1
#=GS A0A1S9DZG7_ASPOZ/2-967      AC A0A1S9DZG7.1
#=GS A0A1F7ZZ98_9EURO/2-966      AC A0A1F7ZZ98.1
#=GS A0A0M8N2D0_9HYPO/427-806    AC A0A0M8N2D0.1
#=GS A0A367JQ52_RHIAZ/31-399     AC A0A367JQ52.1
#=GS A0A5N5X4L5_9EURO/2-965      AC A0A5N5X4L5.1
#=GS A0A5B0RD69_PUCGR/446-751    AC A0A5B0RD69.1
#=GS A0A369GPW3_9HYPO/323-874    AC A0A369GPW3.1
#=GS A0A1L9X209_ASPA1/2-973      AC A0A1L9X209.1
#=GS A0A150VID6_9PEZI/25-648     AC A0A150VID6.1
#=GS A0A2S7PR84_9HELO/29-978     AC A0A2S7PR84.1
#=GS A0A080WR42_TRIRC/1-180      AC A0A080WR42.1
#=GS J7RAF4_KAZNA/1-1131         AC J7RAF4.1
#=GS A0A2C5ZMZ3_9HYPO/302-894    AC A0A2C5ZMZ3.1
#=GS S3BZ01_OPHP1/240-1045       AC S3BZ01.1
#=GS C7YTM5_NECH7/14-952         AC C7YTM5.1
#=GS A0A167D9E0_9ASCO/66-641     AC A0A167D9E0.1
#=GS A6R7P5_AJECN/516-700        AC A6R7P5.1
#=GS A0A2I2EYQ6_9EURO/1-826      AC A0A2I2EYQ6.1
#=GS A0A167M174_CALVF/670-813    AC A0A167M174.1
#=GS A0A397V815_9GLOM/179-473    AC A0A397V815.1
#=GS A0A1E4TBI0_9ASCO/15-352     AC A0A1E4TBI0.1
#=GS A0A0C7N442_9SACH/2-1068     AC A0A0C7N442.1
#=GS A0A4Q4X943_9PEZI/302-839    AC A0A4Q4X943.1
#=GS A0A094AF75_9PEZI/18-688     AC A0A094AF75.1
#=GS A0A010R6G8_9PEZI/14-983     AC A0A010R6G8.1
#=GS A0A179IHU5_CORDF/303-486    AC A0A179IHU5.1
#=GS A0A094HYF8_9PEZI/22-757     AC A0A094HYF8.1
#=GS C6H7Y9_AJECH/9-480          AC C6H7Y9.1
#=GS A0A5B0R0V3_PUCGR/428-728    AC A0A5B0R0V3.1
#=GS A0A2P7YES6_9PEZI/109-851    AC A0A2P7YES6.1
#=GS C5DPE0_ZYGRC/1-1081         AC C5DPE0.1
#=GS A0A316VJT3_9BASI/197-519    AC A0A316VJT3.1
#=GS R9P832_PSEHS/561-854        AC R9P832.1
#=GS A0A420ILB0_9PEZI/57-972     AC A0A420ILB0.1
#=GS M1VVS5_CLAP2/320-939        AC M1VVS5.1
#=GS N1PN55_DOTSN/270-821        AC N1PN55.1
#=GS A0A2N1JEG5_9BASI/325-450    AC A0A2N1JEG5.1
#=GS A0A1C1CDD1_9EURO/464-725    AC A0A1C1CDD1.1
#=GS G8BG32_CANPC/629-805        AC G8BG32.1
#=GS C5DMR8_LACTC/3-1070         AC C5DMR8.1
#=GS A0A1V6T5D0_9EURO/6-972      AC A0A1V6T5D0.1
#=GS C1GBZ9_PARBD/11-963         AC C1GBZ9.2
#=GS I1CL94_RHIO9/544-822        AC I1CL94.1
#=GS A0A0L0VFJ0_9BASI/335-461    AC A0A0L0VFJ0.1
#=GS A0A1L9PQD1_ASPVE/12-1025    AC A0A1L9PQD1.1
#=GS A0A177UI33_9BASI/130-250    AC A0A177UI33.1
#=GS A0A1E4TNV0_PACTA/2-266      AC A0A1E4TNV0.1
#=GS B6Q263_TALMQ/2-967          AC B6Q263.1
#=GS A0A179H741_PURLI/19-957     AC A0A179H741.1
#=GS T0LKA6_COLGC/49-980         AC T0LKA6.1
#=GS A0A5M9JSC7_MONFR/266-750    AC A0A5M9JSC7.1
#=GS A0A4Q1B9Z1_TREME/579-721    AC A0A4Q1B9Z1.1
#=GS A0A093ZY63_9PEZI/22-773     AC A0A093ZY63.1
#=GS A0A5N6EJ54_9EURO/2-967      AC A0A5N6EJ54.1
#=GS A0A162NKV9_PHYB8/668-977    AC A0A162NKV9.1
#=GS A0A1B8DZE0_9PEZI/64-759     AC A0A1B8DZE0.1
#=GS A0A165NE65_EXIGL/545-721    AC A0A165NE65.1
#=GS A0A168CMY0_CORFA/31-903     AC A0A168CMY0.1
#=GS A0A0L0VFJ0_9BASI/463-678    AC A0A0L0VFJ0.1
#=GS A0A135U3T8_9PEZI/121-1054   AC A0A135U3T8.1
#=GS A0A5N5N8U1_9PEZI/43-997     AC A0A5N5N8U1.1
#=GS D4AZE1_ARTBC/296-473        AC D4AZE1.1
#=GS G0WFF2_NAUDC/10-1100        AC G0WFF2.1
#=GS A0A1Y2X839_9PEZI/63-968     AC A0A1Y2X839.1
#=GS A0A395HCR3_9EURO/2-945      AC A0A395HCR3.1
#=GS A0A166EYQ9_9AGAM/474-741    AC A0A166EYQ9.1
#=GS A0A3M6YUL5_HORWE/54-615     AC A0A3M6YUL5.1
#=GS A0A166NLH4_9PEZI/49-984     AC A0A166NLH4.1
#=GS A0A3A2ZK57_9EURO/1-888      AC A0A3A2ZK57.1
#=GS A0A074XYF4_AURPU/4-613      AC A0A074XYF4.1
#=GS A0A232LV26_9EURO/470-921    AC A0A232LV26.1
#=GS A0A367Y1D9_9ASCO/714-900    AC A0A367Y1D9.1
#=GS G0SGD2_CHATD/511-950        AC G0SGD2.1
#=GS A0A178AD59_9PLEO/3-980      AC A0A178AD59.1
#=GS A0A5M6C2R2_9TREE/564-696    AC A0A5M6C2R2.1
#=GS A0A656KHB5_BLUGR/58-964     AC A0A656KHB5.1
#=GS H6BKY6_EXODN/409-680        AC H6BKY6.1
#=GS M7UQZ1_BOTF1/22-860         AC M7UQZ1.1
#=GS A0A0D1Y6N7_9EURO/444-708    AC A0A0D1Y6N7.1
#=GS A0A4S2MV06_9PEZI/252-825    AC A0A4S2MV06.1
#=GS A0A2P5I0W3_9PEZI/15-923     AC A0A2P5I0W3.1
#=GS A0A2C5Y623_9HYPO/65-903     AC A0A2C5Y623.1
#=GS MED5_CANGA/1-1094           AC Q6FV36.1
#=GS A0A167KPU6_METRR/32-964     AC A0A167KPU6.1
#=GS A0A1E4RN83_9ASCO/1-934      AC A0A1E4RN83.1
#=GS X0D090_FUSOX/13-927         AC X0D090.1
#=GS MED5_KLULA/1-1062           AC Q6CNY5.1
#=GS F8PGS0_SERL3/574-722        AC F8PGS0.1
#=GS G2Q887_MYCTT/50-1019        AC G2Q887.1
#=GS A0A5C3QX17_9AGAR/473-720    AC A0A5C3QX17.1
#=GS A0A3M6XMZ3_HORWE/439-615    AC A0A3M6XMZ3.1
#=GS H0EY00_GLAL7/199-373        AC H0EY00.1
#=GS A0A317WIG9_9EURO/2-946      AC A0A317WIG9.1
#=GS A0A2T0FHF9_9ASCO/189-629    AC A0A2T0FHF9.1
#=GS A0A1B7NC13_9AGAM/555-701    AC A0A1B7NC13.1
#=GS A0A1A0H1P7_9ASCO/1-631      AC A0A1A0H1P7.1
#=GS A0A428U9J1_9HYPO/14-952     AC A0A428U9J1.1
#=GS A0A0U5FSV3_9EURO/289-961    AC A0A0U5FSV3.1
#=GS A0A1E3IPX5_9TREE/499-707    AC A0A1E3IPX5.1
#=GS A0A094CMN5_9PEZI/132-758    AC A0A094CMN5.1
#=GS A0A1C7MR29_GRIFR/470-741    AC A0A1C7MR29.1
#=GS A0A421JUH3_9ASCO/370-726    AC A0A421JUH3.1
#=GS A0A0D2GP52_9EURO/69-369     AC A0A0D2GP52.1
#=GS A0A443I005_BYSSP/3-982      AC A0A443I005.1
#=GS A0A1J9R6I2_9PEZI/9-907      AC A0A1J9R6I2.1
#=GS A0A2T4CDX9_TRILO/15-978     AC A0A2T4CDX9.1
#=GS A0A319CXX0_9EURO/2-946      AC A0A319CXX0.1
#=GS A0A167D9E0_9ASCO/649-847    AC A0A167D9E0.1
#=GS Q2HB43_CHAGB/241-425        AC Q2HB43.1
#=GS A0A4R0R5V9_9APHY/1623-1900  AC A0A4R0R5V9.1
#=GS A0A1V6UCQ8_9EURO/8-487      AC A0A1V6UCQ8.1
#=GS J4UJ97_BEAB2/14-962         AC J4UJ97.1
#=GS A0A1A5ZTV0_9TREE/588-750    AC A0A1A5ZTV0.1
#=GS A0A1B9HZ55_9TREE/591-841    AC A0A1B9HZ55.1
#=GS B8LUB6_TALSN/2-1029         AC B8LUB6.1
#=GS A0A5C3EWK5_9BASI/517-825    AC A0A5C3EWK5.1
#=GS A0A168H770_CORDF/14-953     AC A0A168H770.1
#=GS A0A0D1Y6N7_9EURO/92-369     AC A0A0D1Y6N7.1
#=GS A0A423WHK2_9PEZI/57-1002    AC A0A423WHK2.1
#=GS A0A317XNT7_9BASI/581-850    AC A0A317XNT7.1
#=GS A0A1Y1UM03_9TREE/574-700    AC A0A1Y1UM03.1
#=GS A0A3N4JKV3_9PEZI/221-857    AC A0A3N4JKV3.1
#=GS A0A117DX34_ASPNG/2-984      AC A0A117DX34.1
#=GS A0A3M2TCB5_9EURO/2-947      AC A0A3M2TCB5.1
#=GS A0A4P6XP58_9ASCO/173-972    AC A0A4P6XP58.1
#=GS A0A395RZ90_FUSSP/15-955     AC A0A395RZ90.1
#=GS A0A2T3B2R4_AMORE/294-961    AC A0A2T3B2R4.1
#=GS A0A1B8DFP2_9PEZI/21-756     AC A0A1B8DFP2.1
#=GS A0A1L9UIC4_ASPBC/2-987      AC A0A1L9UIC4.1
#=GS A0A0A2VHG7_BEABA/718-925    AC A0A0A2VHG7.1
#=GS G8BG32_CANPC/302-608        AC G8BG32.1
#=GS A2QHS8_ASPNC/2-631          AC A2QHS8.1
#=GS S0DSP8_GIBF5/35-887         AC S0DSP8.1
#=GS A0A0D7AH31_9AGAR/408-666    AC A0A0D7AH31.1
#=GS A0A2J6QSN4_9HELO/11-956     AC A0A2J6QSN4.1
#=GS A0A0G4MNN8_9PEZI/14-840     AC A0A0G4MNN8.1
#=GS A0A074RVP2_9AGAM/473-688    AC A0A074RVP2.1
#=GS A0A225ACE7_9EURO/2-294      AC A0A225ACE7.1
#=GS A0A448YRQ4_BRENA/339-741    AC A0A448YRQ4.1
#=GS G7E9R4_MIXOS/485-595        AC G7E9R4.1
#=GS A0A2P5A128_9HYPO/13-897     AC A0A2P5A128.1
#=GS W4KNM5_HETIT/535-692        AC W4KNM5.1
#=GS A0A1V6Q811_9EURO/8-1007     AC A0A1V6Q811.1
#=GS A0A5Q4C4B2_9PEZI/49-956     AC A0A5Q4C4B2.1
#=GS MED5_USTMA/578-854          AC Q4PAB8.1
#=GS A0A1E4TBI0_9ASCO/354-732    AC A0A1E4TBI0.1
#=GS A0A2H0ZW05_CANAR/172-1003   AC A0A2H0ZW05.1
#=GS A0A3G2S799_9BASI/462-763    AC A0A3G2S799.1
#=GS A0A4Q7JQW5_METCM/13-947     AC A0A4Q7JQW5.1
#=GS A0A084FXD0_PSEDA/281-968    AC A0A084FXD0.1
#=GS A0A427XNZ1_9TREE/572-719    AC A0A427XNZ1.1
#=GS A0A0C3E374_9AGAM/558-730    AC A0A0C3E374.1
#=GS W9W8D9_9EURO/380-707        AC W9W8D9.1
#=GS A0A094H9C9_9PEZI/22-757     AC A0A094H9C9.1
#=GS A0A4U0TXJ4_9PEZI/257-860    AC A0A4U0TXJ4.1
#=GS A0A2J6TNR1_9HELO/25-958     AC A0A2J6TNR1.1
#=GS A0A4U0WBH9_9PEZI/548-746    AC A0A4U0WBH9.1
#=GS A0A1E1LQH8_9HELO/59-960     AC A0A1E1LQH8.1
#=GS A0A5B0RDQ2_PUCGR/108-413    AC A0A5B0RDQ2.1
#=GS A0A0A2VHG7_BEABA/14-722     AC A0A0A2VHG7.1
#=GS A0A4U0VGJ6_9PEZI/270-940    AC A0A4U0VGJ6.1
#=GS A0A1B8EV06_9PEZI/22-757     AC A0A1B8EV06.1
#=GS A0A316URE4_9BASI/564-662    AC A0A316URE4.1
#=GS G3JCY3_CORMM/485-909        AC G3JCY3.1
#=GS A0A2H3IVN7_WOLCO/479-732    AC A0A2H3IVN7.1
#=GS A0A2J6PQP3_9HELO/25-959     AC A0A2J6PQP3.1
#=GS W9WJK5_9EURO/445-708        AC W9WJK5.1
#=GS A0A5N6YXG2_9EURO/2-967      AC A0A5N6YXG2.1
#=GS A0A0C4F777_PUCT1/6-155      AC A0A0C4F777.1
#=GS A0A180GP09_PUCT1/455-589    AC A0A180GP09.1
#=GS A0A545VBL2_9HYPO/18-975     AC A0A545VBL2.1
#=GS A0A3M7LV32_9PLEO/246-1224   AC A0A3M7LV32.1
#=GS S7ZKI7_PENO1/5-953          AC S7ZKI7.1
#=GS A0A165CWQ1_9BASI/634-769    AC A0A165CWQ1.1
#=GS G3YA07_ASPNA/2-985          AC G3YA07.1
#=GS A0A2H3C2I6_9AGAR/446-694    AC A0A2H3C2I6.1
#=GS A0A1Y2W8S8_9PEZI/309-998    AC A0A1Y2W8S8.1
#=GS A0A2I2GNC4_9EURO/2-966      AC A0A2I2GNC4.1
#=GS A0A1R3RTF0_ASPC5/2-945      AC A0A1R3RTF0.1
#=GS L8FUP4_PSED2/57-761         AC L8FUP4.1
#=GS A0A1E4T1X3_9ASCO/386-835    AC A0A1E4T1X3.1
#=GS A0A2C6A4A7_9HYPO/41-952     AC A0A2C6A4A7.1
#=GS A0A2T3A1P9_9PEZI/240-1004   AC A0A2T3A1P9.1
#=GS A0A4V3XC21_9AGAM/454-705    AC A0A4V3XC21.1
#=GS A0A1Y2AUX0_9TREE/616-732    AC A0A1Y2AUX0.1
#=GS A0A5C2SPC3_9APHY/558-693    AC A0A5C2SPC3.1
#=GS A0A2N6NKW8_BEABA/524-882    AC A0A2N6NKW8.1
#=GS A0A167V6B5_9AGAM/454-575    AC A0A167V6B5.1
#=GS A0A2A9PH30_9HYPO/99-853     AC A0A2A9PH30.1
#=GS A0A5J5EGD5_9PEZI/270-829    AC A0A5J5EGD5.1
#=GS A0A2B7YPD5_9EURO/10-954     AC A0A2B7YPD5.1
#=GS M3J8T6_CANMX/362-668        AC M3J8T6.1
#=GS A0A423WRF5_9PEZI/57-536     AC A0A423WRF5.1
#=GS F0U503_AJEC8/477-941        AC F0U503.1
#=GS A0A395I9N3_ASPHC/2-946      AC A0A395I9N3.1
#=GS E3KAK2_PUCGT/425-725        AC E3KAK2.1
#=GS I2H078_TETBL/1113-1262      AC I2H078.1
#=GS A0A0D2A9N5_9EURO/433-702    AC A0A0D2A9N5.1
#=GS A0A163K4D3_ABSGL/675-1044   AC A0A163K4D3.1
#=GS A0A0K6G6W4_9AGAM/426-704    AC A0A0K6G6W4.1
#=GS H1UX95_COLHI/50-957         AC H1UX95.1
#=GS A0A423VEZ0_9PEZI/56-1003    AC A0A423VEZ0.1
#=GS A0A2N3NE69_9PEZI/21-969     AC A0A2N3NE69.1
#=GS A0A3F2Y4K9_DEKBR/122-717    AC A0A3F2Y4K9.1
#=GS A0A395T478_9HYPO/499-950    AC A0A395T478.1
#=GS A0A067MZ61_9AGAM/559-697    AC A0A067MZ61.1
#=GS A0A3M7MQ16_9EURO/1011-1241  AC A0A3M7MQ16.1
#=GS B2W0U4_PYRTR/1-996          AC B2W0U4.1
#=GS A0A4U0XED2_9PEZI/254-868    AC A0A4U0XED2.1
#=GS Q7S824_NEUCR/50-1029        AC Q7S824.2
#=GS A0A0B2WL20_METAS/39-955     AC A0A0B2WL20.1
#=GS A0A2H3E418_ARMGA/449-694    AC A0A2H3E418.1
#=GS A0A1J9PQD4_9EURO/9-983      AC A0A1J9PQD4.1
#=GS W9C7L9_SCLBF/27-959         AC W9C7L9.1
#=GS A0A284RA81_ARMOS/399-644    AC A0A284RA81.1
#=GS A0A066XYH0_COLSU/50-969     AC A0A066XYH0.1
#=GS A0A0F4Z6U7_TALEM/3-301      AC A0A0F4Z6U7.1
#=GS A0A1V8SII1_9PEZI/265-748    AC A0A1V8SII1.1
#=GS A0A165T053_9APHY/441-708    AC A0A165T053.1
#=GS E9EEZ5_METAQ/305-920        AC E9EEZ5.1
#=GS A0A0D2BFX2_9EURO/432-705    AC A0A0D2BFX2.1
#=GS A0A1V6NRY9_9EURO/8-986      AC A0A1V6NRY9.1
#=GS A0A166U4S9_9AGAM/587-719    AC A0A166U4S9.1
#=GS A0A1G4MDC0_LACFM/3-1075     AC A0A1G4MDC0.1
#=GS MED5_YARLI/249-976          AC Q6C8D1.2
#=GS A0A2V1EE58_9PLEO/27-961     AC A0A2V1EE58.1
#=GS M2LSJ7_BAUPA/5-592          AC M2LSJ7.1
#=GS A0A1E5RN68_9ASCO/6-1194     AC A0A1E5RN68.1
#=GS C1H0Q3_PARBA/12-967         AC C1H0Q3.2
#=GS L8WXV6_THACA/503-745        AC L8WXV6.1
#=GS K1WVH9_TRIAC/544-675        AC K1WVH9.1
#=GS A0A2I1C683_9EURO/9-969      AC A0A2I1C683.1
#=GS A0A1E3BN12_9EURO/11-1001    AC A0A1E3BN12.1
#=GS K5WAA6_AGABU/394-615        AC K5WAA6.1
#=GS A0A2B7Y4H7_9EURO/9-973      AC A0A2B7Y4H7.1
#=GS G8YFP0_PICSO/4-976          AC G8YFP0.1
#=GS K1XYM0_MARBU/273-918        AC K1XYM0.1
#=GS A0A063C361_USTVR/16-945     AC A0A063C361.1
#=GS T5A6W9_OPHSC/16-583         AC T5A6W9.1
#=GS A0A0D2CKT4_9EURO/437-715    AC A0A0D2CKT4.1
#=GS A0A317SWX8_9PEZI/222-844    AC A0A317SWX8.1
#=GS A0A0C3PWN3_PHLGI/364-539    AC A0A0C3PWN3.1
#=GS A0A428P1U2_9HYPO/14-952     AC A0A428P1U2.1
#=GS A0A0C9Y9M5_9AGAR/478-733    AC A0A0C9Y9M5.1
#=GS A5D9W0_PICGU/2-661          AC A5D9W0.2
#=GS A0A0F7ZPI6_9HYPO/23-926     AC A0A0F7ZPI6.1
#=GS G4MZ09_MAGO7/245-970        AC G4MZ09.1
#=GS A0A0C9ZGY6_9AGAM/521-720    AC A0A0C9ZGY6.1
#=GS A0A0P7B5H3_9HYPO/50-978     AC A0A0P7B5H3.1
#=GS A0A2S4KT38_9HYPO/14-915     AC A0A2S4KT38.1
#=GS A0A1L9SC49_9EURO/3-988      AC A0A1L9SC49.1
#=GS A0A367KRT9_RHIST/516-853    AC A0A367KRT9.1
#=GS A0A2P7YJV8_9ASCO/178-868    AC A0A2P7YJV8.1
#=GS A0A425BJH9_9PEZI/1-566      AC A0A425BJH9.1
#=GS A0A1F5LB47_9EURO/8-996      AC A0A1F5LB47.1
#=GS A0A5C5FXS8_9BASI/447-705    AC A0A5C5FXS8.1
#=GS A0A1S7HMW8_9SACH/1-1078     AC A0A1S7HMW8.1
#=GS A0A1D8PSV9_CANAL/407-787    AC A0A1D8PSV9.1
#=GS S8FRS0_FOMPI/437-717        AC S8FRS0.1
#=GS N1RHN3_FUSC4/480-902        AC N1RHN3.1
#=GS V2Y868_MONRO/459-692        AC V2Y868.1
#=GS A0A5N5LSJ8_9PEZI/46-996     AC A0A5N5LSJ8.1
#=GS A0A0G4MNN8_9PEZI/826-1182   AC A0A0G4MNN8.1
#=GS A0A177DF16_ALTAL/3-983      AC A0A177DF16.1
#=GS A0A5N6L6C5_9ROSI/318-915    AC A0A5N6L6C5.1
#=GS A0A1V8V7V6_9PEZI/265-731    AC A0A1V8V7V6.1
#=GS A0A401G7R1_9APHY/463-711    AC A0A401G7R1.1
#=GS A0A0C3DW28_9PEZI/301-928    AC A0A0C3DW28.1
#=GS A0A420Y3N7_9PEZI/304-978    AC A0A420Y3N7.1
#=GS A0A376B2G5_9ASCO/6-1236     AC A0A376B2G5.1
#=GS A0A0N1I1V2_9EURO/376-658    AC A0A0N1I1V2.1
#=GS M7ST26_EUTLA/3-266          AC M7ST26.1
#=GS A0A1Q3ELF0_LENED/513-649    AC A0A1Q3ELF0.1
#=GS A0A165J6S2_XYLHT/2-896      AC A0A165J6S2.1
#=GS A0A420HRG4_9PEZI/6-974      AC A0A420HRG4.1
#=GS A0A167Z3F6_9PEZI/344-934    AC A0A167Z3F6.1
#=GS D5G4B0_TUBMM/73-858         AC D5G4B0.1
#=GS A0A319EYZ4_ASPSB/2-942      AC A0A319EYZ4.1
#=GS A0A0D2PEH2_HYPSF/955-1105   AC A0A0D2PEH2.1
#=GS A0A369KC30_HYPMA/525-697    AC A0A369KC30.1
#=GS A0A0C3G3R9_PILCF/547-675    AC A0A0C3G3R9.1
#=GS E3RQR4_PYRTT/2-981          AC E3RQR4.1
#=GS A0A1V6YXH2_PENNA/483-981    AC A0A1V6YXH2.1
#=GS A0A059JI44_TRIIM/11-1001    AC A0A059JI44.1
#=GS A0A0D2HJH2_9EURO/441-714    AC A0A0D2HJH2.1
#=GS A0A084QAD0_STAC4/51-897     AC A0A084QAD0.1
#=GS A0A177CIU6_9PLEO/3-976      AC A0A177CIU6.1
#=GS G3AHL3_SPAPN/324-727        AC G3AHL3.1
#=GS S3CYP2_GLAL2/44-499         AC S3CYP2.1
#=GS W9Y990_9EURO/448-709        AC W9Y990.1
#=GS A0A1V8V431_9PEZI/267-746    AC A0A1V8V431.1
#=GS A0A4Q2DSK2_9AGAR/648-865    AC A0A4Q2DSK2.1
#=GS A0A364N5N2_9PLEO/226-1206   AC A0A364N5N2.1
#=GS G2QSD1_THETT/14-971         AC G2QSD1.1
#=GS C5M3A0_CANTT/762-955        AC C5M3A0.1
#=GS A0A179FDW6_METCM/13-947     AC A0A179FDW6.1
#=GS A0A1E3Q4G2_LIPST/1-443      AC A0A1E3Q4G2.1
#=GS A0A2S5BHV3_9BASI/397-580    AC A0A2S5BHV3.1
#=GS A0A316W7E3_9BASI/292-562    AC A0A316W7E3.1
#=GS F0XLY3_GROCL/364-1011       AC F0XLY3.1
#=GS A0A2N5W897_9BASI/455-785    AC A0A2N5W897.1
#=GS C5G892_AJEDR/9-982          AC C5G892.2
#=GS A0A2X0N6D1_9BASI/434-733    AC A0A2X0N6D1.1
#=GS A0A086TKQ0_9FUNG/190-415    AC A0A086TKQ0.1
#=GS A0A0G2EP89_9EURO/228-662    AC A0A0G2EP89.1
#=GS A0A4U0UNZ7_9PEZI/260-734    AC A0A4U0UNZ7.1
#=GS A0A0U5FSV3_9EURO/11-299     AC A0A0U5FSV3.1
#=GS A0A0C9UAG9_SPHS4/544-734    AC A0A0C9UAG9.1
#=GS A0A2I0S0Y4_9PEZI/77-978     AC A0A2I0S0Y4.1
#=GS A0A5N6SQQ9_ASPPS/2-967      AC A0A5N6SQQ9.1
#=GS U5HAQ2_USTV1/373-672        AC U5HAQ2.1
#=GS A0A1X7S830_ZYMTR/245-827    AC A0A1X7S830.1
#=GS G0RV32_HYPJQ/14-985         AC G0RV32.1
#=GS V6RGU1_GIBZE/16-915         AC V6RGU1.1
#=GS A0A5B1QG04_9AGAM/571-692    AC A0A5B1QG04.1
#=GS A0A1Q5T6Z1_9EURO/6-969      AC A0A1Q5T6Z1.1
#=GS A0A081CGL1_PSEA2/552-882    AC A0A081CGL1.1
#=GS A0A4Q9P643_9APHY/473-706    AC A0A4Q9P643.1
#=GS W1Q7W2_OGAPD/356-667        AC W1Q7W2.1
#=GS A0A139HWT5_9PEZI/266-849    AC A0A139HWT5.1
#=GS A0A5N7D023_9EURO/2-967      AC A0A5N7D023.1
#=GS A0A0J8QIU7_COCIT/10-942     AC A0A0J8QIU7.1
#=GS W3X4L7_PESFW/51-1005        AC W3X4L7.1
#=GS A0A167V6B5_9AGAM/769-864    AC A0A167V6B5.1
#=GS A0A383V3E3_BLUGH/5-958      AC A0A383V3E3.1
#=GS A0A427YW01_9TREE/587-724    AC A0A427YW01.1
#=GS A0A286US70_9AGAM/474-714    AC A0A286US70.1
#=GS A0A1L9S225_ASPWE/1-943      AC A0A1L9S225.1
#=GS A0A316YIZ3_9BASI/388-711    AC A0A316YIZ3.1
#=GS W9YVG5_9EURO/443-702        AC W9YVG5.1
#=GS J3NGT2_GAET3/252-1052       AC J3NGT2.1
#=GS A0A175W648_9PEZI/45-929     AC A0A175W648.1
#=GS A0A395T478_9HYPO/14-529     AC A0A395T478.1
#=GS A0A1S7HBA6_9SACH/1-1078     AC A0A1S7HBA6.1
#=GS A0A2V5HEW5_9EURO/2-973      AC A0A2V5HEW5.1
#=GS I2H078_TETBL/9-1133         AC I2H078.1
#=GS W9IWZ9_FUSOX/13-931         AC W9IWZ9.1
#=GS A0A0L6V2N7_9BASI/325-706    AC A0A0L6V2N7.1
#=GS A0A1B9G773_9TREE/573-688    AC A0A1B9G773.1
#=GS A0A1Y2GK36_9FUNG/183-430    AC A0A1Y2GK36.1
#=GS C4Y3S4_CLAL4/2-632          AC C4Y3S4.1
#=GS A0A367YAG3_9ASCO/359-666    AC A0A367YAG3.1
#=GS A0A4Q4X2Q9_9PEZI/343-884    AC A0A4Q4X2Q9.1
#=GS A0A0L1J653_ASPNO/2-967      AC A0A0L1J653.1
#=GS A0A2B7WZX2_9EURO/9-965      AC A0A2B7WZX2.1
#=GS A0A507R037_MONPU/3-1014     AC A0A507R037.1
#=GS V5GCL7_BYSSN/3-984          AC V5GCL7.1
#=GS A0A5M9JSC7_MONFR/744-1085   AC A0A5M9JSC7.1
#=GS A0A2L2SV30_9HYPO/61-1005    AC A0A2L2SV30.1
#=GS A0A3N4KYX4_9PEZI/292-887    AC A0A3N4KYX4.1
#=GS A0A401KXC7_ASPAW/2-977      AC A0A401KXC7.1
#=GS A0A484FX76_COLOR/48-949     AC A0A484FX76.1
#=GS A0A4Y7QM38_9AGAM/577-711    AC A0A4Y7QM38.1
#=GS V5GGV1_KALBG/561-839        AC V5GGV1.1
#=GS A0A3D8QBR8_9EURO/57-455     AC A0A3D8QBR8.1
#=GS A0A3N2Q2G6_9PEZI/50-989     AC A0A3N2Q2G6.1
#=GS A0A093XCE0_9PEZI/21-762     AC A0A093XCE0.1
#=GS C0NIL9_AJECG/10-984         AC C0NIL9.1
#=GS A0A5N6KB32_9HELO/2-837      AC A0A5N6KB32.1
#=GS A0A369H0W5_9HYPO/40-872     AC A0A369H0W5.1
#=GS A0A4P9Z9P0_9ASCO/199-615    AC A0A4P9Z9P0.1
#=GS G0VEW9_NAUCC/1-1081         AC G0VEW9.1
#=GS A0A4Z1ICL5_9HELO/27-960     AC A0A4Z1ICL5.1
#=GS H2AQW5_KAZAF/54-1137        AC H2AQW5.1
#=GS A0A074WPX2_9PEZI/5-571      AC A0A074WPX2.1
#=GS M5FQL4_DACPD/595-717        AC M5FQL4.1
#=GS MED5_ASPCL/2-970            AC A1CGW7.2
#=GS A0A544ZYF0_9PEZI/19-926     AC A0A544ZYF0.1
#=GS A0A232LV26_9EURO/3-478      AC A0A232LV26.1
#=GS A0A1B8ADT0_FUSPO/15-982     AC A0A1B8ADT0.1
#=GS A0A2K1QYD1_9PEZI/138-845    AC A0A2K1QYD1.1
#=GS A0A317XA25_9EURO/2-946      AC A0A317XA25.1
#=GS A0A1E4SKK6_9ASCO/158-952    AC A0A1E4SKK6.1
#=GS A0A1Y2EJV1_9PEZI/33-923     AC A0A1Y2EJV1.1
#=GS A0A1L7XK95_9HELO/23-981     AC A0A1L7XK95.1
#=GS A0A2T2NEV9_CORCC/5-981      AC A0A2T2NEV9.1
#=GS A0A1M8ABL6_MALS4/553-706    AC A0A1M8ABL6.1
#=GS A0A1E3P3P1_WICAA/3-908      AC A0A1E3P3P1.1
#=GS A0A370TCR4_9HELO/51-954     AC A0A370TCR4.1
#=GS A0A0D1ZMB3_EXOME/379-707    AC A0A0D1ZMB3.1
#=GS A0A0C9MU67_9FUNG/633-933    AC A0A0C9MU67.1
#=GS A0A5N7AQA6_9EURO/2-967      AC A0A5N7AQA6.1
#=GS A0A0B7N5K8_9FUNG/584-903    AC A0A0B7N5K8.1
#=GS A0A2A9P1I3_9AGAR/461-713    AC A0A2A9P1I3.1
#=GS A0A439DKH3_9PEZI/62-956     AC A0A439DKH3.1
#=GS Q2HB43_CHAGB/410-583        AC Q2HB43.1
#=GS A0A409XD01_PSICY/451-666    AC A0A409XD01.1
#=GS A0A1L0D427_9ASCO/2-747      AC A0A1L0D427.1
#=GS A0A218ZAC7_9HELO/276-920    AC A0A218ZAC7.1
#=GS A0A4Q4T380_9PEZI/343-863    AC A0A4Q4T380.1
#=GS A0A2X0LX76_9BASI/422-732    AC A0A2X0LX76.1
#=GS R7YMM4_CONA1/108-895        AC R7YMM4.1
#=GS A0A1G4ARV5_9PEZI/50-1001    AC A0A1G4ARV5.1
#=GS A0A0D0ARD8_9AGAM/572-697    AC A0A0D0ARD8.1
#=GS K0KKX0_WICCF/3-928          AC K0KKX0.1
#=GS A0A1Y2UP87_9PEZI/24-1001    AC A0A1Y2UP87.1
#=GS A0A2N6NKW8_BEABA/14-527     AC A0A2N6NKW8.1
#=GS A0A437ADD4_9PEZI/345-933    AC A0A437ADD4.1
#=GS G8YD84_PICSO/4-974          AC G8YD84.1
#=GS F9XP04_ZYMTI/6-587          AC F9XP04.1
#=GS A0A2V1AZ25_9ASCO/174-992    AC A0A2V1AZ25.1
#=GS A0A2T3YSA6_9HYPO/14-897     AC A0A2T3YSA6.1
#=GS A0A1D2VKM2_9ASCO/503-734    AC A0A1D2VKM2.1
#=GS A0A0D2B1I9_9PEZI/3-957      AC A0A0D2B1I9.1
#=GS A0A080WM42_TRIRC/1-465      AC A0A080WM42.1
#=GS A0A0K3CBB3_RHOTO/317-626    AC A0A0K3CBB3.1
#=GS A0A371DHR0_9APHY/573-699    AC A0A371DHR0.1
#=GS A0A0F7U1B0_PENBI/6-970      AC A0A0F7U1B0.1
#=GS A0A225ACE7_9EURO/285-942    AC A0A225ACE7.1
#=GS A0A074WM03_9PEZI/27-647     AC A0A074WM03.1
#=GS A0A0D2GP52_9EURO/416-771    AC A0A0D2GP52.1
#=GS A0A0K8L7I9_9EURO/1-904      AC A0A0K8L7I9.1
#=GS C4R952_KOMPG/350-753        AC C4R952.1
#=GS MED5_DEBHA/5-983            AC Q6BH05.2
#=GS A0A517LLZ6_9PEZI/42-909     AC A0A517LLZ6.1
#=GS A0A4T0W1J7_9PEZI/421-905    AC A0A4T0W1J7.1
#=GS A0A0C3CVJ0_HEBCY/494-728    AC A0A0C3CVJ0.1
#=GS J8LNY2_SACAR/1-1126         AC J8LNY2.1
#=GS A0A2K0W2A2_GIBNY/36-931     AC A0A2K0W2A2.1
#=GS MED5_NEOFI/2-970            AC A1CXW3.2
#=GS A0A2G8SCX8_9APHY/65-198     AC A0A2G8SCX8.1
#=GS A0A165W034_9AGAM/429-722    AC A0A165W034.1
#=GS S8AMI8_DACHA/281-904        AC S8AMI8.1
#=GS A0A165DZB9_9APHY/468-724    AC A0A165DZB9.1
#=GS A0A068RFH9_9FUNG/635-922    AC A0A068RFH9.1
#=GS A0A0F8CXV6_CERFI/127-729    AC A0A0F8CXV6.1
#=GS A0A4T0W1J7_9PEZI/50-396     AC A0A4T0W1J7.1
#=GS A0A319CI49_9EURO/2-973      AC A0A319CI49.1
#=GS A0A194UYH9_9PEZI/57-1009    AC A0A194UYH9.1
#=GS A0A395MER3_9HYPO/373-1362   AC A0A395MER3.1
#=GS G8JRS3_ERECY/3-1093         AC G8JRS3.1
#=GS A0A0D2F2F8_9EURO/443-708    AC A0A0D2F2F8.1
#=GS A0A0J0XIR4_9TREE/506-693    AC A0A0J0XIR4.1
#=GS G0SZ86_RHOT2/372-677        AC G0SZ86.1
#=GS A0A1Y1Y4E8_9PLEO/5-973      AC A0A1Y1Y4E8.1
#=GS MED5_PICST/2-976            AC A3M022.2
#=GS A0A6V8HCC9_9EURO/2-990      AC A0A6V8HCC9.1
#=GS A0A136J7F0_9PEZI/36-887     AC A0A136J7F0.1
#=GS A0A197JFY4_9FUNG/196-421    AC A0A197JFY4.1
#=GS W7HP71_9PEZI/34-395         AC W7HP71.1
#=GS D4AZS7_ARTBC/1-304          AC D4AZS7.1
#=GS Q5KF61_CRYNJ/585-700        AC Q5KF61.2
#=GS A0A1Y2IUI1_PYCCO/468-705    AC A0A1Y2IUI1.1
#=GS A0A162ZM05_DIDRA/3-978      AC A0A162ZM05.1
#=GS G8ZYY8_TORDC/1-1072         AC G8ZYY8.1
#=GS F0U503_AJEC8/9-480          AC F0U503.1
#=GS A0A4S8MPS5_DENBC/451-697    AC A0A4S8MPS5.1
#=GS A0A1V6QU48_9EURO/6-984      AC A0A1V6QU48.1
#=GS A0A238FQ96_9BASI/460-769    AC A0A238FQ96.1
#=GS C5M3A0_CANTT/395-731        AC C5M3A0.1
#=GS F9G7R4_FUSOF/254-668        AC F9G7R4.1
#=GS A0A0G4NXS6_PENCA/8-986      AC A0A0G4NXS6.1
#=GS MED5_YEAST/1-1127           AC P53114.1
#=GS A0A0M8MM61_9BASI/590-725    AC A0A0M8MM61.1
#=GS A0A0A2JCS0_PENEN/5-969      AC A0A0A2JCS0.1
#=GS A0A1E3PEJ0_9ASCO/161-727    AC A0A1E3PEJ0.1
#=GS A5E0V5_LODEL/339-644        AC A5E0V5.1
#=GS A7TJI2_VANPO/1-1073         AC A7TJI2.1
#=GS A0A1V8SUN1_9PEZI/267-743    AC A0A1V8SUN1.1
#=GS E9D102_COCPS/10-973         AC E9D102.1
#=GS A0A1L9T129_9EURO/14-1016    AC A0A1L9T129.1
#=GS A0A2T4A667_TRIHA/15-902     AC A0A2T4A667.1
#=GS A0A3N4M0S8_9PEZI/271-916    AC A0A3N4M0S8.1
#=GS A0A1J9RJ07_9EURO/9-972      AC A0A1J9RJ07.1
#=GS E3QB97_COLGM/49-977         AC E3QB97.1
#=GS A0A2S7PCZ6_9HELO/28-977     AC A0A2S7PCZ6.1
#=GS A0A2H3IJX2_9EURO/1-879      AC A0A2H3IJX2.1
#=GS A6R7P5_AJECN/70-497         AC A6R7P5.1
#=GS W2RRD9_9EURO/406-653        AC W2RRD9.1
#=GS A0A420PD24_FUSOX/13-927     AC A0A420PD24.1
#=GS A0A5C3LCZ3_9AGAR/365-691    AC A0A5C3LCZ3.1
#=GS A0A5C3E2D8_9BASI/550-884    AC A0A5C3E2D8.1
#=GS W7MJH6_GIBM7/35-696         AC W7MJH6.1
#=GS A0A5N6ZZ06_9EURO/2-967      AC A0A5N6ZZ06.1
#=GS G9MEF5_HYPVG/16-938         AC G9MEF5.1
#=GS A0A0P1BRG7_9BASI/260-557    AC A0A0P1BRG7.1
#=GS A0A0F9WXS2_TRIHA/15-902     AC A0A0F9WXS2.1
#=GS M3DEF5_SPHMS/6-469          AC M3DEF5.1
#=GS M2TI34_COCSN/3-983          AC M2TI34.1
#=GS A0A1V6YXH2_PENNA/8-489      AC A0A1V6YXH2.1
#=GS A0A0H1BBL6_9EURO/9-949      AC A0A0H1BBL6.1
#=GS A0A316UCQ6_9BASI/123-232    AC A0A316UCQ6.1
#=GS G2XDU2_VERDV/48-865         AC G2XDU2.1
#=GS C9S8B9_VERA1/49-955         AC C9S8B9.1
#=GS A0A5N6D1E5_ASPPA/2-967      AC A0A5N6D1E5.1
#=GS A0A316ZG55_9BASI/527-838    AC A0A316ZG55.1
#=GS A0A2H3HJH7_FUSOX/13-927     AC A0A2H3HJH7.1
#=GS N1JGR6_BLUG1/60-935         AC N1JGR6.1
#=GS W7M8I4_GIBM7/32-931         AC W7M8I4.1
#=GS A0A559M0U4_9HELO/325-929    AC A0A559M0U4.1
#=GS A0A178ZTZ5_9EURO/278-485    AC A0A178ZTZ5.1
#=GS A0A1B9GK32_9TREE/583-708    AC A0A1B9GK32.1
#=GS A0A1W2TLE6_ROSNE/70-960     AC A0A1W2TLE6.1
#=GS A0A0C3PJ86_PISTI/539-718    AC A0A0C3PJ86.1
#=GS A0A0D2XC79_FUSO4/314-415    AC A0A0D2XC79.1
#=GS E5R4W7_LEPMJ/3-999          AC E5R4W7.1
#=GS S2JIY8_MUCC1/596-919        AC S2JIY8.1
#=GS A0A4R8R632_COLTR/303-935    AC A0A4R8R632.1
#=GS A0A5N6THC8_9EURO/2-967      AC A0A5N6THC8.1
#=GS G0SGD2_CHATD/52-526         AC G0SGD2.1
#=GS A0A4Q4XZ02_9PEZI/74-926     AC A0A4Q4XZ02.1
#=GS A0A1G4JEQ4_9SACH/3-1032     AC A0A1G4JEQ4.1
#=GS A0A4Q4TY84_9PEZI/303-839    AC A0A4Q4TY84.1
#=GS A0A4Z0Y7U6_9PEZI/22-961     AC A0A4Z0Y7U6.1
#=GS A0A1L9MWW8_ASPTC/2-985      AC A0A1L9MWW8.1
#=GS M3B4R4_PSEFD/57-632         AC M3B4R4.1
#=GS A0A1V1SVV3_9FUNG/25-961     AC A0A1V1SVV3.1
#=GS MED5_ASPOR/2-967            AC Q2UG94.2
#=GS A0A094HHZ7_9PEZI/38-757     AC A0A094HHZ7.1
#=GS A0A5N6UPQ4_9EURO/2-967      AC A0A5N6UPQ4.1
#=GS M2VA16_COCH5/3-983          AC M2VA16.1
#=GS G8BVJ9_TETPH/1-1081         AC G8BVJ9.1
#=GS A0A1S8B6T4_9PEZI/272-888    AC A0A1S8B6T4.1
#=GS A0A0A1TBP7_9HYPO/11-908     AC A0A0A1TBP7.1
#=GS A0A5N5DN11_9PEZI/3-890      AC A0A5N5DN11.1
#=GS A0A5B0PWV5_PUCGR/131-254    AC A0A5B0PWV5.1
#=GS A0A074Y2C4_AURSE/203-983    AC A0A074Y2C4.1
#=GS A0A162I027_9EURO/26-948     AC A0A162I027.1
#=GS N1RHN3_FUSC4/13-506         AC N1RHN3.1
#=GS A0A409VBL9_9AGAR/567-714    AC A0A409VBL9.1
#=GS A0A2S4Q1F9_9PEZI/8-572      AC A0A2S4Q1F9.1
#=GS A0A4Q4VSV1_9PEZI/345-862    AC A0A4Q4VSV1.1
#=GS R0J677_SETT2/3-984          AC R0J677.1
#=GS A0A0U1LQ80_TALIS/4-941      AC A0A0U1LQ80.1
#=GS A0A094AWR7_9PEZI/22-775     AC A0A094AWR7.1
#=GS A0A1V6UCQ8_9EURO/482-975    AC A0A1V6UCQ8.1
#=GS A0A2S7QB18_9HELO/29-942     AC A0A2S7QB18.1
#=GS A0A0N8Q040_RHOGW/144-446    AC A0A0N8Q040.1
#=GS MED5_ASPFU/2-968            AC Q4WNQ6.2
#=GS A0A1U7LTD0_NEOID/376-678    AC A0A1U7LTD0.1
#=GS E5R3Y4_ARTGP/11-1007        AC E5R3Y4.1
#=GS A0A0F0IH61_ASPPU/2-967      AC A0A0F0IH61.1
#=GS A0A545AB75_9PEZI/60-961     AC A0A545AB75.1
#=GS T5A6W9_OPHSC/581-936        AC T5A6W9.1
#=GS A0A2K3Q9M5_9HYPO/84-985     AC A0A2K3Q9M5.1
#=GS A0A3M6XMZ3_HORWE/66-449     AC A0A3M6XMZ3.1
#=GS A0A178DV15_9PLEO/4-983      AC A0A178DV15.1
#=GS A0A093Z4A9_9PEZI/280-751    AC A0A093Z4A9.1
#=GS A0A166LZW3_9AGAM/532-698    AC A0A166LZW3.1
#=GS A0A421DGF0_9EURO/9-977      AC A0A421DGF0.1
#=GS A0A1X2GBX7_9FUNG/689-973    AC A0A1X2GBX7.1
#=GS A0A194XHL8_9HELO/14-966     AC A0A194XHL8.1
#=GS W6Y4G9_COCCA/4-983          AC W6Y4G9.1
#=GS A0A0F8X380_9EURO/2-970      AC A0A0F8X380.1
#=GS A0A1B8C9Q3_9PEZI/22-757     AC A0A1B8C9Q3.1
#=GS A0A5C3E305_9BASI/541-874    AC A0A5C3E305.1
#=GS A0A395NXW1_TRIAR/316-872    AC A0A395NXW1.1
#=GS A0A1A0H1W4_9ASCO/1-306      AC A0A1A0H1W4.1
#=GS A0A2V1BTW7_9HELO/59-968     AC A0A2V1BTW7.1
#=GS A0A1J7IQG9_9PEZI/40-957     AC A0A1J7IQG9.1
#=GS M2RCP5_CERS8/582-728        AC M2RCP5.1
#=GS A0A4V1X9K8_9PEZI/345-899    AC A0A4V1X9K8.1
#=GS A0A1X7R1A8_9SACH/5-1096     AC A0A1X7R1A8.1
#=GS A0A067TRX7_GALM3/431-699    AC A0A067TRX7.1
#=GS A0A072NWY0_9EURO/4-366      AC A0A072NWY0.1
#=GS K9GY11_PEND2/1-963          AC K9GY11.1
#=GS A0A3M2RFH4_9HYPO/14-918     AC A0A3M2RFH4.1
#=GS A0A423WRF5_9PEZI/522-960    AC A0A423WRF5.1
#=GS A0A161WFX7_9PEZI/50-985     AC A0A161WFX7.1
#=GS A0A5N6GD22_PETAA/2-966      AC A0A5N6GD22.1
#=GS A0A0C2XMG0_AMAMU/463-721    AC A0A0C2XMG0.1
#=GS A0A1E3QSH7_9ASCO/620-780    AC A0A1E3QSH7.1
#=GS A0A367YAG3_9ASCO/714-899    AC A0A367YAG3.1
#=GS A0A318ZAW6_9EURO/2-973      AC A0A318ZAW6.1
#=GS A0A0F4Z6U7_TALEM/293-958    AC A0A0F4Z6U7.1
#=GS A0A507AKP3_9PEZI/50-1007    AC A0A507AKP3.1
#=GS A0A3F3Q4R9_9EURO/2-978      AC A0A3F3Q4R9.1
#=GS U1HZ19_ENDPU/107-723        AC U1HZ19.1
#=GS MED5_EMENI/1-998            AC Q5B503.2
#=GS MED5_ASPTN/2-941            AC Q0CL68.2
#=GS A0A4U0WBH9_9PEZI/376-553    AC A0A4U0WBH9.1
#=GS A0A1V6S3S2_9EURO/8-987      AC A0A1V6S3S2.1
#=GS A0A367Y1D9_9ASCO/358-626    AC A0A367Y1D9.1
#=GS A0A0S7DV85_9EURO/192-1062   AC A0A0S7DV85.1
#=GS A0A2C5X4I0_9PEZI/190-925    AC A0A2C5X4I0.1
#=GS A0A1G4JK27_9SACH/8-1081     AC A0A1G4JK27.1
#=GS G3B0D1_CANTC/80-658         AC G3B0D1.1
#=GS A0A179ULB0_BLAGS/9-982      AC A0A179ULB0.1
#=GS I2JW99_DEKBR/1-109          AC I2JW99.1
#=GS A0A4Z1NR75_9PEZI/9-919      AC A0A4Z1NR75.1
#=GS A0A0F4GSC9_9PEZI/269-854    AC A0A0F4GSC9.1
#=GS A0A4Y9ZDH9_9AGAM/478-703    AC A0A4Y9ZDH9.1
#=GS B0CQ67_LACBS/445-697        AC B0CQ67.1
#=GS A0A0M8N2D0_9HYPO/14-431     AC A0A0M8N2D0.1
#=GS MED5_ASHGO/3-1093           AC Q74Z26.1
#=GS A0A0A2KN90_PENIT/500-1470   AC A0A0A2KN90.1
#=GS A0A0M9WJW1_9EURO/5-950      AC A0A0M9WJW1.1
#=GS U5HAQ1_USTV1/433-732        AC U5HAQ1.1
#=GS A0A1E3HE83_9TREE/82-179     AC A0A1E3HE83.1
A0A067QBX1_9AGAM/482-745               ..................................................................................................................................................................................................................rsltftleleglsplarmlylhhesldlislhvpiselvlhaltfledydcetvgdpqtavsllgdvvlflqatlarfhinpntlsakdrvlqldylqssatvy--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..--QAHQLKHEDAT..AFTAWF.KALFd......sSS..E.....GIADTIF......R.STPPKTL..LRLAPTLFSHAIS.....SY...L...D...........Q......KI-....D..........KDV.LFNGVS............Y................F....VGPLLNWT.LVGVIKAL---......VM.EIQ.H.R..G....P.S.....V..HI.-H....--.L.EVL..QT.L.L.....V..S.S..T.C...P..--...........-----K..PVL....SLCGASILRLLGDTKNKH.lHQ....N--GVFDAP.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------tirklalqals.............................................................................................................................................................................................................................................
G7X6H3_ASPKW/2-985                     .........................................................................................................................................................................................................................................................................................................................t-SSEQWGTFLQQCLLHRIDAAEFKNLTRLLMQRYPIG-....................----...........................----------...........--------------.....---...-.....EA...QLLD..VLLETRLa....tgIKW...DPLppLYI....DCLCKMGLVR.....TSTMLNSLLKH.SSIHdklpsaggseata......................................................aaaaavqgkqkrkcYTLM.TDIR.VVQD.AM.L.S.VS..TG.T.ASKT.......................................................--..-..-......-F.AE.AL...SI..F..A..SIVDWIQA..V..V.AWHNSH....Ldtshq...........................tgglmsSPDAV.SL.F.E.SL....GI.......L....LAA.LS...G..T.A.KGLEvlsad...................shealkIKLGQ.A.LSAYL.P.LC.VE.-.---............VSLPL..RNR...LDSL.Qkefnlfgepss...............kaldvsmmenvnVNAL...Q..FEDSvm..........dgPVI.N.SRAGL......---.---....................----..-..--..-..----...YVYINA..MLV.GRPLV.DDSMLLNFLS---NRYG.GHY..........------QVLIEELITASF----.DVL.SNA.NYR.N..E.SS..RTMFLFRS---FLVNKLPTFIA-................AM.LAASivsl................plpmeLCISHALS.....RL.DP-.--..NT..F..P..SFS.QM..F....A..--....MQSN.TV..L--.-.....-...---.-...SD.VRQEFLFACASHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTLP.V.G..GP..Y.N.K.DELVSQINANper..................................aeqLIN......EIESMEGNAGA......-------................---..-----.---.--....-------.IVG...AITDVMH....HLCN..Q.K..ETMTLKNICNS..L.-SR...R...PQ.....ALDVI.LLFRS...L.K.QVLQPLCAL......LD-AW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQP..........VYDE.FGSILLLVLTFKFRYDL...R..P.QD...M...GIG...........GS....---....--NSFVLR..LL.E.NGFC..------.----..SQKLDDLSEKQNK..NLGSWI.NALF........MA..E.....GISEETM......S.ACSPQEF..YMLVTTLFNQSLS.....AC...E...A...........G......KL-....D..........FDT.LKGGFE............Y................L....LEPFLLPS.LILALNWLGNH......IW.ESE.S.D..P....S.I.....P..--.--....--.L.KAL..HS.L.I.....S..P.S..S.I...S..GE...........AKEIHR..TVL....NITARSLEEQLKSIRARQ..PD....D--------.----..-----.-...----.....-......--.....-T.IK.P.IL.EALE.PH...L.S.F...............Q.R............S...GS.TR.rSE..L.--E.......SW.T.AH...T..........P...G..G....LLASIRSTFQSLi....lWS.TSPDms............mapQSYT..HR..Q.FIAGI..HIQG...SMRV...LCALIDEL.KLQATT--....---.-SP..TNT...T.....GSSDLALDIA.ATMICAPL.AD.S...F..A...V.DQ.N...TySPHHHIDPTN.........T......TKEIP..PRNPILTPR.....................................GALYQLHDSVPkICEKDPLRAEIivr......................lwrrVNAALTPPSQLD..................--MNN......-..-.....------II---..-----.-----......----.----.-.-..--.----------------------qnmqlgvgvggpgqmdldtsgaggheeestinqmldnav.................................................................................................................................................................................................................
A0A4Z1KET4_9HELO/28-956                ..........................................................................................................................................................................................................................tdyirilysrnplpspyiceiflrphkhndihvdprvlryvqillaegfidcagilrvllrysslwsfmqdghmhseanngadktkrvkggsrrwk--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................MSYS.AEEM.MLYR.LA.K.T.VS..TG.I.RPKN.......................................................--..-..-......-V.QE.AV...YL..L..V..ICIQWMEM..V..A.TSMGRG....Theil..............................nidaHVEEIgMV.G.M.AL....GT.......L....MVA.VV...G..N.T.KVLGaiq.......................ngtgIDLGK.A.LARFV.P.LL.LQ.S.SP-............---QN..IQR...LDVF.Rtqtlit.........................ilpvdkkE---...-..--RAana........einEIL.D.STIGI......NID.NIAv..................aDLPT..V..NS..-..RAGL...YIYLNS..ILV.GRPLI.DDSAIFAYLH---NRYQ.GDV..........------QSTTVDLILASF----.DVL.ANA.TFR.N..E.GP..QTTTILRS---FLINKVPLLVSTla............tsF-.---Fppl...................tseFCITEALS.....HV.DT-.--..NA..F..P..TLS.TL..F....A..ES....--TN.ND..MFS.D.....S...---.-...--.VRQDFCFACCLHGLIP.ESSIETLLGD.IPM--.--..--.-.--QSLP.A.G..GR..Y.S.K.QDLVQQCLSNser..................................aegLIS......ELDNMDGNAGA......-------................---..-----.---.--....-------.VSQ...AIAEVIK....HMCG..N.K..ETMTLKTLCSQ..L.-AR...N...PS.....SLDIM.LLFNK...P.T.SFLQPICEL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLVVSFAHRYNL...S..T.VD...L...GIK...........NP....---....-AESFVAK..LL.V.HGHL..------.----..SRALDPLSQQDQN..HLDGWI.RGLFe......pEG..G.....GLGDELM......S.SCPPQEF..YLLVPTLFHHIVL.....AL...S...T...........E......TL-....S..........EEG.LKGGLE............F................M....VEPFLLPS.LIPAITWLSAH......LW.EAR.P.Q..A....T.-.....-..--.--....YV.L.QIL..SA.L.I.....K..S.P.pS.Is.nN..ME...........ASHLLN..AIL....KIIAQNLEQSLRWLQRAE.pHR....H--------.----..-----.-...----.....-......--.....-D.ID.S.IS.KALE.SN...L.G.W...............E.R............K...GA.SK.ySE..L.--E.......VW.T.AT...P..........G...G..G....LAASIKHTIVTLv....qWG.LQCDrnpg........mqimpASYT..HR..Q.LLTGL..KMLG...AKRL...LSTIIEEV.KTQTEA--....---.---..---...-.....GNGSVVLDIA.ISLICAPD.SA.S...-..F...D.SG.S...G.MDIMS-----.........-......GNTPQ..LLQRRLTLR.....................................EALKAEVENMPkVHKTDNFHAET.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------virlyrrveaqsviqqqllpddngmgalnevm........................................................................................................................................................................................................................
W6MY50_9ASCO/362-691                   .....................................................................................................................................................................................................................................................................................................lslvdqmasgsvyqrrnfalm--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-VSHSVH....RFIR..E.K..DSARLHRLLLV..L.STN...L...-S.....VLCQV.VLATG...P.Y.QFVLPLVQF......LE-TW................E......L......D..........K.......Q.......R....N....QD...........Q..dQdqmllfgqeE.....D...D...D....V.N...........FQD..........YYTD.FSCVLLVVFYVFQKFDL...R..L.EM...L...LAH...........SAs..qNAS....ADPTFVFD..FL.K.RSMG..LPQ---.-PAS..RRDLQDPSSNLNK..LVNDWI.NSLFdsdvaasaNG..G.....GISDELI......K.SSSMRDC..FKVIPVVFQEAII.....AH...T...K...........S......FL-....G..........DEP.LMNGLE............Y................F....LQPFLVCT.IVGIFDFVRDR......LW.ELC.D.V..Q....S.G.....E..--.VA....LI.L.KLV..QS.L.V.....A..P.G..TkL...K..GE...........ALYMHI..LVL....ETSSRDLCTSLRP-----..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------yisentairqlvek..........................................................................................................................................................................................................................................
A0A2T6ZUV4_TUBBO/9-855                 ....................................................................................................................hraqtyhslfrkcllkrtpvdtfgeyvsqlllksplpsssicpiilsptvssrvdplhleyiqrlvekdtvslpdvlvallrtssarsavstsaslghgatsgengmstnrealeediftvlatvvreyrpksndfvwaaiqalsdwmevvmavsgagmldepgddvsgmagtmnvgkgrlealaeltiaiggnedvr--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.RILGeggr......................kerkSVFQT.S.LSLFM.Q.YT.QV.Q.NPA...........lAARMD..ALF...RHQP.S......................................QQSP...Q..-QNR..............NLR.N.TKGAE......TID.GMMmgig............dgtdNDGP..I..VW..A..RGGL...FVWLNG..LLA.GRPQV.DDEAVIGYLY---SRYR.NDI..........------NTLLLDFVTAVL----.DVL.SNA.ILR.N..E.AA..STLFLLRS---FLTNKVPILLSR................LS.-PSPmt.....................asYALSQALL.....RT.DAStLA..NP..P..P..SLF.DP..Y....S..HN....TSTN.PD..M--.-.....I...FNT.L...VD.LRQEFLFACALHGVVG.EEDIQGIIGE.LPL--.--..--.-.--GALP.V.A..GK..Y.D.V.GDLMNQCAMDpdr..................................verLLE......EIEGVEGNSGA......-------................---..-----.---.--....-------.VVR...TVVEIMR....NMCE..Q.K..ETMPLRSICSF..L.-AR...K...TS.....SLDVM.LLFVK...P.V.YLLEPLCEL......LD-TW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.FGYILLLVLTLIHRYDI...Q..V.TD...L...TSS...........ST....--P....NTDSFIPQ..LL.S.KGST..SQR---.IENF..E------SSDKHA..QLGGWI.REIF........EG..E.....GISDGLM......S.SCRPQDF..YKLVPTLFMQSVM.....AC...E...R...........G......VL-....D..........IDT.LKEGFA............F................L....LEPFLLPS.LVGGLGWLGNH......LW.ESH.E.D..I....S.I.....P..--.--....--.V.QIL..HS.L.L.....V..P.S..S.I...S..PD...........ASEVHK..TVI....SISARQLERVLRELVRRG..T-....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------agshqnvveglvanlrpytsfkrngaatrdelenwthhagggglmqslglafqslvnwsqgdinivrpsatythrlvlatwrvlgarntvkgiigevv......................................................................................................................................................
MED5_COCIM/10-991                      ........................................................................................................................................................................................................................................................................................sgpewallleqcishriistefrdfsvimmrrhp-----------------------------------IS-....................----...........................----------...........--------------.....---...-.....EK...ALIR..IVLEARSa....tgLMW...DPL..IPLy..vEVLQKLGYVS.....LPEILKTLLLF.STIYddshpvskagp...........................................................ngkgvkrkkktSTLM.TDNK.IIQN.VM.A.T.IT..MG.Q.GPKA.......................................................--..-..-......-T.RG.AT...DV..L..C..AVADWIST..L..L.AWSPSG....Egpesdq..........................pgdilgHQDGA.CI.F.G.SL....GL.......L....LVA.LV...G..T.E.KGVSalssl....................skkdrKCLGQ.A.LSSYT.P.IC.AS.-.---............YSLPL..RNR...LDSI.Qkdfn..............................iypsDSSK...G..LEES..............MMG.D.VNVAV.....lQFE.SNVv.................diPTTS..-..--..S..RAGL...YIYINA..LLA.GRPLI.DDSMFLNYLN---NRYG.GDH..........------ISMVEELITAAF----.DVL.SNG.MYR.N..E.SS..KTMFLFRA---FLVNKLPPFLAY................-M.SASSmsq..................ipmeVCITRALS.....RV.DP-.--..NT..F..P..SFS.ET..F....S..--....MQGN.SV..L--.-.....-...---.-...SD.VRQEFLFSCALHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTLP.V.G..GQ..F.M.K.DTLIAQINNNper..................................aeqLLN......GIESMEGNAGA......-------................---..-----.---.--....-------.IVD...AIIEVMH....NLCS..R.K..ETMTLKSICNS..L.-SR...R...PQ.....TLDII.LLFKS...P.S.FILQPLCSL......LD-AW................K......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQL..........VYDE.FGSILLLVLAFKYKYDL...T..P.LD...L...GIN...........KP....---....--DSFILR..LL.D.TGAS..------.----..SQQLKDLTEKQNQ..NLGAWI.TALF........VA..E.....GISDESM......S.SCSPQEF..YLLVATLFSQSLT.....AC...E...A...........G......KM-....E..........FET.LKGGFE............Y................L....LEPFLLPA.LVMALTWLGNH......IW.ESE.S.D..-....-.-.....-..--.LE....TS.L.KIL..HG.L.V.....K..P.A..S.I...S..GE...........AQEIHR..TVL....CIASRTLEATLKDTRARH.pSR....T--------.----..-----.-...----.....-......--.....-D.IS.P.IL.DVLE.QY...H.S.F...............-.R............R...TG.AT..NQ..T.ELD.......SW.R.AN...P..........A..gG..G....LVTSIRNTFSSLv....lWS.TDPEis............mtpPSYT..HR..Q.MLAGI..GHVG...SERV...LQGLIDEL.KLQTET--....---.---..---...-.....GSGNLAFDIA.ATLICAPM.AE.S...F..T...L.EQ.I...L.YRQMD-----.........Q......DKYPL..PGCRMLTLR.....................................DALGIQRESLSkLIEADPHRAEL.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------iirlhrrvealcsipqiapgdvdvgnimdsihleavggddeqreqhqqqqpdadqsnqgvvaptgntpgnldamldaaa.........................................................................................................................................................................
A0A1D2VKM2_9ASCO/715-1128              ...............................................................................................................................................................................................................................................................................................................ykilnsmlqvp--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....--FP..S.D..NLNSLNSNYGR..V.YFD...N...-K.....PLDII.LYFVS...P.L.KFLLPIVHY......CD-SW................H......E......I..........K.......E.......E....E....NQvnh.....gvdV..eM.........N.....S...E...D....D.N...........YQE..........DYCN.FSVFILFIVYLTKKLNI...S..Q.NE...L...MTSytfantdynysKE...gSNS....HSKSFVLD..YL.S.NLNT..LNS---.-NQP..CFITNEGEAANMA..LLNDWI.FALF.......gSS..D.....GISDELI......S.KSSIKTC..FKLTPIIFKESFF.....AN...L...S...........S......LI-....D..........FDT.LKEGTQ............Y................F....FQSFLIGT.LLGAFKWVEDF......FF.NFN.F.Q..D....S.S.....N..D-.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------aifidqnffispeiksiliksidilyilllenhlgsnlnsqnwiihkillllssptlskslekifyifgklrtlnnieisifnkiknlinlfnkinyntennllniniissknkffvqesfnslhfdlklmlnnyqeyqayfnpnfrqneqllslinn..........................................................................................
U7Q2J6_SPOS1/403-1112                  ..................................................................................................................................................................................................................................................................................................................isnsragl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...YIYLNA..VLV.GRPLV.DDATIFSYLN---NRYQ.GDL..........------QATAVDLILASF----.DVL.ANA.VFR.S..E.GQ..TSAHLLRS---YLINKVPLLLA-................SL.AASPlyp..................fdsqYCISEALS.....RV.DT-.--..NA..F..P..TMS.SM..F....D..DN....QNAN.T-..-FT.D.....-...---.-...-S.VRQDFCFACCLHGLVP.EASIETLLGE.ITY--.--..--.-.--QSLP.T.G..GR..Y.T.K.EQLVQQCLADsdy..................................lvtLVG......QLDNMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALVAMLG....HLCR..T.R..ETATLKTLCNQ..L.-VR...K...PL.....AFDVL.LLFER...P.A.AILYPLCQL......LD-GW................H......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........IYEE.FGSALFLLLAFVYRYNL...T..I.AD...L...GIQ...........WS....---....-PDSFVAR..VL.S.TGAQ..------.----..GRTLVELSEQERE..NLGNWI.RGLFn......tDA..G.....GLSDDLM......S.SCPPHQF..YMLTPTLFQQIVQ.....AL...S...T...........G......AL-....P..........EDV.LKGGIE............Y................L....VDTFLLPS.LATALVYLSD-......--.ALR.V.D..K....P.A.....E..--.QK....AI.I.RIL..QL.I.L.....Q..P.A..S.I...S..DE...........ATLMLS..ALL....NIVAKPLEHALRTYQRQD..PR....S--------.QDID..PLLKA.L...KQNIphsrrT......AA.....AE.HN.E.LL.NWAG.TS...G.T.N...............-.S............S...GS.SD.sAN..S.NAN.......NG.T.AN...NgrsnsgqggtS...G..G....LYAAMRQTVQGFv....qWS.LHPGvn............impTSYT..HR..Q.FLAGL..SLVG...ASSV...LQLILDEV.QRQTDA--....---.---..---...-.....GSGSVAYDVA.CALICASD.VT.N...E..P...S.PD.S...L.YVLVDGEAKA.........Q......ASSNN..SNNSNNNNNnsgpv..........................tagstvA----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ntaavqrrislrqalmfkaeewkkiqsshdaagvamaeavvrlyrkveaq......................................................................................................................................................................................................
A0A4Z1JR19_9HELO/27-962                .....................................................................................................................................................................................................................ftdyirilysrnplpsqyiceiflrpdkyndihvdprvlryvqillaegfidcagilrvllrysslwnyvqdehmhseannganktkrvkggnrrwkmsys--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.AEEM.MLYR.LA.K.T.VS..TG.T.RPKN.......................................................--..-..-......-V.QE.AV...DL..L..M..ICIQWMDM..V..A.TSMGRG....Aheil.............................dieahAEEIG.MV.G.M.AL....GT.......L....MVA.VI...G..N.A.KVLGaiqkgr..................cpkgtgIDLGK.A.MARFV.P.LL.IQ.S.SPQ...........nVQRLD..VFR...TQ--.Tlmt................................ilpVDKK...E..R--Aana........eidEIL.D.STIGM......NID.NIVv..................aDLPT..I..NS..-..RAGL...YIYLNS..IAStTMPLV.DDSAIFAYLH---NRYQ.GDV..........------QSTTVDLILASF----.DVL.ANA.TFR.N..E.GP..QTTTILRS---FLINKVPLLVSTla............tsF-.---Fppl...................tseFCITEALS.....HV.DT-.--..NA..F..P..TLS.TL..F....A..ES....--TN.ND..MFS.D.....S...---.-...--.VRQDFCFACCLHGLIP.ESSIETLLGD.IPM--.--..--.-.--QSLP.A.G..GR..Y.S.K.QDLVQQCLSDser..................................aegLIS......ELENMDGNAGA......-------................---..-----.---.--....-------.VSQ...AIAEVIK....HMCG..N.K..ETMTLKTLCSQ..L.-AR...N...PS.....SLDIM.LLFNK...P.T.SFLQPICEL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLVVSFAHRYNL...S..T.VD...L...GIK...........NP....---....-AESFVAK..LL.V.QGHL..------.----..SRALDPLSQQDQN..HLDGWI.RGLFe......pEG..G.....GLGDELM......S.SCPPQEF..YLLVPTLFHHIVL.....AL...S...T...........E......TL-....S..........EEG.LKGGLE............F................M....VEPFLLPS.LIPGITWLSAH......LW.EAR.P.Q..A....T.-.....-..--.--....YV.L.QIL..SA.L.I.....K..S.P.pS.Is.nN..ME...........ASHLLN..AIL....KIIAQNLEQSLRWLQRAE.pHR....H--------.----..-----.-...----.....-......--.....-D.ID.S.IS.KALE.SN...V.G.W...............E.R............R...GA.SK.ySE..L.--E.......VW.T.AT...P..........G...G..G....LAASIKHTIVTLv....qWG.LQCDrnpg........mqimpASYT..HR..Q.VLAGL..KMLG...AKRL...LNTIIEEV.KTQTEA--....---.---..---...-.....GNGSVVLDIA.ISLICAPD.SA.S...-..F...D.SG.S...G.MDIMS-----.........-......GNTPQ..LLQRRLTLR.....................................EALKAEAENMPrVHKTDTFHAET.............................V-----------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------irlyrrveaqsviqqqllpddngmgglnevm.........................................................................................................................................................................................................................
A0A117NSS8_9EURO/5-950                 .......................................................................................................................................................................................................................................................................................................................spv--------------------------------------....................----...........................----------...........--------------.....---...K.....EN...ELLD..LLLEARAs....ssVTW...DPL..LPLy..vDGLCKVGRVK.....SSSALASLLKH.SSIVdasgsgevegeg.........................................................qgspskskkqkpSTLM.TDIK.VIQD.VM.V.F.IS..TG.S.IPKT.......................................................--..-..-......-V.IE.AA...DI..Y..S..ATVDWILA..V..V.AWHNHS....Vdasqq...........................tgglmgSPDAV.SL.F.E.SL....GI.......L....LAA.LS...G..T.N.KGLEvlssd...................fnqalkAKLGQ.A.LSSYL.P.LC.ID.-.---............VSLPL..RHR...LEEL.Qkvfnlypgqps...............kalngpaidgvnVNAL...Q..FESSvm..........dgPVV.N.TRAGL......---.---....................----..-..--..-..----...YVYINS..MVV.GRPLV.DDTILINYLT---NRYQ.GHN..........------DVLIEEIITAAF----.DVL.SNG.VYR.N..E.SG..RTMLLFRS---FLVNKLPAFFAA................IS.AA-Smvp..................ismeMCISHALS.....RL.DP-.--..NA..F..P..SFS.QM..F....S..--....MQGS.SV..L--.-.....-...---.-...SD.ARQEFLFACASHKLIR.ESSIEQLLGE.NPM--.--..--.-.--QTLP.G.G..GP..Y.V.K.DDLVSQINNNher..................................teqLIG......EIESMEGNAGA......-------................---..-----.---.--....-------.IVG...AVVDVMH....NLCH..Q.R..ETMTLKNICNS..L.-SR...R...PQ.....TLDVM.LLFRT...T.K.QVLQPLCAI......LD-SW................K......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........NQP..........VYDE.FGSILLLVLAFKYRYDL...S..P.SD...M...GIS...........NN....---....--DSFLLK..LL.D.RGAC..------.----..SQKLSDLSEKQNN..DLGAWI.GALF........IA..E.....GISEETM......S.SCSPHEF..YMLVTTLFDQSLG.....AC...E...S...........G......KL-....D..........FDT.LKGGFE............Y................L....LEPFLLPS.LVVALTWLGNH......IW.ESE.T.D..P....T.I.....P..--.--....--.I.KTL..HS.L.V.....K..P.S..S.I...S..GE...........AQAIHQ..TVL....NITGCPLEEQLKNVRTRN.qSR....T--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DALE.PY...I.S.F...............R.R............V...GS.CR.rSE..L.--D.......TW.T.SH...S..........P...G..G....LIASIRTTLQALv....lWS.ANPGis............mapHAYT..HR..Q.VLAGI..RMLG...ATRV...LCAIIDEV.KQQTEA--....---.---..---...-.....GSGHIALDIA.TTMVCAPM.TE.S...-..-...F.AV.D...Q.NNYHP---VD.........T......SKEAL..PRCAILTLR.....................................DALALQHENVPkISESDPLRAEVvvr......................larrVNMLMAPPSQ--..................-----......V..S.....NIDVSNIIQNM..HLGVE.GQEDR......MDLE.PSTA.G.V..AR.TTDHEDDPDNINQMLDKAA---ada.....................................................................................................................................................................................................................................................
A0A2D3URX7_9PEZI/112-727               ......................................................................................................................................................................................................................................................................................................................ragl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...FLWMNS..ALA.ARPLT.DDMDVLSYLH---ARYS.GNM..........------QSAIVDLLVASF----.DNL.TNS.MLR.K..E.PR..QSVKVIRS---FICNKVPVLISM................--.LSGSiapp.................mtaeACIQMAMA.....PG.GLI.SM..NP..L..P..PIS.AG..A....S..DV....---Q.ES..L--.-.....-...---.-...KH.TRLEFLQACALHGLVT.ENTIATILHE.AIA--.--..--.-.----LP.R.V..TK..Y.S.K.DGLVSQCANNvsr..................................meaIID......DLGGMQGNSGA......-------................---..-----.---.--....-------.IAG...CIVQTIG....NLCM..T.K..DTMSLKTVCNE..L.VKR...M...-P.....LMDII.MQYTE...P.V.HLLLPLCNL......LD-GW................V......-......-..........-.......-.......-....-....--...........-...H.........D.....Q...D...Q....T.E...........FTP..........SYEE.FASILLLTLAVMHRYSI...P..S.AS...L...GLI...........G-....---....--DNFVVR..LL.D.EMSS..------.----..SKSPSDMTTEQAS..QLEKWI.EGLFavd..ehgET..S.....GIGDEVM......R.QCSPRDF..YLLVPTLFEQSVL.....AC...R...Y...........N......AL-....S..........SES.FRGGLE............L................L....LEPFLLPS.LIMGLGWLAEH......SW.EDH.N.D..-....-.-.....-..--.VE....VL.L.QVL..EK.L.L.....K..P.S..S.S...S..QE...........TQAMHR..AIL....GMVATPLYNSLQELHRQR.pEK....K--------.----..-----.-...----.....-......--.....-K.AA.E.LS.DLXR.SH...L.N.Q...............Q.R............N...LH.CS.rAE..M.--D.......E-.-.YM...Q..........D...G..T....LNNRIRRSIXELv....rWA.STTTspp...........dppPRYA..HK..M.FALAC..QIVD...VEVL...LDTIIEEL.AST-----....---.---..--P...S.....ANMPVALDVC.TAMICAPA.AG.S...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------iaqqknhsagvtarlrnkvrlipsnvpallgkpkahaqal................................................................................................................................................................................................................
K2SAK5_MACPH/14-898                    ...................................................................................................................................................................................................................................................................................................nrlsadkleklaiqlnkriprde--------------------------------------....................----...........................----------...........--------------.....---...-.....-A...QLAE..ALLRPRSr....atACL...DPL..IPVy..lERLLVLNFLD.....PPEVLHALFRY.SRDYatgaehhgs..............................................................pkkqqpqpwhITPE.LEEL.VFAR.LS.K.A.FV..TN.E.RPKS.......................................................--..-..-......-I.VE.VQ...KT..L..A..ILSRWMNV..L..N.SSQTAE....Svihs.............................ladgsQAQRA.QT.L.V.GL....GM.......L....VIA.AM...E..H.P.KVAGvie.......................aampKGLRK.S.ISESL.T.FF.VP.H.LSQ............ASLQW..GER...LGML.Qkqyslttdhasn..............gmhdgpgshgldVSVL...Q..LETVm...........dlPII.N.SRAGL......---.---....................----..-..--..-..----...YVFINS..LLV.ARPLT.DDNMILNYLH---ARYK.VDF..........------QSMAVDLITASF----.DVLaANA.TYR.S..E.SN..ETIFNFRS---FLVNKVPTLVAI................--.LAGSmfpt.................ttpeLCITQALN.....RI.DR-.--..NA..F..P..SFS.QT..F....D..-M....APVN.SL..L--.-.....-...---.-...SD.VRQDFLVACALHQLIP.ESSIERLLGE.TPM--.--..--.-.--SSVP.I.G..GK..Y.V.K.ENLVAQCSTNfer..................................veeLLN......EVEGMDGNAGA......-------................---..-----.---.--....-------.IVG...AMTEIIR....NLCS..T.R..ETMSLKTICNT..L.-SR...K...PR.....SLDVV.LQYTS...P.A.SILQPLCQL......LD-SW................K......-......-..........-.......-.......-....-....--...........-...N.........D.....E...D...Q....S.E...........YQP..........VYDE.FGSVLLLVQALLFRHDL...K..A.SD...L...GLE...........DG....---....---SFVVQ..LI.E.RGHQ..------.----..SLGTDELTEDQNK..YLAGWL.RGLY........DP..E.....GISDELL......S.SCKPQDF..YLLVPTIFSQTIF.....AC...S...A...........D......VL-....P..........LDT.VKAGLE............F................L....LETFLLPS.LVGAVMWITSH.....aLE.QNS.H.D..-....-.-.....-..--.LD....IT.M.QIL..AR.L.I.....R..P.A..S.I...S..GE...........AQAMHG..TIV....SMVSRRLERCLKSIQHRE.pSR....T--------.----..-----.-...----.....-......--.....-D.IS.P.LL.EALR.SY...H.D.Y...............E.R............T...PW.SS.sAE..L.--E.......PW.M.SN...P..........G...A..S....FRSAIKFTMQHLt....nWN.STADln............ptpPAYT..HR..Q.VFSAL..QIVG...AQKV...LRAILEEL.RNQTVA--....---.---..---...-.....GTGAVALDIA.LNIICAPT.HI.N...S..C...T.PV.S...W.LNSHA-----.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------pihtpsrngslnlremlkheiddpaplmqsdpglaeaa..................................................................................................................................................................................................................
A0A067NUM6_PLEOS/443-697               ............................................................................................................................................................................................................................................................................................................sieevkllasrvwl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....DPTSHET.FAR...VIMEQAA....KLTT..T.L..DVESMSHLCKL..L.-LQ...H...ET.....ALD-I.ISLHE...PiS.SLVYHALKF......IE-TY................D......-......-..........-.......-.......-....-....C-...........-...-.........-.....E...T...V....G.D...........PQT..........AVGH.LGDVVLFAQYTMEKYHL...D..M.DT...F...AHG...........A-....---....--NAVSSQ..FI.K.TVRN..IYG---.----..---LDELTREEMV..AFNSWF.KTLFd......sTS..E.....GIEDSIL......R.STNPKIL..LRLAATLVSHAII.....AR...M...A...........S......KI-....D..........NDT.LHNGVS............F................F....LSPLLNWT.LVGVVKSL---......LR.EIK.T.K..G....F.N.....A..--.-P....VH.F.DIL..QT.I.L.....L..S.P..S.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------cpptvh..................................................................................................................................................................................................................................................
A0A2N5VT39_9BASI/89-163                ........................................................................................................................................................................................................................................................................................................................hh--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....----NLL......S.NTDPRNC..CTIKATVFKLSFN.....AL...T...R...........G......LI-....N..........LQA.FCNGLR............Y................F....EHKLLIRGcAVGIVGWLLNM......LT.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------qqgrctvt................................................................................................................................................................................................................................................
A0A1B9IFY4_9TREE/595-712               ......................................................................................................................................................................................................................................................................................................................isfs--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-----HLDEESKE..CMDGWV.KAIF........GS..D.....GIEDAIL......L.ATPPQKL..YKLSPTLIQQAVA.....AV...T...A...........S......QI-....D..........LDT.LHSGLS............Y................F....SQPLLSWC.LGGVVAWL---......CK.EIK.R.Q..G....L.L.....S..AI.-H....--.L.VVL..QD.L.I.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------lghscpea................................................................................................................................................................................................................................................
A0A4U0VRY7_9BASI/359-633               .....................................................................................................................................................................................................................................................................................................saesvdleppmetdldeklas--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......TDSNELR................AAV..EEHMH.TFS.--....---SQNR.MSQ...AMAAAFR....HRSE..N.A..DITGLANLCEV..V.MSH...K...-D.....ELAVM.FLHIE...P.H.ELLRPVREL......LD-AR................D......-......-..........-.......-.......-....-....--...........P...S.........-.....Q...D...D....A.N...........DSS..........VMER.YGMLVLFLQVTVERFEL...S..H.DL...A...KHL...........G-....---....STSSFFVA..WL.R.ASSA..VYT---.----..---LTNISDEERH..TISGWI.GALF........G-..E.....GISDELM......H.STNPKVL..LKIAPTILKQSLM.....AC...R...A...........A......VV-....D..........QDS.LRDALS............Y................F....LQELLRFT.LPGVLVWL---......LT.EIE.Q.T..S....A.A.....S..SK.-T....GM.I.NIL..Q-.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ffchsdalp...............................................................................................................................................................................................................................................
A0A4Y8DCW2_9HELO/25-960                .........................................................................................................................................................................................................................................................................................................epftdyirvlysknplp--------------------------------------....................----...........................----------...........--------------.....---...-.....--...--AP..YICEIFLrpdkhndVNV...DPR..VLRy..vQILLAEGYID.....CAGILRVLLRY.SSLWsyrqdghmhseand....................................................anktkrvkegnrrwkMSYS.AEEM.MLYR.LA.K.T.VS..TG.T.RPKN.......................................................--..-..-......-V.QE.AV...DL..L..V..ICVQWMDM..V..A.ASMGIG....Shemm..............................dieaHVEEIgMV.G.M.AL....GT.......L....MVA.VV...G..N.A.KILGaiqngr..................cpkgtgVDLGK.A.MAGFV.P.LL.LQ.S.SPQ............----N..AQR...LDVF.Rtqtlit.........................ilpvdkkE---...-..--RAana........einEIL.D.STIGM......NID.NIVv..................aDLPT..V..NS..-..RAGL...YIYLNS..ILV.GRPLI.DDSAIFAYLH---NRYQ.GDV..........------QSTTVDLILASF----.DVL.ANA.TFR.N..E.GP..QTTTILRS---FLINKVPLLVSTla............tsF-.---Fppl...................tseFCITEALS.....HV.DT-.--..NA..F..P..TLS.TL..F....A..ES....--TN.ND..MFS.D.....S...---.-...--.VRQDFCFACCLHGLIP.ESSIETLLGD.IPM--.--..--.-.--QSLP.A.G..GR..Y.S.K.QDLVQQCLSDser..................................aegLIS......ELENMDGNAGA......-------................---..-----.---.--....-------.VSQ...AIAEVIK....HMCG..N.R..ETMTLKTLCSQ..L.-AR...N...PS.....SLDIM.LLFNK...P.T.LFLQPICEL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLVVSFAHRYNL...S..T.VD...L...GIK...........TP....---....-AESFVAK..LL.V.QGHL..------.----..SRALDPLSQQDQN..HLDGWI.RGLFe......pEG..G.....GLGDELM......S.SCPPQEF..YLLVPTLFHHIVL.....AL...S...T...........E......NL-....S..........EEG.LKGGLE............F................M....VEPFLLPS.LIPGITWLSAH......LW.EAR.P.Q..A....T.-.....-..--.--....YV.L.QIL..SA.L.I.....K..S.P.pS.Is.nN..ME...........ASHLLN..AIL....KIIAQNLEQSLRWLQRAE.pHR....H--------.----..-----.-...----.....-......--.....-D.ID.S.IS.KALE.SN...V.G.W...............E.R............K...GT.SK.ySE..L.--E.......VW.T.AT...P..........G...G..G....LAASIKHTVVTLv....qWG.LQCDrnpg........mqimpASYT..HR..Q.VLTGL..KMLG...AKRL...LNTIIEEV.KTQIEA--....---.---..---...-.....GNGSVVLDIA.TSLICAPD.SA.S...-..F...D.SG.S...G.VDIMSGN---.........-......--TPQ..LLQRRLTLR.....................................EALKAEAENMPkVHKTDTFHVE-.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------tvirlyrrveaqaviqqqllpddndlgalnevm.......................................................................................................................................................................................................................
A0A0D9NVL4_METAN/17-958                ...........................................................................................................................................................................................................................................................................ikhwtkfvdrcifkrldterfeefiplvqnqhplppfviallflqpq--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..------Py....nvITL...DPR..IPPy..iQILTKLGYVD.....APSILRVLYKF.SSLHtqlktsqnetqsask...................................................gnnpyqglkekrknpQRWN.SSAW.VEEF.MF.Y.H.VI..KI.I.VEGT.......................................................-A..F..R......ES.RV.VL...EL..V..Q..VISKWMEL..F..T.SVSSVF....Atdvmge..........................lqssqaRIDME.TA.R.A.AF....VP.......L....LLR.LV...E..V.P.ALVKaissp...................hakairKSLAN.S.MAGFI.Q.TL.QP.A.PGF............VERLE..IFR...TETL.A......................................RLDPidkK..DQAA..............TNA.A.MDELL......GTT.VGLdsfv............ipdlL---..I..SN..T..RSAV...YVFLNA..SLV.GRPLV.DDNVLISYLQ---NRYQ.GAT..........------QSSAIELIVASF----.DIL.ANA.VFR.N..E.GG..KDAHLLKS---FLVNKVPLLLCLlflr........eptfDT.NASE.........................FCITEALS.....QV.DT-.--..SV..F..P..TAS.LM..F....D..ES....RSNN.PY..T--.-.....-...---.-...ES.VREEFCTACALHGLVQ.REHVERILGE.LSMS-.--..--.-.---YEP.S.L..EK..Y.S.K.EKLVQDCLADaek..................................vqgLIR......ELEKMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALVEVMR....QLCN..N.K..ETMSLKLLCSQ..L.-AQ...K...PQ.....ILDIL.LLFEK...L.P.SILDPLCQL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........IYEE.FGSILLLVLAFAYRYNL...T..A.AD...I...GIT...........SP....---....--DSCIAK..IL.G.RAHI..-SR---.----..--DGDELTEQEKG..HLSGWI.HGLF.......aDS..G.....GLGDDLM......S.SCPPQDF..YLLVASLFQNIVV.....AY...T...Y...........G......YL-....S..........DET.LKGGIE............Y................L....VDTFLLPS.LVPALRFLADY......LW.VEQ.K.E..-....-.-.....-..--.QK....AI.I.KIL..QL.I.L.....L..P.S..S.I...S..GE...........ASTMLS..SVR....NLVAKPLEHSLRTYQRQD..PK....N--------.----..-----.-...----.....-......--.....QD.IQ.P.LL.RALK.DS...L.P.L...............S.Rr..........tG...GA.DH..NE..L.--Q.......SW.T.NS...S..........S...A..G....LAGALRHTVQGLv....qWS.MHPSvn............smpTSYT..HR..Q.LIAAQ..KIMG...AKRT...LRLLLEEV.RTQSET--....---.---..---...-.....GSANIVYDAV.AAIVCAPN.VT.N...E..P...P.PN.N...Q.M---------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------mdasgnvppavqrpltlrevlrleaegcnklqkadpvlaeivvrlyrrveahmampqnqai...........................................................................................................................................................................................
A0A2G7FX32_9EURO/2-967                 .........................................................................................................................................................................................................................................................................................................................t-SSEQWRAFLHQCLMRRIDAAEFKNLSKILSRRCPIA-....................----...........................----------...........--------------.....---...-.....EG...TLLD..VLLEIRLa....tgIKW...DPL..LPLy..iDCLCKMGKVQ.....TSTVLTSLLKY.SSIHdkpqcpgse..............................................................tvqskkalkcYTLM.TDIR.VIQD.AM.L.S.VS..TG.S.TPKS.......................................................--..-..-......-L.AE.AV...GI..F..S..AIIDWIQA..V..V.AWHNNH....Idpsqq...........................tgglmsSPDAV.SL.F.E.SL....GI.......L....LTA.LS...G..T.G.KGIEvlssd...................shealkVKLGQ.A.LSAYL.P.LC.ME.-.---............VSLPL..RNR...LDSL.Qkgynlygeppn................kslqsmmdnvnVNAL...Q..FEASvm..........dgPVI.N.SRAGL......---.---....................----..-..--..-..----...YIYINA..MLM.GRPLV.DDSMLLNYLT---NRYG.GHY..........------DVLVEEVITATF----.DVL.SNA.LYR.N..E.SS..RTMFLFRS---FLVNKLPSFFAA................-M.LAASmvs..................lpmeMCISHALS.....RL.DP-.--..NT..F..P..SFS.QM..F....A..--....MQGS.TV..L--.-.....-...---.-...SE.VRPEFLFACASHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTPP.V.G..--..Y.N.K.DDLMSQINTNqer..................................aeqLVS......ELESTEGNAGA......-------................---..-----.---.--....-------.IVA...AITEVMH....NLCN..Q.K..ETMTLKSICNS..L.-SR...R...PQ.....ALDVI.LLFRS...A.K.QVLQPLCTL......LD-SW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQP..........VYDE.FGSILLLVLTFKYRYDL...R..P.YD...L...GIT...........SN....---....--DSFVLK..LL.D.CGPS..------.----..SQKLDDLSEKQNK..NLGAWI.TALF........IA..E.....GISEETM......S.SCSPQEF..YLLVTTLFNQSLT.....AC...E...A...........G......KL-....E..........FDT.LKGGFE............Y................L....LEPFLLPS.LVVALTWLGNH......IW.ETE.S.D..P....T.I.....P..--.--....--.L.KTL..QS.L.V.....N..P.S..S.I...S..GD...........AREIHK..TVL....NITARSLDEQLKDIRSRH.pNR....A--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DVLE.PC...L.S.F...............Q.R............T...GS.CH.rSE..L.--D.......SW.T.TH...S..........P...G..G....LLGSIRSTFQGLv....lWS.TSPGvs............mapHFYT..HR..Q.LVAGI..RMLG...SARV...LTAIVDEL.KMQTET--....---.---..---...-.....GNADLALDIA.VTMICAPL.AE.S...-..-...F.AI.E...Q.SNYHP---VD.........P......NKEPL..PRCPVLTLR.....................................DALNLQHENVPkLSEKDPLRAEVivr......................lyrrVNALMTPTSQMP..................-----......-..-.....NLDMSNIIQDM..QLGV-.-----......----.----.-.-..--.----------------------edhgqmdlepagaghgvgdddaanlnrmldnaaaa.....................................................................................................................................................................................................................
A0A1L9VT81_ASPGL/11-1008               .........................................................................................................................................................................................................................................................................................................................s-SAEQWRLFLDQCLKHRIDANEFKNLSNILAARCSVS-....................----...........................----------...........--------------.....---...-.....ES...VLVD..VLCDVRAvga.aagVKW...DPL..VPVy..iDCLCKTERVK.....IPSVLAGLLKR.SYILpqsqiqssde............................................................sekskqqkkngYTLM.TDIR.VIQD.VM.L.A.VS..TGnS.TPRT.......................................................--..-..-......-A.AE.AM...EI..F..S..AAVDWIQA..V..V.AWHQQH....Qqtg...............................glmgSPDVV.SL.F.E.SL....GI.......L....LAA.LS...G..T.T.KGVDvlssd....................neglkIKLGQ.A.LSAYL.P.LC.VE.-.---............VSLPL..RNR...LDSL.Qkefnlygepas...............ksldmtmmdgmnVNAL...Q..FEASvm..........dgPVI.N.SRAGL......---.---....................----..-..--..-..----...YVYINS..MLV.GRPLI.DDNMLLSYLV---NRYG.GHY..........------KALIEEVITASF----.DVL.SNA.MYR.N..E.SN..RTMFIFRS---FLVNKLPAFFAT................-M.LAASmvs..................ipmeICISNALG.....RL.DP-.--..NT..F..P..SFS.QM..F....S..--....MQGN.TV..L--.-.....-...---.-...SD.VRQEFLFACASHQLIP.ESSIERLLGE.NPM--.--..--.-.--QAVP.V.G..--..H.V.K.DDLVSQIYANper..................................aeqLTN......DIESTEGNANA......-------................---..-----.---.--....-------.IVG...AVTEVIH....QLCN..Q.K..ESMTLKNICNS..L.-SR...R...PQ.....ALDVI.LLFRS...T.K.QILQPLCTL......LD-NW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....S...D...Q....G.E...........NQP..........VYDE.FGSILLLILNFKYRYDL...K..P.YE...L...GIS...........SD....---....--DSFVLK..LL.D.RGSC..------.----..SQKLEDLTEKQNK..DLGAWI.GALF........IA..E.....GISEETM......S.NCSPQEF..YLLVTTLFSQSLG.....AC...E...A...........G......KL-....E..........FET.LKGGFE............Y................L....LEPFLLPS.LVVALGWLGNR......IW.ESE.S.E..P....T.I.....A..--.--....--.L.KTL..HS.L.V.....S..P.T..S.I...S..GE...........AQAIHQ..TVL....SMTARTLEEQLKDVRARH.pSR....T--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DALE.PH...L.S.F...............Q.R............T...GG.CH.rTE..L.--E.......SW.S.HS...G..........NggaG..G....LLGSVRNTFQSLv....lWS.TNPEis............mapPSYT..HR..Q.VVVGV..RMLG...ASRV...LRALEEEL.KLQTEA--....---.---..---...-.....GSGDLALDVA.AMIVSAPM.ME.S...-..-...F.TA.D...Q.MHYHPPENKD.........Q......SQQTK..QQQAAANLRspv..............................ltlrDALSIRHQDVPrVSEKDPLRAEMivr......................lyrrVNAVTAPTAQVP.................sLDVSN......IlgN....mPVADQSSQPQA..QPQSQ.TQQQS......QQQQ.QQSQ.Q.A..QS.QEQQQ-----------------qnqmdldadaedgdfshm......................................................................................................................................................................................................................................
A0A090CIC4_PODAN/52-802                ..............................................................................................................................................................................................................................................................................................ppgliaelllrptadnnvaldpraplyl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....THLIKQRRVD.....TASVLKALYNY.STIHtkihpqpedqpske....................................................rdasaprrkklqrwtSSYS.SEAI.LFWR.LA.Q.T.VN..QG.I.GIKS.......................................................-G..R..D......VV.ET.SR...ML..V..R..WMALFTEA..A..T.IFSQDA....Fgsmh.............................slnasKLGME.RS.R.E.SF....IM.......F....LNA.FS...A..H.P.TVPKtfqip...................aakgirKQLSQ.S.LEAFL.P.SI.MQ.V.NPS...........iASQLD..MFR...AQSL.Athdstekkdpav..............sdmnsymdnvmgLESF...Q..VPEV..............---.-.-----......---.---....................---P..I..AN..T..RAGL...YIYLSA..ALV.GRPMI.DDAALFTYLH---NRYR.GDV..........------QQAAVQLILASF----.DVL.ANA.VFR.N..E.GA..KAGHLLKS---FVVNKVPLVLVS................LA.QSSPlyt..................fnpeICITEALG.....QV.DT-.--..NI..F..P..TFS.GM..F....D..-M....SSNT.GS..SFQ.D.....-...---.-...-S.VRQDFCFACQLHGLLS.QAAIENLLGD.ITY--.-Q..TL.P.DEGRYV.K.D..IL..V.Q.S.CLQDSDRTQK........................................LIG......ELDNMNGNVGA......-------................---..-----.---.--....-------.AAQ...AVVEVIG....SLCR..N.T..ETMALKQLCGQ..L.-AS...K...PL.....SLDIL.LLFSP...A.Q.KILHPLREL......ID-HW................G......-......-..........-.......-.......-....-....--...........G...Y.........D.....E...E...Q....G.E...........YQP..........VYEE.FGSVLLLLMAFVYRYNI...S..P.AD...L...GVR...........SP....---....--DSFVGK..LI.G.GGHA..VRL---.----..---LSDLSPQEHL..HLNGWI.QGLF........AE..G.....GLGDELM......A.SCPPQDF..YLLMPVLFGQISA.....AL...S...A...........G......FL-....N..........EET.LKSGLE............CefhfwsgiwmiltaadL....VEVFLLPS.LVPAILYLSNQ......LW.AEG.P.E..-....-.-.....G..--.QR....SI.I.KIL..QL.L.I.....R..P.N..S.I...S..NE...........ASAMFQ..SVL....NIVAKPLEHALRSYQRSD..PK....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------sqevepllraikenltvsr.....................................................................................................................................................................................................................................
A0A0C4F5J7_PUCT1/274-385               ......................................................................................................................................................................................................................................................................................................................qgsk--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..------LPETHKS..TLWVWV.KALY........CS..S.....GIPNALL......S.TTNPRIF..FAIAPSLFKQSFN.....AL...N...V...........C......LI-....N..........LQT.FRDGLS............Y................F....EHKLLI--.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------swaavgvldklsrlgpissnlyptnlleilkaill.....................................................................................................................................................................................................................
MED5_PHANO/17-252                      ......................................................................................................................................................................................................................................................................................................................pglk--------------------------------------....................----...........................----------...........--------------.....---...-.....--...-IAG..LLLRPRAa....naSSV...DPR..VIIy..lERLLALKKVD.....ASDVLSSAFQY.SKDRlpktgddg.................................................................sskdsgwhNPPE.LEEV.VFHR.LS.K.A.FQ..AE.E.RPVN.......................................................--..-..-......-S.TE.GL...RT..L..V..VVTRWMQT..M..V.TSHTSD....Tmiqama..........................giqqqpQQQSI.NV.R.E.GL....GM.......L....VVG.VI...E..N.Q.KMLNilnkhhik..............nckspgrsRKSNT.T.FTTNL.A.TG.EW.R.SER............RSRTE..TQD...LKSL.R......................................SNFE...A..---Vdw..........ifPTI.N.TRAGL......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------yiflnslids..............................................................................................................................................................................................................................................
A2QHS8_ASPNC/646-963                   ..........................................................................................................................................................................................................................................................................................................................--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................L....LEPFLLPS.LILALNWLGNH......IW.ESE.S.D..P....S.I.....P..--.--....--.L.KAL..HS.L.I.....S..P.S..S.I...S..GE...........AKEIHR..TVL....NITARSLEEQLKSVRARQ..PD....D--------.----..-----.-...----.....-......--.....-T.IK.P.IL.EALD.PH...L.S.F...............Q.R............S...GS.TH.rSE..L.--E.......SW.T.AH...T..........P...G..G....LLASIRSTFQSLi....lWS.TSPDms............mapQSYT..HR..Q.FIAGI..HIQG...SMRV...LCALIDEL.KLQATT--....---.-SP..TNA...T.....GSSDLALDIA.ATMICAPL.AD.S...F..A..vD.QN.T...Y.SPHHHMDPTN.........T......NKEIP..PRNPILTPR.....................................GALYQLHESVPkICEKDPLRAEIivr......................lwrrVNAALTPPSQLD..................--MNN......-..-.....------IIQ--..-----.-----......----.----.-.-..--.----------------------nmqlgvgvggpgqmdldtsgaggheeestinqmldnav..................................................................................................................................................................................................................
A0A4Q4YPV4_9PEZI/351-866               ......................................................................................................................................................................................................................................................................................................................nryq--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................FCITEALS.....QV.DT-.--..NA..F..P..TLS.GM..F....D..ES....-NNN.NS..F--.-.....-...---.-...TDtVRQDFCFACCLHGLIP.ESSIEGLLGE.ITY--.--..--.-.--QTLP.S.A..GK..Y.V.R.EALVEECMADper..................................iqgLIG......ELDNMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALTEVIA....RLCN..N.K..ETMTLKLLCSQ..L.-AR...K...PV.....SLDVM.LLFER...P.I.TILHPLCEL......LD-NW................K......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.FGSVMLLLLAFVYRYNL...S..P.LD...L...GIR...........SP....---....--ESFVAK..LL.H.DGQL..------.----..GRSLDELTDQEKG..HLDGWI.HGLFd......tGA..G.....GLGDELM......S.SCPPQDF..YLLVATLFQNIVL.....AF...G...T...........G......YL-....S..........EES.LKTGLE............Y................L....VDTFLLPS.LVLAISYMANQ......LW.---.S.D..I....S.Q.....E..--.KK....AV.I.RVL..QL.I.L.....L..T.K..Q.G...S..NE...........AQSMLT..AVV....NIVAKPLEHALRLSQRQN..PK....S--------.----..-----.-...----.....-......--.....QD.IE.P.LL.KAIK.DN...T.R.F...............S.R............R...TA.GA..GH..N.ELE.......AW.T.ST...A..........N...G..G....LVASVRHTIQGFv....qWS.LHPGin............impTPYT..HR..Q.ILAAL..RILG...AKRL...LYVILDEV.KQQTEA--....---.---..---...-.....GSGSVVYDVA.TALVCAPD.VT.N...M..P...P.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ppemlapalhhhahnhvhhvpp..................................................................................................................................................................................................................................
A0A0D0E710_9AGAM/567-732               .......................................................................................................................................................................................................................................................................................................fkkgakvfrtdflrssrvy--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..--HPDELPPEMRS..VFAGWF.KAIFd......sSS..E.....GIDDTIL......R.STKPKTL..LHMSATLFSQACI.....AR...Q...E...........G......RV-....D..........NDV.LHNGIS............Y................F....LGPLLNWT.LVGVVHAM---......LF.EVQ.Q.R..G....L.A.....A..-P.FQ....--.L.EIL..QS.L.L.....L..A.P..T.C...P..--...........-----H..VVV....RLCSPNILKIL-------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------sgkrtqivvsslhyd.........................................................................................................................................................................................................................................
A0A2S6CHL1_9PEZI/268-978               ....................................................................................................................................................................................................................................................................................................................rsragi--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...FVWLNA..ALA.ARPLT.DDMTILTYIQ---GR--.-S-..........--SDNPQSIVVDLLVAAF----.DVL.TNF.MLT.K..E.PR..QNAKVVRS---FICNKLPVLIAI................LA.NNMQpai...................sadACIQMALMpggmiSM.DP-.--..--..L..P..PIS.AG..A....T..DV....---R.DS..L--.-.....-...---.-...KT.TRLEFLQACVLHGLVN.EQTVALILQE.SVAL-.PR..VI.K.------.-.-..--..L.N.K.DSLVAQCANN........................................VSKlaehieELAGMQGNVGA......-------................---..-----.---.--....-------.IAG...CVVETVN....NMCM..S.K..DTMSLKSVCDK..L.IRR...I...-P.....YMDFV.MQYTQ...P.G.MLLLPLCNL......LN-DW................T......-......-..........-.......-.......-....-....--...........-...H.........D.....Q...D...Q....S.E...........FTP..........AYEE.FASILLFTLAVIYRYDL...A..F.AD...I...GIL...........G-....---....--DSFVAR..LL.E.DMTV..------.----..SKPPGELQSEQAS..QLTQWI.EGLFavd..ehgDT..S.....GIGDEVM......R.QCSPQSF..YTLVPTLFEQSIL.....AC...R...S...........Q......VL-....S..........MNT.FKSGLE............L................L....LEPFLLPS.LVMGLGWLAKH......SW.EDH.N.D..-....-.-.....-..--.AD....VL.I.QVL..EK.L.L.....K..P.S..S.S...A..PE...........TQAMHR..AIL....AMVATPLYCSLEEYCRKQ..PN....K--------.----..-----.-...----.....-......--.....-K.AN.E.LL.ELLK.PH...L.N.Q...............Q.R............S...LH.SR.qSE..L.--D.......QW.Q.-Q...D..........G...T..G....LQGRVQQAIRELi....tWS.STSTspp...........nppPHYT..HR..T.FAIAC..QLLD...SQTL...LDAIIAEV.SK-TE-Y-....---.---..---...-.....NNVPIALDVC.TSLICAPA.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------pvpmgaqqathwtsptgqlrsrvriasadaqaildlakshaetlvrlgrrvqaqmsfaaqmpaiampmpmqdqstdqmmqdlglaldsnasasnvdatmatnasaiasnaemsgmdqpidltnlnnasadelaklt................................................................................................................
A0A1Y2ECP1_9BASI/409-722               ..................................................................................................................................................................................................................................................................................sfchrelisidvgaslaspdvhqqdlapqslpegcynnql--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......--AEQDQ................EGV..RETLN.DLP.TN....-YLAQKA.IVS...GLQAAIH....SFAQ..N.L..DLVGLSALCKT..I.-LD...V...PD.....VLEVA.FLHLE...P.R.EILSPVREF......LD-QF................D......-......-..........-.......T.......S....L....EN...........F...-.........-.....-...-...-....-.G...........DGH..........PIEG.YGKVVLFIETVLSRFKL...Y..A.DL...P...RHL...........G-....---....SSKGFFVH..WL.P.SAPA..VYP---.----..---LQGLDEESKL..AVDGWV.EGLF........G-..E.....GISDELM......H.STNPRVL..LRVAPTICKQSLV.....AC...Q...A...........G......VI-....D..........LDT.LREGLS............Y................F....LQELLSFT.LPGVVHWL---......VD.EIG.R.T..P....P.S.....P..AQ.-T....TM.L.DIL..GV.F.I.....F..S.E..S.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------lprlvlelvssslaalaskl....................................................................................................................................................................................................................................
A0A166NH10_9HYPO/28-965                ...................................................................................................................................................................kapddefyeqmarniykqnplppailadlffhpqpddqvslvprmplyirilhrlgfidslsilrsmykvsalhdvlkksgssqeqnsngqqdtsvgdkesrrwstsswfeeffffqiikamtdgtplgdtkdmlelcqivsqwmdlftst--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...-S..N..F..FAADVLGQ..L..Q.ESRSRD....P......................................KFCME.ES.R.D.AF....VP.......L....LVR.LV...E..T.P.LLVKtisms...................iakgarKQLSD.S.MWSFL.Q.TL.QP.S.GL-............VDRLQ..IFY...TDTL.T......................................KLDPdgkK..KQAA..............ASA.A.MEEIL......ETT.VGVdn...............fviPDLP..V..PN..T..RAAL...YVFLNA..CLV.GRPLI.DDNVLISYIH---NRYQ.DQT..........------QAGVIDLILASF----.DIL.ANA.IFR.N..E.GS..KDSHVLKS---FLVCKVPLLICQlcs..........agfDM.STSE.........................YCITEALN.....QV.DT-.--..SV..F..P..TAS.LM..F....D..PS....RSNN.PY..T--.-.....-...---.-...ES.VREDFCTACVVHGLIQ.REHVDRILGE.SSM--.--..SY.V.SLEKLS.K.E..KL.vQ.D.C.LASTAN---Iq......................................sLIR......DLDKTDGNVGA......-VAQALV................PPL..LN---.---.--....-GARKFQ.VLK...T-EQVMR....RLCH..N.K..ETISLKMVCSQ..L.-AQ...K...PQ.....ALDVL.LLFEK...L.P.SIVEPLCQV......LD-NW................Q......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........IYEE.FGSILLVVLAFAYRYNL...S..P.FD...M...GIA...........SP....---....--DSSVAK..IV.N.W-AH..ISR---.----..--DPHELSAQQKE..HVNGWI.EGLF........DNesG.....GLGDDLM......S.SCPPPDF..YSLVASIFQRIIV.....AY...T...V...........G......YL-....N..........DDA.LKGGIE............Y................L....VDTFLLPS.LVPAMRFLADY......LW.VEQ.S.E..Q....-.-.....-..--.-K....AV.I.KIL..QL.L.L.....L..P.S..S.I...S..GE...........ASAMLS..SVC....NLVAKPLEHSLRTYQRQD..PK....N--------.----..-----.-...----.....-......--.....QD.IE.P.LL.IALK.DS...L.P.L...............S.R............R...TG.GA..DH..L.ELE.......T-.-.WA...N..........S...S..G....LSGALRHTIQGLv....qWA.MNPAvn............nmpTSYT..HR..Q.LIVFV..QVTG...ASRT...LQMLLEEI.RMHAEA--....---.---..---...-.....GNPSVVYDVV.AAMICAPN.VQ.N...E..A...P.WT.D...G.MM-MD---AS.........G......-NIAP..PVQRSLTLR.....................................QALGFARERARkVSKEDALLAEI.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ivrlhrrveahmvmpqp.......................................................................................................................................................................................................................................
A0A1X6NFM3_9APHY/439-693               ......................................................................................................................................................................................................fakvvekrftspshsvdleslshtcrilcrynlaldivslhvkaqvlvayalafiedydcetvgdprtavthvgdvvlfvqeaivrcnvsyptlrlgerqlsldlirsastarppl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-----EFKGDDKQ..AYGAWF.KALFd......sSS..E.....GIEDTIL......R.NTRPKTL..LRIAATLFAQAII.....FC...A...E...........R......KI-....D..........RSI.LNNGIQ............F................F....MDPLLNWT.SVGVAKSL---......MT.EIR.R.R..G....Y.R.....A..-P.LH....--.L.DVL..QT.L.L.....L..S.S..S.C...P..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ptvlrlsassvlrlfpavpkheltr...............................................................................................................................................................................................................................
A0A2S4Q1F9_9PEZI/569-904               ..........................................................................................................................................................................................................................................................................................................................--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.---Y........KN..S.....GLTDDLM......S.SCPPQEF..YLLVPTLFHSIVH.....AC...A...T...........Q......NL-....T..........AAM.LSSGLE............Y................L....VDTFLLPS.LVPGISFLSAY......LW.ENR.G.D..K....-.-.....D..AV.IQ....IL.T.ALI..TTpL.S.....N..K.N..S.N...N..TD...........AAQILG..VVL....DITAKELEQSLRWLQRVD.pLR....Q--------.----..-----.-...----.....-......--.....-D.IE.P.LS.KALR.CN...L.G.W...............E.R............S...AA.SE.hTE..L.--E.......NW.T.ST...P..........G...G..G....LSTAIKQTLRNLl....qWH.LQPTd..............npANYT..HR..Q.ILVGV..KMLG...AKKV...IRIILEEL.KAGISS--....---.---..---...-.....GHAGAALDVA.SSIVCAAD.AS.T...-..W...D.SI.Y...C.SN---AEKGS.........G......NGEVQ..LLQRRLNLR.....................................EALKNEVENAPkLQKTDSFAAETvvr......................lyrkVESLLA------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------idnngirnflsdveeidvpadindl...............................................................................................................................................................................................................................
G3JCY3_CORMM/16-491                    ...................................................................................................................................................................................................................................................................................................avqywsdfvarciaqrlgserfh--------------------------------------....................----...........................----------...........--------DFVRLV.....HAQ...Hp..lpPI...LVAD..LFLRPQPs....nrVSL...DPR..VPPy..vRVLTQLGYMD.....APSILRVMYKY.SALHalakpspe................................................................vkteeagdkT---.----.VRWQ.ES.S.W.AE..EV.M.FYHVikt................................................mfegTA..F..T......DA.KT.GL...EL..V..G..ITCKWMDL..F..V.QTFAAE....Alvgt.............................hdrqaREEMV.TV.R.A.AL....AP.......L....LLR.LV...D..N.E.ALLRii.........................slrKHLSD.S.LGHFI.Q.TF.QP.A.PLY............LERLE..IFR...TQTL.A......................................QLDP...V..DEKKqaan......aamdELL.D.STVGL......---.--Esfv.............vadiPIAN..S..RA..A..---L...YIYLNA..ALV.GRPVL.DDSMLYAFLN---NKYQ.ENQ..........------QASAVDLIVASF----.DVL.ANA.VFR.N..E.GP..KDAHLLRS---FVVNKLPLLLCQlch..........pefSA.TSAE.........................FCITEALS.....RV.DT-.--..GI..F..P..TAS.LM..F....D..ES....RNNN.PY..M--.-.....-...---.-...DS.VREEFCAACALHGLIE.RDHVDRILGE.TSMSY.DP..SL.E.R-----.V.N..RD..R.L.V.GDCLSDSAKIq......................................sIIS......QLDRVDGN---......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------vgavahavve..............................................................................................................................................................................................................................................
A0A1Q8S1Y3_9PEZI/13-989                .....................................................................................................................................................................................................................................................................aleqwsqfiakslahridpdkfesyvpflqakhplppvavadlflrpqphnra--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......-SL...DPR..VPRy..lQVLSDLNYID.....TPSILKALYKY.STSRahsrdaaqptdqe.......................................................aaeaqkpntlrwgSSYA.AEEV.MFYR.LT.K.S.VA..QG.T.AIRN.......................................................ME..TglE......IA.NI.MAkwiAL..FtdA..ATAFTVDV..M..G.QLHTSQ....V......................................REEME.SA.R.A.AF....VA.......L....LLG.VC...E..N.A.VVLKafgrp...................eaqntrKGLSE.S.LANFV.P.TI.MQ.SaGPIa.........trLDMFR..TST...LASF.E......................................PVDE...Q..KNKSna.........eidDLF.D.STVAL......ENF.VIS....................ELPI..V..N-..S..RAGL...YIYLNA..VLV.GRPLI.DDVAIFNYLN---NRYQ.GDV..........------QSTTIDLILASF----.DVL.ANS.VSR.N..E.GN..PTAHLLRS---FLMNKLPLLIE-................NL.SKHMypp..................ltaeYCITEALR.....RV.DT-.--..NT..F..P..TLS.SM..F....D..DT....RSNN.PF..M--.-.....-...---.-...ES.VREEFCWACCLHGLVR.ESSIETLLGE.TPY--.-Q..SL.P.TAGRYV.K.E..NL..-.-.V.AECLADPERMq......................................aLIA......ELDGKDGNAGA......-------................---..-----.---.--....-------.VCQ...ALTEVLV....QLCR..N.K..ETMSLKLLCSQ..L.-AQ...K...PL.....SLDVM.LMFEK...P.V.AILHPLCDL......LD-GW................K......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSVLLLVMAFAYRYGL...S..A.LD...M...GVS...........AP....---....--DSFVAR..LL.G.QGHQ..------.----..SRPLDELSEQEKG..HLNGWI.HGLFd......sEA..G.....GLGDELM......S.SCPPQDF..YLVVSTLFQNIVL.....AF...S...T...........G......HL-....S..........EES.LKGGIE............Y................L....VDTFLLPS.LVVAITYLANS......LW.VER.S.E..-....-.-.....-..-C.QK....AI.V.RVL..NF.V.L.....T..P.A..A.I...S..NE...........ASAMLS..SVM....NIVAKPLEHSLRAYQRSD..PK....S--------.----..QEVEP.L...----.....-......--.....--.LK.A.IK.DSIP.LS...R.R.T...............-.-............G...AA.DH..TE..L.--D.......SW.-.--...S..........L...V..G....FSNSIRQTLQQLv....qWS.IHPTmd............rmpPAYT..HR..Q.MLVAL..KILG...AKRL...LQLLYEDI.RQQTET--....---.---..---...-.....GSGSIIYDVA.TAMVCAPD.VF.N...S..P...P.AS.A...-.LNFLD----N.........P......GNVPS..PVQRKLALR.....................................DVLKSDAEDCMrLKKTDMNLAEI.............................VVRLYRKVEAQMa................vSQAQV......I..Q.....AESMLQN----..-----.-----......----.----.-.-..--.----------------------dlgldlgngagslddamaaaaanvtqgdgmsvdnvs....................................................................................................................................................................................................................
G2YHD3_BOTF4/27-963                    ...........................................................................................................................................................................................................................................................................................................ftdyirilysknplp--------------------------------------....................----...........................----------...........--------------.....---...-.....--...--AP..YICEIFLrpdkhndVNV...DPR..VLRy..vQILLAEGCID.....CAGILRVLLRY.SSLWsyrqdghmhseand....................................................ankikrvkegnrrwkMSYS.AEEM.MLYR.LA.K.T.VS..TG.T.RPKN.......................................................--..-..-......-V.QE.AV...DL..L..V..ICVQWMDM..V..A.ASMGRG....Ahemm..............................dieaHVEEIgMV.G.M.AL....GT.......L....MVA.VV...G..N.A.KILGaiqngr..................cpkgtgVDLGK.A.MAGFV.P.LL.LQ.S.SPQ............----N..AQR...LDVF.Rtqtlit.........................ilpvdkkE---...-..--RAana........einEIL.D.STIGM......NID.NIVv..................aDLPT..V..NS..-..RAGL...YIYLNS..ILV.GRPLI.DDNAIFAYLH---NRYQ.GDV..........------QSTTVDLILASF----.DVL.ANA.TFR.N..E.GP..QTTTILRS---FLINKVPLLVSTla............tsF-.---Fppl...................tseFCITEALS.....HV.DT-.--..NA..F..P..TLS.TL..F....A..ES....--TN.ND..MFS.D.....S...---.-...--.VRQDFCFACCLHGLIP.ESSIETLLGD.IPM--.--..--.-.--QSLP.A.G..GR..Y.S.K.QDLVEQCLSDser..................................aegLIS......ELENMDGNAGA......-------................---..-----.---.--....-------.VSQ...AIAEVIK....HMCG..N.R..ETMTLKTLCSQ..L.-AR...N...PS.....SLDIM.LLFNK...P.T.LFLQPICEL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLVVSFAHRYNL...S..T.VD...L...GIK...........NP....---....-AESFVAK..LL.V.QGHL..------.----..SRALDPLSQQDQN..HLDGWI.RGLFe......pEG..G.....GLGDELM......S.SCPPQEF..YLLVPTLFHHIVL.....AL...S...T...........E......NL-....S..........EDG.LKGGLE............F................M....VEPFLLPS.LIPGITWLSAH......LW.EAR.P.Q..A....T.-.....-..--.--....YV.L.QIL..SA.L.I.....K..S.P.pS.Is.nN..ME...........ASHLLN..AIL....KIIAQNLEQSLRWLQRAE.pHR....H--------.----..-----.-...----.....-......--.....-D.ID.S.IS.KALE.SN...V.G.W...............E.R............K...GA.SK.ySE..L.--E.......VW.T.AT...P..........G...G..G....LAASIKHTVVTLv....qWG.LQCDrnpg........mqimpASYT..HR..Q.VLTGL..KMLG...AKRL...LNTIIEEV.KTQTEA--....---.---..---...-.....GNGSVVLDIA.TSLICAPD.SA.S...-..F...D.SG.S...G.VDIMS-----.........-......GNTPQ..LLQRRLTLR.....................................EALKAEAENMPkVHKTDTFHAET.............................V-----------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------irlyrrveaqaviqqqllpddndlgalnevmgda......................................................................................................................................................................................................................
A0A3D8RHI8_9HELO/20-962                ....................................................................................................................................................................................................................................................................................................etfssyvqilsckhplskahaa--------------------------------------....................----...........................----------...........--------------.....---...-.....--...---E..IFLRPTSd....ndVNL...DPR..IPRy..lQVLLGLQLVD.....TPGILKALAKY.-SSFgregekdnvghen......................................................pdgadkkektvrwrSSYA.AEES.LFYR.LA.K.H.IS..SG.A.APRN.......................................................--..-..-......-T.QE.AV...EL..I..L..VSIKWMDL..V.sT.AVHADE....Tlgl................................gshAEEMS.AA.I.M.AL....GT.......L....LVA.VT...E..N.G.KVLNsfr.......................ggcpKGISQ.T.LSKCL.A.TC.IP.L.LLQ............TAPQS..AAR...LEIF.Rtqtlva.........................vapvdkkEQAD...R..KEIE..............DI-.-.-----......---.--Mdeaiglg.....gmeslvvgDLPT..M..NS..R..P-GL...YIYLNS..LLV.AMPLM.DDDAIFAYLH---NRYQ.GDI..........------QSTMVDLILASF----.DIL.ANA.IYR.K..E.SS..QTTTLLRS---FLINKLPLLLSP................LS.SS-Lfpp..................lnaeYCITGALA.....HV.DT-.--..NV..F..P..TLA.SM..F....D..ES....-SNS.NF..L--.-.....-...---.S...DS.VRPDFCFACCLHGLIP.ESSIEALLGD.IPM--.--..--.-.--QSLP.A.G..GR..Y.A.K.EDLVQQCLSDper..................................aegLID......ELEHMDGNVGA......-------................---..-----.---.--....-------.VSQ...AITEVIG....RLCT..N.K..ETMTLKALCSK..L.-AQ...K...PS.....SLDTM.LLFDK...P.V.TILQPICEV......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...D...Q....G.E...........YQP..........VYEE.FGSILLLVLAFVHRYNL...S..P.ND...L...GIR...........NS....---....--ESFVTK..LL.N.QGHL..------.----..SKAMENLTDQEQS..HLDGWI.RGLF........DNesG.....GLGDELM......G.SCPPQDF..YLLVPTLFHHIVI.....AC...S...T...........N......NL-....S..........DEG.LKGGLE............Y................L....VDTFLLPS.LVGAITWLSSH......LW.ESR.G.N..D....A.T.....S..--.--....-V.L.QIL..SA.LiL.....T..P.T..S.I...S..SE...........ASNIFP..AIL....NIIAKPMEHSLRWYQRAE.pS-....---------.----..-----.-...----.....-......-C.....QD.IE.P.LS.KKIK.GN...L.G.W...............E.R............H...GG.SE.hTE..L.--E.......AW.T.AT...P..........G...G..S....MTASVRQTVQNLv....qWG.LNPGmpgm.........niipASYT..HR..Q.ILAAL..KIIG...AKRL...LHAIISEV.LSQTEA--....---.---..---...-.....GNGSIVIDVA.TAIICAPC.SC.S...E..G...L.RA.A...E.LAVMQ-----.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------plqrrmtlrealkneadnspkihksdpaqaetivrlsrrveaqllqpqpvmgamglddaglqmdaalqqqidagvgevdehqq.....................................................................................................................................................................
A0A1B8GA04_9PEZI/19-756                ...............................................................................................................................................................................................dkleqfakvlstksplatpliaelllrpsesrnydldpqvslyvqallridildvpsvlrallrhstsrpvdatkedqevasgsqtrwtksygheerlvyglskivaagdrpksaqealvman--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..ALTEWMRL..L..V.MSNAAD...dMmreig...........................agndthNQETM.AV.R.V.AV....GA.......L....LVA.LA...E..N.S.TVNDalknr...................cpkdtlKGFSQ.S.LANFT.P.LL.IN.G.SSM............FAERL..ELY...TKTL.V......................................ALEP...M..DKKAqkaga....eidqiIDS.A.-----......---.--Malgmd..........nipvvEIPT..M..NS..R..A-GL...YVYLNS..LLT.GRPMV.DDNQLLNFLH---NRYQ.GDI..........------QTTCIDLIVSSF----.DIL.ANA.IFR.S..E.SP..QTTFLLRS---FLINKVPLLIS-................-M.ISAPmfpp.................lspeLCITEALS.....HV.DT-.--..NA..F..P..TFS.SM..F....D..DT....--SA.GD..MFS.D.....S...---.-...--.VRQDFCFSCCLHGLIP.EESIERLLGE.IPM--.--..--.-.--QTLP.A.G..GR..Y.T.K.DEVLEQCLSDsek..................................ieaFTD......ELEHMDGNVGA......-------................---..-----.---.--....-------.VSQ...AITELLR....RLCE..S.K..DTMALKSLCAH..L.-AR...K...PS.....SLDVL.LIFDK...P.L.TILPPICQL......LD-AW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...D...Q....G.E...........YQP..........VYEE.FGSILLLVLAFVYRYDL...S..A.TE...L...GVQ...........TP....---....--DSFIAK..LL.V.RGST..------.----..ARLLDDLSSVESS..QLDGWI.KGLFn......aEG..G.....GLGDEPM......A.LCPPQDF..YLLVPTLFSQIVL.....AS...Q...H...........G......HLT....D..........-DV.LRGGLE............Y................L....LDPSLLPS.LIPALLSL---......AS.NIL.T.A..P....P.P.....S..--.--....--.-.SLL..QA.L.I.....L..P.Q..S.I...S..AE...........ASLLHN..AIL....PIPAPHLSRSLRALQRSV.pTR....T--------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------dldpliaalrphlhfsrs......................................................................................................................................................................................................................................
A0A0L0NIM4_TOLOC/14-941                ...................................................................................................................................................................................................................................................................................estaywsnfiarciskrldtdrfeefvplvysqhplapi--------------------------------------....................----...........................----------...........--------------.....---...-.....--...FIAD..LFLKPQPt....ndVSL...DPR..MPPy..iKVLSRLGYID.....APSILWTMYKY.SSLHaqlrls....................................................................qngdnkeENQT.RCRR.ISSW.AE.E.V.MF..YH.V.IKTVv....................................................egSS..F..R......DS.RA.AL...VL..V..K..SICKWMDL..F..T.SASTAF....Aad.................................vlgQIQSS.QV.R.D.EM....DVaraafipL....LLR.LV...E..T.P.SLIKviskp...................vakavrKELSE.S.LSGFI.H.TL.QP.S.PGF............VERLE..IFR...SETL.Ar...................................ldPVDK...K..KQAA..............DNA.A.MDELL......ETT.VGLen...............fviPDIP..I..ST..T..RAGL...YVYLNA..SLV.GRPLI.DDNALLSYLH---NRYQ.GET..........------QSSAIDLVLASF----.DIL.ANT.VFR.N..E.GQ..KDAHLLRS---FLINKVPLLLCQlcs..........pqfST.TSSE.........................FCITEALN.....QV.DT-.--..SV..F..P..TAS.LM..F....D..ES....RSNN.PY..T--.-.....-...---.-...ES.VREEFCTACALHGLVQ.REHVERILGE.TSM--.--..--.-.--SYEP.S.L..EK..Y.S.K.DKLVQDCLSDpek..................................iqgLVR......ELDKMDGNVGA......-------................---..-----.---.--....-------.VSQ...ALVELMR....QLCN..N.K..ETMSLKLLCGQ..L.-AQ...K...PQ.....SLDIL.LLFEK...L.P.AILEPLCQL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...D...Q....G.E...........YQP..........IYEE.FGAILLLVLAFAYRYSL...T..G.AD...I...GIT...........ST....---....--DSCITK..IL.N.RAHM..------.----..SREMDELTMQEKG..YINGWI.HGLFd......sEA..G.....GLGDDLM......S.SCPPQDF..YLLVASIFQNIVV.....AY...T...Y...........G......YL-....N..........DET.LKSGIE............Y................L....VDTFLLPS.LVPAIRFLADY......LW.VEQ.K.E..-....-.-.....-..--.QK....SI.I.KIL..QL.I.L.....L..P.S..S.I...S..GE...........ASTMLS..SVK....NLIAKPLEHSLRTYQKQD..PK....---------.---N..QDIEP.L...LRA-.....-......--.....--.--.-.LK.DSLP.LS...R.R.T...............-.-............G...GA.EH..NE..L.--E.......SW.A.SS...S..........S...T..G....LAGAVKHTVQGLv....qWS.MHHGin............vmpTSYT..HR..Q.MIAAC..RIMG...TGRV...LRVMLEEI.RHQSEA--....---.---..---...-.....GSANIVYDVV.AALICAPD.VT.N...E..P...P.A-.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------agnlldaagnvpptlqrrlklrevlrsdaqdcrklqkkdaalaeivvrlhrrveaqmvlpqpq.........................................................................................................................................................................................
A0A0C2W3K0_9AGAM/440-686               ..............................................................................................................................................................................................................................................................................................................eelkrsldlfva--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....DPNQQRV.FSE...QLLNKFT....DLSQ..T.S..DLTALSKLCEV..L.-YT...H...PE.....ALEIL.ALNLS...I.P.ELLKICLNF......VD-SL................D......-......-..........-.......-.......-....-....--...........-...W.........E.....N...T...D....-.D...........PQG..........AIEP.FGNVIMFLQSTIGRFKL...S..L.SI...F...TSP...........DG....---....---SNSAN..YL.M.QMGT.aLSP---.----..----TSLDLTETK..TYDEWY.KTLFd......pSI..D.....GVDESLV......R.SNNPKIL..LKLAPILLIEAIK.....ACgdpT...S...........G......AK-....N..........LEY.LRHGIN............Y................F....QESLLCWT.LAGV-------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------irsvalemerqgihapihadvlqrlvk.............................................................................................................................................................................................................................
A0A4S3JBF2_9EURO/1-800                 ..........................................................................................................................................................................................................................................................................................................................--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................---M.TDIR.VIQD.AM.L.S.VS..TG.H.APKS.......................................................--..-..-......-L.TE.SL...GI..F..S..AIVDWIQA..V..V.SWHHNH....Vdtnqq...........................tgglisSPDAV.SL.F.E.SL....GI.......L....FAA.LS...G..T.S.KGLDvlsse...................shealkLKLGQ.A.LSAYL.P.LC.VE.-.---............VSLPL..RNR...LDGL.Q......................................KEFN...L..YGDL..............PSK.S.LEVSV......---.---....................----..-..--..M..D---...----NL..NLV.GRPML.DDGMLLNYLT---NRYG.GHY..........------EIMIEEVITATF----.DVL.SNA.MYR.N..E.SS..QVMFLFRS---FLVNKLPAFFAS................ML.SASMasl...................smdVCISHALS.....RL.DP-.--..NT..F..P..SFS.QM..F....S..--....MQGN.TV..L--.-.....-...---.-...SD.VRQEFLFACASHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTVP.V.G..--..Y.I.K.DELVMQINMHper..................................aeqLIS......EIESTEGNAGA......-------................---..-----.---.--....-------.IVS...AITEVMI....NLCN..Q.K..ETMTLKNICNA..L.-SR...R...PQ.....ALDVI.LLFQS...S.R.HVLQPLCAL......LD-SW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...H....G.E...........SQP..........VYDE.FGSILLLVLAFKYRYKL...Q..P.YD...L...GIT...........RS....---....--DSFVLG..LL.E.RGSC..------.----..TQKLDDLNEKQNK..NLGSWI.AALF........IA..E.....GISEETM......S.ACSPQEF..YLLVATLFNQSLG.....AC...E...A...........G......KL-....G..........FET.LKGGFE............Y................L....LEPFLLPS.LVFSLTWLGNH......IW.ESE.G.D..P....S.I.....P..--.--....--.L.KAL..QC.L.V.....N..P.S..S.I...S..RE...........AKEIHR..TVI....NITARSLEEQLNDVQTRQ.pTS....S--------.----..-----.-...----.....-......--.....TS.IK.P.IL.DALE.PC...L.S.F...............Q.R............T...GS.SH.rSE..L.--E.......TW.T.TH...T..........P...G..A....LLGSIRSTFQGLv....lWS.TSADmn............iapQLYT..HR..Q.IIAGI..QMLG...SVRV...LGVLVEEL.KLQTEA--....---.---..---...-.....GNGPLALDIA.AALICSPM.AE.S...-..-...F.AV.N...Q.SHYHT---VD.........P......SKEPL..PQCPILTLR.....................................DALMIQHENIPkIKEKDPLRAEVivr......................lyrqVNALVAPTTQV-..................-----......-..T.....NLDMSNIIQNM..Q----.-----......----.----.-.-..--.----------------------lgvedacles..............................................................................................................................................................................................................................................
A0A3D8QBR8_9EURO/529-957               .................................................................................................................................................................................................................................................................................................................vqvplierg--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.--SS..SQKLEELTGKQNK..NLGEWI.AALF........IA..E.....GISEETM......S.ACSPQEF..YMLVSTLFSQSLG.....AC...E...A...........G......KL-....E..........FDT.LKGGFE............Y................L....LEPFLLPS.LVVALTWLGNH......IW.ESE.A.D..P....T.I.....P..--.--....--.L.KAL..QS.L.V.....S..P.T..S.I...S..GE...........GREIHL..TVL....NITARSLEEQLKDVRARH.pTR....T--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DALD.PC...L.S.F...............Q.R............T...GS.CH.kSE..L.--E.......SW.S.SH...N..........P...G..G....FIGSFRATFQSLi....lWS.TSPDat............mapPSYT..HR..Q.MITAI..RTVG...APRI...LSALLDEL.KFQTES--....---.---..--N...T.....GTADIALDIA.ASLVSAPL.PE.S...-..-...Y.AL.D...Q.FQTHHEHAAS.........K......PSDNP..PRYPLLTPR.....................................DALNLIHESVPkLSEKDPLRAELvvr......................lyrrVNTLLAPPAQVApn..............ldMNVNVn...mdM..Nv...pVSMNMNIMQNM..HLDPS.GTGQPdqsmdmNMDS.SGNAhA.Q..GQ.GQSHGDEQANLNQIMDNAA---aav.....................................................................................................................................................................................................................................................
A0A2N5T6P7_9BASI/440-770               ............................................................................................................................................................................................................................................................................................................allsslcsnqliip--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................--E......DIEKLEQSNSApnhlvlGHHSDVE................LGL..QPL--.-YE.SL....GIDKQKP.ISElagKLQESIM....TATM..S.F..DLSTCISLTKA..I.-SS...L...-D.....SLCTI.LIWLQ...P.R.NILGPIRTL......LD-DW................N......N......I..........R.......N.......N....N....NQ...........VinnS.........D.....N...D...E....S.S...........SGS..........EFEK.FGGLLGWLQGVVGRFGL...-..M.SQ...L...GYH...........LG....---....TTKGFTIH..YL.S.NPST..---AYP.----..---LSSLPSTHTT..TLASWI.EALY........GS..S.....GIPDDLL......S.NTDPRIF..FTISATLFKQSFD.....AL...T...S...........G......LI-....D..........LQT.FRDGLS............Y................F....EHKLLIGGcAVGVVGWLLNE......LT.AAG.S.S..I....S.A.....T..SF.PT....AL.L.EIL..QA.I.L.....L..S.D..S.I...T..ST...........A-----..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------lrlvsarslallrgfdhsfs....................................................................................................................................................................................................................................
A0A0D2G1M2_9EURO/445-706               .......................................................................................................................................................................................................................................................................................................................agf--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.ISQ...AIVEIMH....NYCQ..N.K..ETQYLKDLANA..I.-IR...K...PA.....AINCI.ALFIR...P.S.FFLGPLCSL......LD-EW................R......-......-..........-.......-.......-....-....--...........-...W.........D.....E...I...H....G.E...........AQP..........VYDD.FGAVFLLILVTRARLGL...S..N.SE...L...GIR...........KK....---....--DGFLSE..YL.K.HETY..------.----..EHSLDDLSEEKKS..HLGNWI.NALY........LA..E.....GLSDELF......T.TCSPHDF..YLLIPTLLRQSIT.....AY...Q...Q...........G......KL-....T..........HDS.LKAGLD............Y................L....LEPFLLPS.LISALGWA---......-A.EVY.Q.Q..D....-.-.....S..VV.VG....KV.L.EVL..T-.-.-.....-..K.A..P.G...T..ME...........SRDIHH..TIL....TMCAPRLK----------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------lrlvssaakdsnid..........................................................................................................................................................................................................................................
C4JW55_UNCRE/2-894                     ....................................................................................................................................................................................................................................................................................................................wdplip--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..LYT....DVLQKLGYVG.....VPEVLKLLLSY.STIYdeshpiskags...........................................................dgravkrkrtiSTLM.TDNK.IIQN.AM.A.A.IT..MG.R.GPKA.......................................................--..-..-......-T.RG.AI...DT..F..N..AVADWISA..L..L.AWSPSG....Egpdseh..........................fggilgHKDAA.CI.F.G.SL....GL.......L....LVA.LA...A..T.E.KGVNalssl....................skndrKRLGQ.A.LSSYT.T.VC.AG.-.---............YSIPL..KSR...LDSI.Qkdfnlysgden...............kgledsmmgdvnVAVL...Q..FESNvv..........dsPAI.S.SRAGL......---.---....................----..-..--..-..----...YIYINA..LLV.GRPLV.DDNMLLNYLN---NRYG.GHH..........------MVMVEELITATF----.DVL.SNG.MYR.N..E.SS..KTMFLFRA---FLVNKLPPFLT-................YM.SASSmas..................ipmeLCITRSLS.....RV.DP-.--..NT..F..P..SFS.ET..F....S..--....MQGN.SV..L--.-.....-...---.-...SD.VRQEFLFSCALHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTLP.V.G..GQ..F.T.K.DKLIMQMNNNfer..................................aeqLLN......GIESMDGNAGA......-------................---..-----.---.--....-------.IVD...AITELMH....NLCS..R.K..ETMTLKNICNS..L.-SR...R...PQ.....ALDIM.LLFKS...P.A.SILQPLCSL......LD-AW................K......-......-..........-.......-.......-....-....--...........-...W.........D.....E...E...Q....G.E...........NQL..........VYDE.FGSILLIVIAFKYKYDL...T..P.LD...L...GID...........SP....---....--DSFVLR..LL.E.TGAA..------.----..SQRLDDLTEKQKQ..NLGAWI.AALF........VA..E.....GISDESM......S.SCSPQEF..YLLVATLFSQSLL.....AC...E...A...........G......KI-....E..........FET.LKGGFE............Y................-....--------.----------H......IW.ESE.T.D..L....T.T.....S..--.--....--.L.KIL..HG.L.V.....R..P.A..S.I...S..GE...........AQEIHR..TVL....CITSRTLESTLKDIRTRY.pSR....T--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DVLE.PY...Q.S.F...............R.R............T...GA.T-..NN..T.ELD.......TW.R.AN...P..........A..gG..G....LVTSIRNTFSSLv....lWS.TDPEis............mtpPSYT..HR..Q.LLAGV..GHVG...SEKV...LQGLIDEL.KLQTET--....---.---..---...-.....GSGDLAFDIA.ATLICAPI.AE.S...F..S...V.DQ.A...L.YRQA-----G.........D......AKYSI..PRCRFLTLR.....................................DALSLQRDSLSkLIETDPHRAEL.............................VVRLQRRLETL-..................CSIPQ......M.pP....gEVDVDNIIENI..H----.-----......----.----.-.-..--.----------------------lgvggasepqqqsqqlqtvadqsnqgavtti.........................................................................................................................................................................................................................
A0A017SLL4_9EURO/11-1001               .........................................................................................................................................................................................................................................................................................................................s-SAKQWKLFFDQCLKHRIDANEFKNLSNILAARCSVS-....................----...........................----------...........--------------.....---...-.....ES...VLVD..VLCDVRAvga.aagVKW...DPL..VPVy..iDCLCKTERVK.....ISSVLAGLLKR.SSILlqsqsqiqssd..........................................................esdkskqrkkngYTLM.TDIR.AIQD.VM.L.A.VS..TG.NnTPRT.......................................................--..-..-......-S.AE.AI...DI..F..S..AAVDWIQA..V..V.SWHQQH....Qqtg...............................glmgSPDAV.SL.F.E.SL....GI.......L....LAA.LS...G..T.T.KGVDvlssd....................heglkIKLGQ.A.LSAYL.P.LC.VE.-.---............VSLPL..RNR...LDSL.Qkefslygepas...............ksldmamvegmnVNAL...Q..FEASvm..........dgPVI.N.SRAGL......---.---....................----..-..--..-..----...YVYINS..MLV.GRPLI.DDNMLLSYLV---NRYG.GHY..........------KALIEEVITASF----.DVL.SNA.MYR.N..E.SN..RTMFIFRS---FLVNKLPAFFAT................-M.LAASmvt..................ipmeICISNALG.....RL.DP-.--..NT..F..P..SFS.QM..F....S..--....MQGN.TV..L--.-.....-...---.-...SD.VRQEFLFACASHRLIP.ESSIERLLGE.NPM--.--..--.-.--QAVP.V.G..--..H.V.K.DDLVSQIYANper..................................aeqLIN......DIESTEGNANA......-------................---..-----.---.--....-------.IVG...AITEVIH....QLCN..Q.K..ESMTLKNICIS..L.-SR...R...PQ.....ALDVI.LLFRS...T.K.QILQPLCTL......LD-NW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....S...D...Q....G.E...........NQP..........VYDE.FGSILLLILNFKYRYDL...K..P.YE...L...GIS...........SD....---....--DSFVLK..LL.D.RGSC..------.----..NQKLEDLTEKQNK..DLGAWI.GALF........IA..E.....GISEETM......S.NCSPQEF..YLLVTTLFSQSLG.....AC...E...A...........G......KL-....E..........FET.LKGGFE............Y................L....LEPFLLPS.LVVALGWLGNR......IW.ESE.S.E..P....T.I.....A..--.--....--.L.KTL..HS.L.V.....S..P.T..S.I...S..GE...........AQAIHQ..TVI....SMTARTLEEQLKDVRARH.pSR....T--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DALE.PH...L.S.F...............Q.R............T...GS.CH.rTE..L.--E.......SW.S.HSgngS..........V...G..G....LLGSVRNTFQSLv....lWS.TNPEis............mapPSYT..HR..Q.VVAGV..RMLG...ATRV...LRALEEEL.KLQTEA--....---.---..---...-.....GSGDLALDVA.AMIVSAPM.ME.S...-..-...F.TA.D...Q.MHYHPPENKD.........Q......SQQSK..HQQTATNLRspv..............................ltlrDALSIRHQDVPrISEKDPLRAEMivr......................lyrrVNAVTAPTAQVP.................sLDVSN......I.lG.....NMSVTDQSSQP..QARSQ.SQTQQ......QSQQ.QQQA.Q.Q..QA.QSQEQ-----------------qqpsqmdldad.............................................................................................................................................................................................................................................
C6H7Y9_AJECH/477-941                   .......................................................................................................................................................................................................................................................................................................................iaa--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.AITEPLCAL......LD-AW................K......-......-..........-.......-.......-....-....--...........-...W.........G.....E...E...Q....G.E...........SQP..........VYDE.FGSILLLILAFKHKYGL...S..H.YD...L...GIS...........NP....---....--DSFVLR..LL.N.HGSS..------.----..SQRLEDLDEKQKN..NLGAWI.TALF........IA..E.....GISDDSM......S.SCSPQEF..YFLVATLFSQSLA.....AC...E...T...........G......KL-....E..........FET.LKGGFE............Y................L....LEPFLLPS.LVTALTWLGHH......IW.ESE.S.D..L....A.T.....S..--.--....--.L.KLL..LA.L.V.....K..P.S..S.I...S..GE...........AQEIHR..TVL....LITAKPLEDQLKGVRTRH.pSR....N--------.----..-----.-...----.....-......--.....-D.IK.P.VL.EALE.PY...H.S.F...............Q.R............R...ST.AR.yGE..V.--E.......GW.A.AN...P..........A..gG..G....IVASIRNTFSSFv....fWS.TSPEis............mtpPSYT..HR..Q.IVAGI..RLVG...AVRV...LRGIIDEL.KLQAET--....---.---..---...-.....GSGDLALDIA.ATLICAPL.AE.S...-..-...F.AV.E...R.AA---FHPVD.........P......SKDSV..PHCSILTLR.....................................DALSLERESIPkLVNSDTLRAELivr......................lnrrVDALAAIPQMS-..................QEVSN......I..-.....DVGNIMQDINL..EEESM.GMTNQ......-RHD.QGGE.Q.A..GQ.QDQVADDAGDLNDM--------ldaavaa.................................................................................................................................................................................................................................................
A0A1Y2M7M8_EPING/3-994                 ...............................................................................................................................................................................................................................................................................................smvkewtvyldrclnqrvsvdvfdaat---------------------------AQLYRKSPLS-....................----...........................----------...........--------------.....---...-.....GR...KLAA..LLLKPRSs....cvNNV...DPR..VIAy..lERLLALKKVD.....ASDVLSATFYH.SKDRqtqaggdv.................................................................ldrestwsNSPE.LEEI.VCHR.LH.R.T.FA..AE.E.RPLS.......................................................--..-..-......-N.TE.GL...QT..L..I..VVTRWMKA..M..V.TSHTSD....Tmmqama..........................gisqqpQQQSI.NV.R.E.AL....GV.......L....VVG.LI...E..N.S.KILQtlnhp...................ttkglrKRLAQ.S.LASFI.P.FL.SH.N.SLGs..........qSSIEI..ANR...LEMS.Qkqhelyekpis...............vegvpgrnanleVAAL...Q..LEAVm...........dlPLV.S.TRAGL......---.---....................----..-..--..-..----...YVFLNS..LLV.ARPLT.DEFLIINYLH---SRYK.MDP..........------QNMGADLVTASF----.DIL.ANA.MYR.S..E.PP..STMFSLKS---FLINKVPILLSQl.............agS-.---Ifpm...................tpeMSITQALS.....HL.DP-.--..NA..F..P..AFS.QG..F....D..DI....MGGT.NS..L--.-.....-...---.-...SD.VRQDFLNACALHGHIT.TATVERLLGE.PPI--.--..--.-.---QGP.P.A..LR..Y.E.K.KALLDQCKNNfdk..................................antYID......EMENLDGNAGA......-------................---..-----.---.--....-------.IAG...AVTEFIA....HLCE..T.Q..GTMHLKQICSL..L.-SK...R...SQ.....CLDVM.LQFTS...P.A.SVLRPLCQF......LD-DW................H......-......-..........-.......-.......-....-....--...........-...Y.........D.....S...D...Q....G.E...........YQP..........VYDE.FGAILLLVMVFVYRYSL...S..P.AD...I...GIG...........PE....---....---SFIAR..LI.E.RSNH.gIAP---.----..----DELTEEQGK..HLASWL.KGLYd......sGN..E.....GLSNDVF......A.SCRPQDF..YLMVPTFFSQTVM.....AC...S...A...........G......VL-....S..........HET.VKSGME............Y................L....GETFLLPS.LIGGLSWMTGH.....aLK.QNH.N.D..-....-.-.....-..--.LD....AM.L.RIF..ND.A.V.....L..T.V..P.S...S..GD...........AQAMHS..TII....AMVSSRLEKCLRALQRRE.pTR....T--------.----..-----.-...----.....-......--.....-N.IE.P.LL.EAIK.AN...A.H.Y...............D.R............T...VY.AS.iRE..L.--E.......QW.T.NA...P..........N...S..T....LNTALRHTIRQLa....qWA.STAAin............pnpPSYT..HR..Q.MYTSS..STLG...VYQT...VLAIVDEV.KAQTEA--....---.---..---...-.....GNGAVALDIG.AAIICAPT.IE.N...S..P...I.SI.D...W.IG-------S.........S......LPAPA..PPRTRMNLR.....................................EMLKHAAEHAApLVSLDPSLAEA.............................TVRLHRRVEAQLaslgqa......galhqaAGAMH......L.pN....vNVNVNVVGMDM..QAQSL.SDDIT......KAME.HAAN.A.-..--.----------------------slvaddpldlpdadkkalersmeela..............................................................................................................................................................................................................................
A0A0D2XC79_FUSO4/413-655               ........................................................................................................................................................................................................................................................................................................................hi--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.---GRQ............Y................L....VDTFLLPS.LVPAIRFLADY......LW.IDQ.K.E..-....-.-.....-..--.QK....SI.I.KIL..QL.I.L.....L..P.S..S.I...S..GE...........ASTMLS..SVK....NLIAKPLEHALRTYQRRD..PK....N--------.----..QDIEP.L...LR--.....-......--.....--.--.T.LK.DSIP.LS...R.-.-...............-.R............T...GG.TD.lNE..L.--E.......SW.T.VT...P..........P...T..G....LSSAIKLTIQGLv....hWS.IHPAmn............smpTSYT..HR..Q.ILAAL..KIMG...PKRV...LHVILEEI.RQHTEA--....---.---..---...-.....GSASIVYDVA.ISLICAPD.AA.K...D..-...-.AP.A...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------vvdangnmlppvqrqrslrdllkveaegcrklqkkdpa..................................................................................................................................................................................................................
A0A0D2JJA9_9EURO/385-714               ...........................................................................................................................................................................................................................................................vctlhhlipaqiaaqlvgnddllkglsrglygkddlvaqvnanhtrgpklveeltrsdgsagy--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.ISQ...AVVEIMH....TYCQ..N.K..ETQYLKDLANA..I.-IR...R...PS.....AINCI.ALFVR...P.A.FFLGPLCSL......LD-EW................R......-......-..........-.......-.......-....-....--...........-...W.........E.....E...I...H....G.E...........AQP..........VYDD.FGAIFLLILVSRGRLGL...S..N.SS...L...GIR...........KK....---....--DGFLAQ..YL.E.REND..------.----..EESLENLSEERKS..HLGNWI.NALY........LA..E.....GLSDELF......T.NCSPHDF..YLLIPTLLRQSMT.....VH...Q...Q...........G......KL-....T..........HDS.LQAGLD............Y................L....LEPFLLPS.LISAMNWV---......AE.VFQ.N.E..R....M.V.....A..--.--....--.G.KVL..EA.L.I.....K..P.P..-.G...S..PE...........SRDIHH..TIM....ALCAPKLKMHLKAVEAQD..N-....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------nvdsilktldq.............................................................................................................................................................................................................................................
S7QMQ2_GLOTA/457-712                   ........................................................................................................................................................................................................................................................................................................psshapfadtvhrrfcsl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....--TS..S.L..EAEGLSNLCKL..L.-YV...Y...PI.....AMDLV.SLHCK...V.S.DMVARALMF......LE-EY................D......-......-..........-.......-.......-....-....--...........-...-.........C.....E...S...V....G.D...........PQT..........AVSH.LGDVVLFLQSTIAQFQI...S..S.RE...F...KLR...........ER....--T....LRLE----..--.-.----..----FL.ITPS..IQQIDQLAREDSN..AFYSWF.KALFd......sNS..E.....GIEDTIL......R.TTRPKTL..LRLAPLLFLHAIA.....FH...I...Q...........N......QM-....D..........KDV.LNNGVS............Y................F....LGPLLHWT.LVGIVKAL---......IT.EIQ.R.I..G....S.Q.....A..--.-R....AH.L.EVL..QI.L.L.....T..S.Q..S.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------cprpvlrlcgpsimrllviplvr.................................................................................................................................................................................................................................
A0A397GU15_9EURO/9-655                 .......................................................................................................................................................................................................................................................................................................................tpp---VQWGTFFRQCLMHRIDVNEFRDLSKLLFQKCPIA-....................----...........................----------...........--------------.....---...-.....EN...ALLD..ALLQTRSq....srIKW...DPL..LPLy..iDCLCRTGRVR.....TSTVLTSLLKY.SSIHesptse....................................................................grdgskcYTLM.TDIR.VIQD.AM.L.S.VP..TG.S.APKT.......................................................--..-..-......-N.AE.AL...AI..F..F..SIIDWIHA..V..V.AWHNSH....Fdpgqh...........................psgmmsSPDVV.SL.F.E.SL....GI.......L....LAA.LS...G..T.G.KGLEvlsad...................sheglkVKLGQ.A.LSAYL.P.LC.VE.-.---............VSLPL..RNR...LDGL.Qkefnlygerap...............ksldvpmmenmnVNAL...Q..FEASvm..........dgPVI.N.SRAGL......---.---....................----..-..--..-..----...YVYINA..MLV.GRPLV.DDNMLINYLA---NRYG.GHY..........------EALIEEILTAAF----.DVL.SNG.MYR.N..E.SS..RTMFVFRS---FLVNKLPAFFAA................-M.LAATmvs..................ipmeMCISHALS.....RL.DP-.--..NT..F..P..SFS.QM..F....E..--....MQGN.TV..L--.-.....-...---.-...SD.VRQEFLFACASHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTLP.V.G..--..Y.N.K.DELVSQINANper..................................aeqLIN......EIESMEGNAGA......-------................---..-----.---.--....-------.IVG...AITEVMH....NLCS..Q.K..ETMTLKNICNS..L.-SR...R...PQ.....ALDVV.LLFRT...S.K.QVLQPLCAL......LD-SW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........NQP..........VYDE.FGSILLLVLAFRYRFDL...R..P.AD...L...GIS...........SN....---....--DSFVLK..LL.E.RGSC..------.----..SQKLDALDEKQNK..NLGSWI.AALF........IA..E.....GISEETM......S.ACSPQEF..YLLVATLFSQSLE.....AC...E...T...........G......KL-....E..........FDT.LKGGFE............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------........................................................................................................................................................................................................................................................
A0A3N4HQB4_ASCIM/256-886               ...................................................................................................................................................................................................................................................................................................................plargai--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...YAWINA..VFI.GRPLI.DNDILTGYLH---NRYK.TDV..........------RGLICDFIIAIL----.DNI.SCA.ISR.G..E.SA..AFVFILRS---FLSNKVPLLLSG................PW.LAIPpl....................einDWLQYALS.....RV.DSG.SL..YN..I..S..ASR.AD..P....L..AK....SGRG.AD..LF-.-.....-...-AL.P...VD.VRQEFLFACVLHNVLE.EGAIQGILGD.LPS--.--..QA.G.ASQKLY.E.Q..DL..A.R.L.FQQDPDKIEV........................................KME......EIGTMEGNSGA......-------................---..-----.---.--....-------.VVR...AVVQTMQ....SLCH..N.R..ETITLRTICSY..L.-IR...K...PP.....FLDVI.FLFEK...P.E.TLLKPLYQL......LD-NF................Q......-......-..........-.......-.......-....-....--...........-...L.........D.....E...D...D....Q.E...........CQP..........VYEE.FGYILLLVLTIMYRYDL...K..P.DD...Y...GGV...........FV....---....--PQLFKK..VL.L.ANST..ISD---.----..---DA----ENRR..KTEGWI.KELF........EE..Q.....GVSNALM......S.SCQPQEF..YNIVPNIISDTLL.....AA...H...E...........Q......QL-....N..........LQA.LHSGIQ............Y................F....LQPFLLPS.LLGVLSWLCNH......LW.ETS.E.S..Q....K.L.....K..--.LP....--.L.EVL..QA.L.V.....L..P.P..S.L...S..EE...........ARPMHQ..TVV....SLAAPIIDRTLRQLIHTD..--....A--------.----..-----.-...----.....-......NL.....TA.AE.K.IL.SGIS.PY...I.N.T...............-.R............R...VS.KA..TQ..R.ELE.......SW.T.GS...G..........Q...G..G....MLGALRSSVSGLv....vWS.ASQDmn............aspPFYS..HK..L.ILTCC..TLSG...SRA-...---VVRAL.IDEVVKF-....---.--Q..AQS...P.....LLGDYAIDVA.ASVLSAPT.AD.D...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------fsrrverntqfilgeendmnsnfdsssrlldelkvqeetaiaksppkd........................................................................................................................................................................................................
A0A072NWY0_9EURO/389-906               ......................................................................................................................................................................................................................................................................qiihqligsedvtasfskglyskddlvtqvisnhsrgpklieelvrsdgsag--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....------S.LSQ...AIVEVIQ....HYCQ..S.K..ETQYLKDLANA..I.-LR...K...PS.....AINCI.SLFIR...P.A.YWLGPLCTL......ID-DW................R......-......-..........-.......-.......-....-....--...........-...W.........D.....E...I...H....G.E...........AQP..........IYDE.FGAVFLLILVSRARLGL...R..K.SD...I...GIR...........RK....---....--DGFLAD..YL.E.RENS..---EYT.----..---LSELSKDRES..KLSEWV.NALY........LA..D.....GLSDELF......A.NCSPHDY..YLLIPTLLRQSVT.....AH...Q...Y...........G......KL-....S..........SES.LNAGLD............Y................L....LESFLLPS.LISALNWVGRY......LN.N--.-.N..-....-.-.....L..AL.AG....--.-.-VV..LK.V.L.....T..K.S..P.S...S..AD...........SQDIHR..TIL....ATAAPTLRRRLEAAQSQDpnIQ....SAISIFSAY.QEFSfvPERES.LdgtIDIL.....G......S-.....LQ.SS.I.TC.LLTP.VT...S.L.D...............L.E............N...QS.LS.rYS..P.SLM.......R-.L.AL...R..........C...H..G....ADATLRSLIEVL......LQ.LSNSh...............nFLFA..LD..L.ISTII..CIAE...PK--...LRDVLR--.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------irynmlstvlrkgdalsaeavvrlyrqvetyttiltaqdmnldqfafahqlsnidtananldavvsgqgdgldlqaeqgheadgidqvlgeaaa..........................................................................................................................................................
A0A164UBQ7_9AGAM/474-741               ..............................................................................................................................................................................................................................................................................................................cvadltlkkfas--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....-LSR..S.L..DVDQLGTLCKL..L.SLD...-...-D.....RLLEI.LSLHT..sL.R.DFVAYGLLF......LE---................-......-......-..........-.......-.......-....-....-D...........F...D.........Y.....E...T...V....G.D...........PQS..........AVTL.SGEVVLFVQLLTYRYQL...K..P.CR...F...VVD...........ER....---....---ECKTI..YL.S.TIYQ..------.----..TLRPSTLSPEDRT..LFQAWS.SALFd......kSS..E.....GIEDNLL......R.MTNPEKL..LYLAPSLFSQAIA.....AT...L...T...........R......AI-....D..........LDV.LKSGVS............Y................F....LGGLLNWT.LVGVLNYL---......IA.DIN.R.A..-....G.F.....N..AL.CQ....--.F.EVL..QS.I.F.....A..S.P..G.C...P..--...........-----K..TVL....QICGHSLLRLLSDRKLEH..VK....QRYKV----.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ndtgirqa................................................................................................................................................................................................................................................
A0A086SW73_ACRC1/71-946                .......................................................................................................................................................................cysldprvppylqvlsdleyidapailralyryssshtliesyretsqgdgdgdgngnananannegkeqdtgsgttnakdtdtaslnanhihngeekkssvekkgsgdkrsngsaplrwkssywveevmffrlcksvhegqavrdt--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.NT.AL...EV..I..K..IVSKWLAL..F..A.QASSAF....Aadlla............................qmhnlQLEME.SA.R.A.AF....VP.......L....LLR.LT...D..N.P.SLLKviarp...................vakdarRELSE.N.LSNFV.P.TL.QL.V.NAG............TEKSI..AEK...LDFF.Rnavla............................kldpiDKKK...Q..AADA..............AMN.D.M----......---.--Ldsavg.........pdafevREVP..I..IT..T..RVGM...YIYLNA..ALV.GRPLV.DDGTLFNYIH---NRYR.GDN..........------QSAAMDLILASF----.DVL.ANA.VFR.D..G.GK..EDAHLLKS---FLINKVPLVLCQllp..........pgfSN.PSAE.........................LCITNALN.....QV.DT-.--..SL..F..P..TAS.LM..F....D..ES....RNNN.PY..T--.-.....-...---.-...ES.VREEFCAACVLHGLIN.REHVEAILGE.MSMSY.QP..EK.-.------.-.-..--..K.S.K.DKLVQDYQSHtik..................................vqdLLG......DLEKMDGNVAA......-------................---..-----.---.--....-------.VSH...ALVEIIR....KLCD..E.K..DTMSLKLLCTE..I.-VQ...K...PQ.....SLDML.LLFET...L.P.GIVGPLCQL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....D...D...Q....A.E...........YQP..........VYEE.FGAILLLVLAFVNRYSL...R..P.SD...I...GLY...........NP....---....--KSSVRR..II.T.HGRF..H-----.----..-RDPSRLSEEENK..HLHRWI.VGLF........DNegG.....GLGDELM......S.SCPPQEF..YKLVAPLFYNIVV.....GY...S...H...........G......YI-....T..........EDS.LKSGVE............Y................L....VDTFLLPS.LVPALRFLADY......LW.VDQ.K.E..-....-.-.....-..--.QK....AI.I.RVL..QL.I.L.....L..P.S..A.I...S..NE...........ASAMLA..SVK....KIVAKPLDNALRNYLNRR.dPK....N--------.----..-----.-...----.....-......--.....QD.IM.P.LL.NALE.DS...I.P.M...............SkR............T...GL.PD.lSD..V.--T.......EWcK.SK...P..........D...G..G....LYALLKGVTQGLi....qWS.MQPAms............vmpITYT..HR..Q.FTMGI..RLIG...PQGV...LRLLLEEL.RSHTRSD-....-AD.MRN..QND...Q.....QQ--------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------qqqqqqqqqln.............................................................................................................................................................................................................................................
A0A1B7NR07_9EURO/9-964                 ......................................................................................................................................................................................................................................................................................................................sssa----LWKTLLHRCLSQRTDASEFRDLAKLMLNRYSIP-....................----...........................----------...........--------------.....---...-.....AK...RLLD..LILESRSv....tnVPW...DPL..IPLy..vDTLHRLERVA.....IEDILESLLAH.STVSqkqvpaqn.................................................................rsvtkapvSTLM.TDYC.IIHN.AT.I.A.AT..SG.H.APKT.......................................................--..-..-......-V.AD.AV...NT..F..S..ALANWISA..L..L.SWNSSR....Epvgdp...........................vgsltkSPDAL.AV.F.E.SL....GI.......L....FAA.LV...G..T.E.KSVNalstp...................kskgwrNKLGR.A.LSEYI.P.LC.AG.-.---............VSIPL..RDR...LEVL.Qkdfn..............................lyghDSEK...T..LEDT..............MME.N.VNISA.....lEFE.SNV....................LDGS..I..IN..S..RAGP...YIYVNA..LLF.GRPLV.DDSMFVNYLI---NRYG.GDR..........------MTLIEDLITAAF----.DVL.SNG.MYR.N..E.PN..RTMFIFRS---FLVNKLPPFFAE................MC.AS-Aidp..................ipmeLCITRALS.....RI.DP-.--..NA..F..P..SFS.EM..F....A..--....MQGN.SI..L--.-.....-...---.-...SD.VRQEFLFACALHKLIP.EASIERLLGE.NPM--.--..--.-.--QTLP.V.G..GQ..L.R.K.DDLVAQINSNper..................................aeqLIN......ELESMEGNAGA......-------................---..-----.---.--....-------.IAG...AITEVMH....SLCS..R.K..ETMTLKNICNS..L.-SR...R...PF.....SLDVI.LLFIS...P.S.TILQPLCAL......LD-AW................K......-......-..........-.......-.......-....-....--...........-...W.........G.....E...E...Q....G.E...........SQP..........VYDE.FGSILLLVLAFKHKYLL...S..H.YD...L...GIS...........NP....---....--DSFVLR..LL.Q.HGSS..------.----..SHRLEDLEEKQKN..NLGAWI.TALF........IA..E.....GISDESM......S.SCSPQEF..YFLIATLFSQSLA.....AC...E...T...........G......KL-....E..........FET.LKGGFE............L................-....--------.--MALTWLGHH......IW.ESE.S.D..L....T.T.....S..--.--....--.L.KLL..LC.L.V.....K..P.S..S.I...S..GE...........AQEIHR..TVL....LITAKPLEDQLKSIRMRH.pSR....N--------.----..-----.-...----.....-......--.....-D.IK.P.IL.EALE.PY...H.S.F...............Q.R............R...ST.AR.yGE..V.--E.......GW.A.AN...P..........A..gG..G....IVASIRNTFSSFv....fWS.TSPEis............mtpPSYT..HR..Q.IVAGI..RLVG...AVRV...LRGIIDEL.KLQAET--....---.---..---...-.....GSGDLALDIA.ATLICAPL.AE.S...-..-...F.AV.E...R.AVF---HPTD.........P......SKDAV..PRCPILTLR.....................................DALNLERDNIPkLMDSDTLRAELivrln...................rrvdaLTAVPQMPQEV-..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------snidvgnimqdinleeedmglsgqrhhqegeqpgqqdqgtdnagdlsd........................................................................................................................................................................................................
A0A364KKH4_9EURO/2-853                 .....................................................................................................................................................................................................................................................................................................................lmtdt--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.---R.IV.Q.D.LI..AP.L.SSSS.......................................................LS..L..N......TK.DI.Q-...NI..F..A..ITAEWILD..V..A.RWHASN....Ivdehq...........................mgglmsSPDAL.AL.F.E.SL....GI.......L....LVA.LS...A..T.T.KAHDaltse...................stsdfkITLGQ.A.LTAYL.S.TS.AT.-.---............ISLNL..RNR...LDSL.Qkgyqlygepps...............kdldvqmmdgmnMNAL...Q..FEASvl..........dgPVI.N.SRAGL......---.---....................----..-..--..-..----...YVYINA..LLI.GRPLF.DDEMLLSYLS---NRYG.GQQ..........------EVLIQELITATF----.DVL.SNA.MYR.N..E.ST..RNMFIFRS---FLVNKLPLFIAGmv............atS-.---Meqi...................pmeMCISHALN.....RV.DP-.--..NA..F..P..SFS.QM..F....E..--....MSGN.TV..L--.-.....-...---.-...SD.VRQEFLFACALHRLIP.EASIERLLGE.NPM--.--..--.-.--QTLP.V.G..GR..Y.V.K.DNIVAQILSNqga..................................adrLIS......EIEMMEGNAGA......-------................---..-----.---.--....-------.VVA...AVTDVIH....SLCE..Q.K..ETVTLKSICDS..L.-SR...R...PQ.....VLDAM.LLFRS...P.K.SILQPLCTL......LD-SW................K......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQP..........VYDE.FGSILLLVMAFKYRYDL...S..Q.YD...L...GVT...........AS....---....--SSFVLK..LF.E.RGST..------.----..SMKLTGLDAKQNK..SVGDWI.SALF........MS..E.....GISEETC......-.-------..---------QTLG.....AC...E...M...........G......ML-....E..........LDT.MKGGFE............Y................L....LQPFLLPS.LVFALKWLGNY......IW.ESS.E.A..D....L.L.....L..--.--....-L.L.KVL..HA.L.V.....K..P.S..S.I...S..GE...........AEACHR..TVL....NIAARGLEEQLKDVRTRLpgGR....S-----DNQ.SDIQ..PSPHQ.D...IQQ-.....-......--.....-E.IQ.A.IL.DILD.PY...L.S.F...............Q.C............N...GN.SR.rSE..L.--D.......SW.T.TH...A..........D...-..G....ICGAIRVTFQGLv....lWS.ASAEms............mspHAYT..HR..L.ILAGI..RLST...ASNV...LSVLLDEL.KAQAEE--....---.---..--A...S.....GSLDLAIDIA.ATLICAPI.PE.S...F..A...Q.EQ.T...I.YHPLD-----.........T......TKEAF..PRCLLLTLR.....................................QALMIQHQNVPkLSEKDPTRAEVivr......................ltrrVNALLTPPAHVG..................-----......-..-.....ALDVSNIID--..-----.-----......----.----.-.-..--.----------------------dmnleaaaaaaaaghdvmdlsngngtpndqga........................................................................................................................................................................................................................
A0A2B7YZC3_9EURO/9-971                 ........................................................................................................................................................................................................................................................................................................................ns--TAQWRTLLRRCLSQRTDASEFSGFVKLMLNRYFIP-....................----...........................----------...........--------------.....---...-.....AK...RLID..IILVSRSv....tnVPW...DPL..IPLy..vDTLHRLGCVK.....TENILESLLAH.STVSqkrvpaqn.................................................................gsatttpvSTLM.TDYC.IIHN.AT.I.A.AT..SG.H.APKT.......................................................--..-..-......-I.AD.AA...NT..F..A..ALAKWILT..L..L.SWNSTH....Rpesdp...........................agsltnSPDTL.AV.F.E.SL....GI.......L....FAA.LV...G..T.E.KSVNalsas...................rskawrNKLGQ.A.LAEYI.P.LC.AG.-.---............VSIPL..RDR...LEVL.Rkdfnlyghdge...............ksledtmmenvnISAL...Q..FESHvl..........dgSII.N.S----......---.---....................----..-..--..-..RAGP...YIYVNA..LLF.GRPLV.DDSMVVNYLN---NRYG.GDR..........------MTLIEDLITAAF----.DVL.SNG.MYR.N..E.SN..RTMFIFRS---FLVNKLPPFFAE................MC.AS-Sidp..................ipmeLCITRALS.....RI.DP-.--..NA..F..P..SFS.EM..F....T..--....MQGN.SI..L--.-.....-...---.-...SD.VRQEFLFACALHKLIP.EASIERLLGE.NPM--.--..--.-.--QTLP.V.G..GQ..L.R.R.EDLVSQINNNper..................................aeqLIN......ELESMEGNAGA......-------................---..-----.---.--....-------.IAR...AITEVMH....SLCS..R.K..ETMTLKNICNS..L.-SR...R...PL.....SLDVM.LLFIS...P.S.TILQPLCAL......LD-AW................K......-......-..........-.......-.......-....-....--...........-...W.........G.....E...E...Q....G.E...........SQP..........VYDE.FGSILLLVLAFKHKYVL...S..H.HD...L...GIS...........NS....---....--DSFVLR..LL.Q.HGSS..------.----..SQRLEDLDEKQKN..NLGAWI.AALF........IA..E.....GISDESM......S.SCSPQEF..YFLVATLFSQSLA.....AC...E...T...........G......KL-....E..........FET.LKGGFE............L................-....--------.--MALTWLGHH......IW.ESE.S.D..L....T.T.....A..--.--....--.L.KVL..LA.L.V.....K..P.S..S.I...S..GE...........AQEIHR..TVL....LITAKSLEDQLKGVRTRH.pSR....N--------.----..-----.-...----.....-......--.....-D.IK.P.IL.EALE.PY...H.S.F...............Q.R............R...ST.AR.yGE..V.--E.......SW.A.AN...P..........A..gG..G....IVASIRNTFSSFv....fWS.TSPEis............mtpPSYT..HR..Q.IVAGI..RLVG...AVRV...LRGIIDEL.KLQAET--....---.---..---...-.....GSGDLALDIA.ATLICAPL.AE.S...-..-...F.AV.D...R.AAFHP---ID.........P......SKDAV..PRCPILTLR.....................................DALNLERDSIPkLMNSDTLRAELivr......................lnrrVDALTAVPQM--..................--SQE......V..S.....NIDVSNIMQDI..NLEEG.GMGMS......SQ--.----.-.-..--.----------------------ghnqggetsnqvdqgadntgdlnemldaava.........................................................................................................................................................................................................................
A0A1V2L8M3_CYBFA/65-827                .......................................................................................................................................................................................................................................................visalfsyltaqqqqnnvdllelgiqllvsigsslpddintsaltgeqtelvhvlsaeikdskpila--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................---D...E..LVASlekfq....rkktrSQS.I.TRGSI......SLS.SMAglp.............gpqpHSSF..M..KS..N..KQSK...LVWINA..AIQ.SWSTH.KPSFLGTFEQ-----FV.---..........-KVKNNQNILNELVAASFEGY-.-IV.SLK.---.-..A.KP..QSPIFAKNWELFLLKRFPLIIKD................LK.LKNI........................eSSLMNAL-.....TL.DPK.VL..QA..I..K..MST.DN..NinngD..SN....NDNT.ED..MFA.S.....F...PHS.S...PD.IRHEFLRSCIALQLLP.VGAYESILKQ.DASAD.GR..KL.I.TTDQVL.D.Q..FG..Q.P.V.SLEASLKKSLi......................................dINT......EFIPLE-----......------E................SGL..LEFFK.SVS.SM....EGTKQVE.FSN...HITSCIT....TFIA..N.N..DTSHLYRLSLA..L.-AL...V...PE.....CLHAV.LFHVS...P.T.TFLKPIMNF......LD-TW................Q......-......-..........-.......-.......-....-....--...........-...T.........N.....S...D...D....M.N...........FQD..........TYSS.FGCIFLLFLLTVKDFNI...P..L.VQ...L...ISM...........KD....QI-....DHESFCIN..FL.T.NIGT..------.-SSW..KSPTNDLNQHKSE..VLSGWM.AALF........DS..G.....GISDDLM......R.LSTVQEC..FELFPVIFQQAFV.....AC...K...Q...........G......LT-....D..........VET.VKGGLE............Y................F....LQPFLLSA.IVGLLSWCEGY......LW.KAQ.D.V..-....-.-.....-..--.-E....LV.V.SLL..KT.L.V.....T..P.L..E.L...S..GE...........SIYIHK..IVM....SIFGADLYKNLSELDSNS..--....-------S-.---P..LRVDAgF...LSSL.....R......QS.....VA.SA.K.TN.GFFE.ID...M.S.P...............K.I............K...HF.LS..SP..S.---.......--.-.GQ...N..........E...I..S....LSSVFHTEFQSLl....sWG.QSSS................vARYD..HL..F.VPNMQ..RLLG...ES--...--GLIDAF.VAEICH--....---.--A..QQL...N.....KNVQTVIDLS.AFVLVIDS.VG.F...S..S...D.SR.R...M.FLT-------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------slkeetipekptdtlipgydrmt.................................................................................................................................................................................................................................
A0A177VTZ5_9BASI/133-251               ..............................................................................................................................................................................................................................................................................................................tpipmleeylrv--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.-RSL..SYQLNQLSENERE..LIGRWV.TALF........DS..E.....GISDELS......R.DSPPKTM..LKLAPTLFAQSIS.....AC...A...T...........G......IV-....D..........LDT.LRGALT............Y................F....LQDLLSYT.LPGPIIWL---......LR.QLT.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------hypppspdss..............................................................................................................................................................................................................................................
A0A421J7N1_9ASCO/3-754                 .......................................................................................................................................................................................................................................................................................................................dim----DLHKLVKNSVRRSLPPNSFLYLFEQLDRRQSIS-....................-EK-...........................----------...........----ELYEYLMKFT.....NQR...A....yDN...KIQQ..YTLAVA-.......ASS...STR..MEQf..wANLVELERED.....QKKHFRGLYD-.-MII.................................................................................LKK-.-PQP.VAPE.LV.S.D.II..NL.H.FPKY.......................................................--..-..-......--.--.FE...QL..I..A..KNATGYSD..L..V.SLASTL....Wat.................................lldAYSTL.AQ.S.D.KL....KS.......F....VIY.IM...A..H.K.RFLR..............................EDVLE.Y.LLSKS.RpVL.SA.-.SNVel.......pnhVSDAK..DHS...LDSN.A......................................SSSL...I..RQLS.............gPIS.N.MK---......---.---....................--KN..T..RL..F..EIKK...YFWLLS..SMK.NWTFN.QDNFLKDYEKFCMSKSQ.SHI..........--VKKSYSLVYDITLSMFNGFA.VSL.ISH.---.-..-.EP..PYVLF--NWNNFIITRLPHILASvkfl.......astadS-.---Sdpss.................etleDAILNAFN.....AL.NES.TV..KA..I..T..ALD.SR..T....F..SY....----.--..---.-.....-...---.-...TD.LRQAFIKSCVYSGILA.VPSFHRFFPM.EAR-T.TQ..QM.L.SHEMHS.F.G..NI..E.S.V.QKGLEKTLLN........................................VSC......EFTSLE-----......------E................SGL..YEYIQ.SIP.KLl.kySKSKQIE.FTE...VLSTIVS....QLIE..N.N..DSEKIYRLMLT..L.INN...C...--.....EAMEL.FAFNAtrgP.L.DVIEKLIVF......LD-S-................-......-......-..........-.......-.......-....-....-S...........E...W.........G.....T...D...D....D.N...........FQE..........SYTH.FGVILLGIISMISIFSL...D..F.SQ...V...LVK...........TS...fTSD....YINNFFYR..LC.D.NLSN..K-----.APTT..TEEETTIVQNYNS..LCADWI.NALFd......dAN..D.....GLPDDLI......R.AVHVKQI..YQLIPIVFQQAVT.....AT...I...S...........K......TI-....N..........FKV.LTNGTD............Y................L....SQPFLIPT.MLSIIKWL---......LS.RME.T.V..G....L.E.....E..IY.--....--.L.STL..YE.L.V.....K..A.N..C.R...T..ENeea.....ineSFLTFR..GVL....LLVGHDIVTTIKKFPQWE.eN-....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------evaaktce................................................................................................................................................................................................................................................
G4UDR5_NEUT9/146-1112                  ..............................................................................................................................................................................................................................................................................................pivianlllkptkqssysldprrlqylt--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....-ILLNQKLVN.....PQSVLKVLHHY.STSQakiqseydasttnvaata............................................tkggqgqqgdkkpkrvfwqNSYN.DEEV.IFLR.LS.K.V.IT..HG.Q.GIRH.......................................................-A..S..D......AY.EM.AT...NL..S..K..WTTLFIDV..I..A.AFSRDT....Fgtiq..............................nmrtKQDME.TS.L.Q.AF....SL.......L....LVN.FL...G..N.Q.RVVSafsrp...................eakshrKGLAS.S.IDQLI.P.YL.LQ.N.PNT...........sGIAER..LEF...SRGQ.Al...................................agEESS...D..LKDA..............AVA.E.MHSYM......DNM.IGLd.................twQIPD..M..PI..VnsRAGL...YIYINA..ALV.GRPLI.DDHSLYTYLH---NRYQ.GDL..........------QTTAIHLILASF----.DVL.ANA.VFR.E..G.SK..TGHLL-KS---YVVNKVPLILGN................FA.ASSThmyp.................fdaeFCISQALG.....QV.DT-.--..NV..F..P..TLS.NM..F....D..--....MSNT.SS..SFQ.D.....S...---.-...--.VRQDFCFACQLHGLLS.ASAIETLLGE.ITY--.--..--.-.--QTLP.D.E..GR..Y.V.K.ETLVQACLEDfer..................................sqrLIG......ELDNMNGNVGA......-------................---..-----.---.--....-------.AAQ...AIVEVIG....TLCR..N.K..ETMTLKQLCSQ..L.-AS...K...PS.....SLDIL.LLFDK...P.Y.KILHPLCEL......LD-DW................G......-......-..........-.......-.......-....-....--...........G...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSIQLLLLAFVHRYSL...T..P.TD...L...AIR...........SP....---....--HSFVGK..LL.G.RGQL..------.----..SRPLDELSDQEKS..HLNGWV.HGLFd......sEA..G.....GLGDDLM......S.SCPPQDF..YLLMPTLFDQIVM.....AL...S...T...........G......CLN....D..........Y-L.LRSGLE............-................-....-----LPA.LLFLANNL---......--.--R.T.D..K....Q.P.....G..--.QG....AV.I.KIL..QL.I.L.....R..P.N..S.I...S..NE...........ASTMLS..SVL....NIVAKPLELSLRSYQR-Q.vP-....---------.--AS..QEVEP.L...LRAL.....K......EN.....LA.VS.SrTG.GADH.SE...L.E.N...............-.-............-...-W.T-..--..-.GTH.......HN.G.SG...S..........V...G..G....LYGAIRHTVQNLv....qWA.QHSPgn............gvpATYT..HR..Q.VLVAL..QICG...ARRL...LSALLKEL.KTQTEA--....---.---..---...-.....GNGSVAYDVV.TAIICAPD.VH.N...T..Pv.tD.DN.D...P.SSARE-GGDA.........A......NHPIT..KKQRRITLR.....................................EALKFEAEEFKkIQKSDPLMAET.............................VVRLHRRVEAQMalpp.........pppppAQ---......-..H.....HHHHQQTMLQP..ELSAL.GVVAG......DAM-.----.-.-..--.----------------------gdsimnaaavqvsgsdhhhpmdam................................................................................................................................................................................................................................
A0A5C3NJX4_9AGAM/273-713               ...............................................................................................................................anvttvfirtlrsttwtpqvfytqlllsavtclaqasssgtekrpailwrafvaarlprilvnfqfhdhtegadwrmalqfaltslfqrasllaqcdnvhfdafnategmessrlfardflqqlvaeglldstfannldqglvndnspkvitdaeesgtsleqyieskvmanpddpnaiafidkvcq--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....DPSCQAV.FAE...VIYRRFR....SCAT..S.S..ETEGLSHLCKF..L.-YT...H...PI.....TLDLVsLHCNM...S.D.MVAHASMLF......ED--Y................D......-......-..........-.......-.......-....-....--...........-...-.........C.....E...T...V....G.D...........PQT..........AVSH.LGDVVLFLHSAVAQFRV...N..G.QQ...F...KLN...........ER....---....------VS..RL.D.FLTA..LPI---.----..-QQADQLAKEDLH..SFNAWF.KALFd......sMS..E.....GIEDTIL......R.STRPKVL..LRLAPVLFLHAIT.....LH...T...Q...........G......QM-....D..........KDV.FNNGVS............Y................F....LGPLLHWT.LVGVTRGL---......LN.EIQ.H.K..G....F.Q.....A..-L.AH....--.L.EAL..QT.L.L.....T..S.S..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------acprpvlrlcspnvlrlfsvp...................................................................................................................................................................................................................................
A0A5C3M9F9_9AGAR/459-711               ......................................................................................................................................................................................................................................................................................................................evgt--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....----QAA.FAT...AVFKRFS....AVVN..S.L..DAESLSHICKI..L.-YS...Y...PV.....ALDII.ALHVK...M.E.DIIFFSLLF......LE-QY................D......-......-..........-.......-.......-....-....C-...........-...-.........-.....E...T...V....G.D...........PQT..........AFSH.LGDVVLFVQYCIGFFQF...E..R.KI...F...TKD...........G-....---....--RSLSSA..YL.S.STTT..VYN---.I---..----ETLSPEELA..CFTAWF.KAIFd......sSS..E.....GIEDTIL......R.TTQPKML..LRMSSTLFSQAIQ.....AV...S...A...........R......KI-....D..........ADV.LGNGVS............Y................F....TGSLLNWT.IVGVIKTL---......VR.ELE.Q.K..P....S.M.....P..AI.-H....--.L.QIL..HT.L.I.....L..S.A..S.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------cprpvlalcsapllalsa......................................................................................................................................................................................................................................
A0A151GI90_9HYPO/16-980                ....................................................................................................................................................................................................................................................................................smlrwsgflsrceakgitiddfrafvkiiyarcplppi--------------------------------------....................----...........................----------...........--------------.....---...-.....--...VIAN..LFLKPRPp....ndISP...NPQ..VPIw..fKVLTTLGYVD.....PPSILLSLYNS.SSLHvrlrrpqaeetaerg..................................................hsmhcwkmsfwieeflFYHV.LKVL.AEDA.CF.R.D.SR..SV.I.VLAR.......................................................VM..C..K.....wMD.LF.AS...AS..A..A..FTADVLEE..T..-.--INSE....V......................................RDEMY.GT.R.E.AF....VL.......M....LLR.FV...E..T.D.AVVKvlgkp...................vgkgarKEFFQ.S.LSRFI.Q.TL.PP.T.QAF............VDRLE..IFR...SETL.Ar...................................fnPVDK...K..AKAA..............TDA.A.MDELL......GA-.--Tvgle............nfvvPEMP..I..SN..T..RAAL...YVYLNA..SLV.GRPLI.DDSILLSFLH---NKYQ.GET..........------QASAIDLVLASF----.DLL.ANA.VFR.N..E.GK..KDSLLLKS---FLVNKVPLLLCQlcs..........pefST.TSSE.........................FCITEALN.....QV.DT-.--..SI..F..P..TAS.LM..F....D..ES....RSNN.PY..T--.-.....-...---.-...ES.VREEFCTACALHGLVP.REHVERILGE.TSM--.--..--.-.--SYEP.S.L..EK..Y.S.K.DKLLRDCLSDpek..................................iqgLVK......GLDKMDGNVGA......-------................---..-----.---.--....-------.MCQ...ALVELLR....QLCD..S.K..ETMSLKVLCSE..L.-AQ...K...PQ.....ALDVL.LLFEK...L.P.SILEPLCAL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...D...Q....G.E...........YQP..........IYEE.FGAILLLVLAFSYRYGL...T..P.AD...I...GIT...........SP....---....--ESCVAR..IL.T.RAHI..-SR---.----..--QADELTEQEKA..HIGGWV.HGLFd......sEA..G.....GLGDDLM......S.SCPPQEF..YLLVASVFQNIVV.....AY...A...H...........G......HL-....S..........DES.LKSGIE............Y................V....VDTFLLPS.LVPAIQFLSDY......LW.VEQ.K.E..Q....-.-.....-..--.-K....SV.I.KVL..QL.I.L.....L..P.S..A.I...S..GE...........ASAMLS..SVR....IMIAKPLENSLRSYQKQD..PK....N--------.----..Q----.-...----.....-......--.....-D.IE.P.LL.RALK.DS...L.P.L...............SrR............S...GS.AD.hNE..L.--E.......LW.A.GS...S..........S...S..G....LAGAVKHTIQGLv....qWS.IHHGvs............tmpTSYT..HR..Q.LVVAC..RIVG...TKRL...LRNMLEEL.RHQSEA--....---.---..---...-.....GSGHIVYDVV.AALICAPD.VS.N...E..T...P.AV.T...S.L--LD---VS.........G......NV-AV..PQQRRLSLR.....................................EVLKAEAYDCRkLQKKDAVLAEM.............................VVRLHRRVEA--..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------lmvvpqprailqtqdmsldlnggstslgdamaaaavqadamavdg...........................................................................................................................................................................................................
A0A550CN29_9AGAR/477-678               ..............................................................................................................................................................................................................................................................................................................avssqspeadql--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..--DLISRLCEI..C.CTQ...D...--.....VILDI.FALHK..rV.S.DLVAQAVLF......VD-DY................D......-......-..........-.......-.......-....-....--...........-...-.........V.....E...T...V....G.D...........PQT..........AYGH.LGKVILFIQETVARFHL...G..T.GP...W...NVG...........SR....---....---RVSAD..FL.R.SVSV..VYP---.----..---LDKLSEADKK..AYDAWL.HPMFr......gGD..E.....GIDDQIL......R.ATPPKTL..LRIAPTLFSNAMQ.....LH...M...T...........R......EL-....S..........NEA.LENGIS............Y................F....VGPLLSWT.LVGVI------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------qavlrelyh...............................................................................................................................................................................................................................................
A0A367KZ78_9HYPO/322-890               .........................................................................................................................................................................................................................................................................................................yiylnaavchfgldfys--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..-LV.GRPLI.DDAMLLSFLH---HRYQ.GET..........------QSGAIDLIVASF----.DIL.ANT.VFR.S..E.GP..KDAHLLRS---FLINKLPLLLCQlfa..........aqfST.ASSE.........................YCITAALN.....QV.DT-.--..SV..F..P..TAS.LM..F....D..ES....RSNN.PY..T--.-.....-...---.-...ES.VREDFCTACALHGLVR.REHVERILGE.TSMS-.--..--.-.---YEP.S.L..EK..Y.S.K.DKLVQSCLSDpdk..................................iqgLVR......DIDKMDGNVGA......-------................---..-----.---.--....-------.ICQ...ALVELIR....QLCD..S.K..ETMSLKLLCSQ..L.-AH...K...PQ.....SLDIL.LLFER...L.P.TVLEPLCQL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...D...Q....G.E...........YQP..........IYEE.FGGILLLVLAYAYRYNL...R..A.AD...I...GIV...........SP....---....--DSCVVK..IL.D.RAHI..-S----.----..-RPLNELTEQEKT..HVNGWI.HGLFg......sET..G.....GLGDDLM......S.SCPPQDF..YLIVASLFQYIVA.....AY...T...H...........G......YL-....N..........DDS.LKSGIE............Y................V....VDTFLLPS.LVPAIRFLADY......LW.VDQ.K.E..-....-.-.....-..--.QK....SV.I.KIL..QL.I.L.....L..P.S..S.I...S..GE...........ASAMLS..SVK....NLIAKPLEYSLRSYQKQD..PK....N--------.----..QDIEP.L...LRA-.....-......--.....--.--.-.LR.DNLP.LS...R.R.T...............-.-............G...GA.EH..HE..L.--D.......SW.S.NS...S..........S...S..G....MSGAIRHTVQGL......AQ.MHHGin............vmpTSYT..HR..Q.TMAAC..RMVG...TSRV...LRAMLDEI.RQQPEAYD....VV-.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------amlv....................................................................................................................................................................................................................................................
A0A135LTE0_PENPA/3-958                 .....................................................................................................................................................................................................................................................................................................................vrspv--------------------------------------....................----...........................----------...........--------------.....---...K.....EN...ELLD..LLLEARAs....ssVTW...DPL..LPLy..vDGLCKVGRVK.....SSSALASLLKH.SSVLdapgsgegdvea.........................................................qgspskakkqkpSTLM.TDIK.VIQD.VM.V.F.IS..TG.S.IPKT.......................................................--..-..-......-V.VE.AA...DI..Y..S..ATVDWIMA..V..V.AWHNHS....Ldvsqq...........................tgglmgSPDAV.SL.F.E.SL....GI.......L....LAA.LS...G..T.S.KGLEvlssdynqa...........svneipielkTKLGQ.A.LSSYL.P.LC.ID.-.---............VSLPL..RHR...LEEL.Qkvfnlypgqss...............kaldgpaidgvnVNAL...Q..FESSvm..........dgPVV.N.TRAGL......---.---....................----..-..--..-..----...YVYINS..MVV.GRPLV.DDTILINYLT---NRYQ.GHN..........------DVLIEEIITAAF----.DVL.SNG.VYR.N..E.SN..RTMLLFRS---FLVNKLPAFFAA................IS.AA-Smvp..................ismeMCISHALS.....RL.DP-.--..NA..F..P..SFS.QM..F....S..--....MQGS.SV..L--.-.....-...---.-...SD.ARQEFLFACASHKLIR.ESSIEQLLGE.NPM--.--..--.-.--QTLP.G.G..GP..Y.V.K.DDLVSQINNNher..................................aeqLIG......EIESMEGNAGA......-------................---..-----.---.--....-------.IVG...AVVDVMH....NLCH..Q.K..ETMTLKNICNS..L.-SR...R...PQ.....TLDVM.LLFRT...T.K.QVLQPLCAV......LD-SW................K......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........NQP..........VYDE.FGSILLLVLAFKYRYDL...S..P.SD...M...GIS...........NN....---....--DSFLLK..LL.D.RGAC..------.----..SQKLTDLSEKQNK..DLSAWI.GALF........IA..E.....GISEETM......S.SCSPHEF..YMLVTTLFDQSLG.....AC...E...S...........G......KL-....D..........FDT.LKGGFE............Y................L....LEPFLLPS.LVVALTWLGNH......IW.ESE.N.D..P....T.I.....P..--.--....--.I.KTL..HS.L.V.....K..P.S..S.I...S..GE...........AQAIHQ..TVL....NITGCPLEEQLKNVRTRN.qSR....T--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DALE.PY...L.S.F...............R.R............V...GS.CH.rSE..L.--D.......TW.T.SH...S..........A...G..G....LIASIRTTIQALv....lWS.ASPGis............mapHAYT..HR..Q.VLAGI..RILG...ATRV...LGAIIDEV.RQQTEA--....---.---..---...-.....GSGHIALDIA.TTMVCAPM.TE.S...-..-...F.AV.D...Q.NNYHP---VD.........T......SKEAL..PRCTILTLR.....................................DALSLQHENVPkIFESDPLRAEVvvr......................larrVNMLMAPPSQ--..................-----......V..S.....NIDVSNIIQNM..HLGVE.GQEDR......MDLE.PSAP.D.V..SR.NTANEDDPDNINQMLDKAA---ada.....................................................................................................................................................................................................................................................
A0A5C3PTJ1_9APHY/569-695               ..................................................................................................................................................................................................................................................................................................................tagmnvra--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..----DSLTGDEPA..AFTSWS.KALFd......pGS..E.....GIEDTIL......R.ATRPKTL..LKIAPFLFAHAIH.....SV...T...E...........S......KVK...mD..........KDV.LNNGIS............Y................F....LGPLLNWT.LAGVIRFL---......LS.DIQ.R.R..G....Y.I.....A..-P.VQ....--.L.DVL..KT.L.L.....T..S.P..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------scppt...................................................................................................................................................................................................................................................
G9NF32_HYPAI/33-902                    .......................................................................................................................................................................................................................................................................................................stfedyvqlvqsrhrlppe--------------------------------------....................----...........................----------...........--------------.....---...-.....--...IIAD..FFIRPIKs....ncVSP...DPR..IPPy..iSILTKLRYTD.....AVSILRSLYRY.SSLHalvpeqaqhdgdga....................................................ngegaarqdaqpassLRWK.SSSW.LEEV.MF.Y.H.VI..KL.L.VEGT.......................................................-A..F..R......DS.RT.AL...EL..I..H..ISSKWMVL..F..T.TASNSM....Tadmlggslqdpq..............vrhemetawgalVP---.--.-.-.--....--.......L....VLR.LV...-..-.-.---Dnaafvkvi.............sqpsakgarKVFSD.S.LASFV.Q.VI.QQ.S.PQ-............-LPQF..QQF...INKL.Elfrtev.........................lapldpvD---...-..----..............---.K.SKQAA......--N.AVMddildst.....vgvdnlviPEVP..I..TN..T..RAGL...YIYLGA..SLV.GRPLI.DDHALFSYLN---NRYQ.GDV..........------QQSAVDLILASF----.DLL.ANA.VFR.N..E.GP..RDAQLLRS---FLINKVPLILAQlcp..........pgfST.PSAE.........................FCITQALP.....HV.DT-.--..SV..F..P..TAS.LM..F....D..ES....RNNN.PY..T--.-.....-...---.-...ES.VREDFCSACALHGLIE.REHVERILGE.SSM--.--..SY.E.PSQEKY.S.-..KE..K.L.V.QSCLSDPDKIq......................................aLIR......DMDKMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALVELLR....QLCH..S.K..DTMSLKILCSQ..L.-VQ...K...PQ.....SLDIL.LLFEK...L.P.TILEPICQL......LD-SW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.FGAILLLVLAFAYRYSL...T..P.AD...I...GII...........SP....---....--DSNVAK..II.G.RAHI..------.----..GRELDELSEQENG..HLGGWI.HGLFd......sDA..G.....GLGDDLM......S.SCPPADF..YLLTATLFQNIVI.....AY...T...Q...........G......FLT....D..........-DA.LRSGVE............Y................L....IDTFLLPS.LIPAIRFLSDY......LW.VEQ.K.E..-....-.-.....-..--.QK....SI.I.KIL..QL.I.L.....L..P.T..S.I...S..GE...........ATTMLA..SVK....GIVAKPLEHSLRSYQRQD..PK....N--------.----..-----.-...----.....-......--.....QD.IE.P.LL.RVLK.DS...L.P.F...............S.R............R...TG.AA..EH..Q.ELE.......LW.A.TS...S..........S...S..G....LSGAAKHLIQGLv....qWC.VHTDet............ampTSYT..HR..Q.VIATL..KIVG...ASRL...LRVILEEI.RHQTLA--....---.---..---...-.....GNGSLVYDVA.TALVCAPN.VS.N...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------elpptsgllde.............................................................................................................................................................................................................................................
A0A409VYK2_9AGAR/630-866               ..........................................................................................................................................................................................................................................................................................................niqaifadalfkrfis--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....-SAT..S.L..DAEGLGHLCKI..L.-YT...Y...EH.....ALDIV.SLHVG...I.I.DLVHKALVF......LE-DY................D......-......-..........-.......-.......-....-....--...........-...-.........C.....E...T...V....G.D...........PQT..........AIRN.LGDVVLFVQYTVGRFKF...E..Q.KA...I...TRD...........NR....---....---TVSTG..TV.T.N---..IER---.----..--SGQDRTQEDAN..TYNAWY.KVLFd......tNS..E.....GIEDNIF......R.STKLKVL..LRIAPRLITNAIAhatgaSQ...K...M...........D......KL-....D..........KEV.LINGVS............Y................F....TEPLLNWT.LVPVIRSI---......IK.EIH.K.T..I....S.N.....P..SI.PD....EV.L.QIL..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------lksapk..................................................................................................................................................................................................................................................
A0A428PPL9_9HYPO/14-928                ......................................................................................................................................................................................................................................................................................................................tidf-----WKTFVSRCIARRVDTDRFEVLVQQVYAEHPLP-....................----...........................----------...........--------------.....---...-.....PA...VIAD..FFLRPQPs....ndNSL...DPR..IPPy..lQALTRLGYID.....TPSVLRALYKY.SSSHaqaqqqpnngddknetaq............................................ppktqikrwkssywaeeaiFYSL.TKAV.VEGR.AI.P.DsTI..AL.D.VVKI.......................................................IS..K..Y......MT.LF.TA...AS..T..A..FAADMLG-..-..-.QLHSPQ....I......................................RDEME.SA.R.A.GL....VA.......L....LLR.LC...E..N.D.ILVKavskp...................fakdarKELAT.S.LASFV.P.TL.QL.V.PEL............TEKLE..LFR...TETL.A......................................SLDP...A..DKKKq............vANA.A.MDELL......DST.VGLen...............fviPEIP..I..SN..T..RAGL...YIYLNA..ALI.GRPIL.DDNALFSYMN---NKYQ.GDV..........------QSSAIDLILASF----.DIL.ANA.VFR.N..E.GQ..KDAHLLRS---YLINKLPLLLYQlcp..........pqfPG.TSAE.........................FCITEALH.....HV.DT-.--..SL..F..P..TAS.LM..F....D..ES....RNNN.PY..T--.-.....-...---.-...ES.VREEFCASCVLHGLVQ.RDHVERILGE.ISLSD.EP..SL.Q.K-----.Y.S..KE..K.L.V.QDCLSDTDKIq......................................gLIP......ELDKMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALIELLR....QYCH..S.K..ETMSLKLLCSQ..L.-AA...K...PQ.....SLDVI.LLFEK...L.P.AILEPLCQL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLVLAFAYRYNL...T..A.AD...V...GAI...........TP....---....--DSCVAK..II.G.RGHI..-AR---.----..--QGDELTEQENG..HIGGWI.HGLFd......tEA..G.....GLGDELM......S.SCPPQEF..YLLVAPLFQNIVV.....AY...A...H...........G......YL-....N..........DES.LKGGVE............Y................L....VDTFLLPS.LVPAIRFLSDY......LW.LDQ.K.E..-....-.-.....-..--.AK....SV.I.KVL..QL.I.L.....L..P.S..S.I...S..GE...........ASTMLS..SVK....NLIAKPLEHSLRTYQRRD.pKN....Q--------.----..-----.-...----.....-......--.....-D.IE.P.LL.RVLK.DS...I.PlS...............R.R............T...GG.AD.iNE..L.--E.......SW.T.ST...A..........T...N..G....LASAIKHNIQGLv....hWS.MHPAin............smpTSYT..HR..Q.MLAAL..KLLG...SKRL...LHIILEEV.RQQTET--....---.---..---...-.....GNANSVYDVA.TSLICAPD.AV.K...-..D...A.PV.A...M.LD--------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------angnmppslqrprtlremlkaeaegckklqkkdaalaeivv...............................................................................................................................................................................................................
A0A0F4ZCP6_9PEZI/324-977               .....................................................................................................................................................................................................................................................................................................................sragl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...YIYLNA..CLV.GRPVI.DDAILCNWIR---NRYN.PEI..........------HVGIVDLILASF----.DVL.SNA.AFR.N..E.HR..STAQLLRS---YLTNKLPLLILNlal..........glyP-.---Ptl.....................seFCITTALG.....QV.DP-.--..SV..F..P..TLT.GM..F....D..DT....RNNN.-D..F--.-.....-...---.T...EN.MREEFCFACCLHGLIS.QANISALLGD.TYS--.--..--.-.---SLP.A.E..GK..R.V.K.AALVQECAGNsdy..................................ivsLLA......SLDKTDGNVGA......-------................---..-----.---.--....-------.VCE...ALVEVFG....ELCA..N.R..DTATLKTLCSQ..L.AL-...Q...PM.....SLDVI.QLFEK...P.V.KLLQPLCHL......LD-EW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...E...Q....T.E...........YQS..........VYEE.FGSVLLLVMVFAYRYNL...S..P.PD...M...GIR...........SP....---....--DSFVAR..LI.R.EGHL..------.----..SKALYELSPAEDA..CLTGWI.HGLFg......tDT..G.....GLSDELL......A.SCPPQDF..YLLVSTLFKNIVV.....AN...S...E...........G......CL-....S..........MEA.LKNGIE............Y................L....VDTFLMPS.LVPAVLFLAD-......--.QLS.V.D..Q....E.P.....E..--.QQ....AM.V.NVL..HM.I.L.....K..P.K..A.I...H..TN...........TGKMLA..AVK....NLTAKPLERALRRYQRRY..--....------PTS.EQ--..--VEP.L...----.....-......--.....--.LV.V.IK.DNIP.LS...R.R.T...............-.-............G...GA.DH..NE..L.--E.......SW.C.AT...P..........G...G..G....LAIAVRSTIQNFv....hWS.TDPLav.............tpTPYT..HR..Q.ILVAI..RRMT...AQHV...IRLIIDEI.KVHMSH--....---.---..--G...A.....PALSLMYDVA.IALIVSPE.VT.N...Y..P...E.PV.A...Q.L---------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------vddsgampiptqrrltlrevlgmkaatyktifrtdpvkaeivlrlhreveaqmapapvptlmdadk......................................................................................................................................................................................
L2FNN4_COLFN/49-984                    .......................................................................................................................................................................................................................................................................................................psvvadlflrpqphnhesl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...DPR..VPRf..lQVLSDLNYID.....TPSILEALYKY.STSRahsreaaqasn..........................................................ggnptsqtlrwaSSYS.AEEV.MFYR.LT.K.S.VA..QGtA.IPNTetgl..............................................aiakiM-..-..-......--.AS.WI...AL..F..TdaATAFTVDV..M..G.QLQNSQ....A......................................REEME.SA.R.A.AF....VA.......L....LLG.VC...E..N.H.TVMKafgsp...................eakntrKALSE.S.LANFV.P.TI.MQ.N.AGP...........iATRLD..MFR...TSTL.A......................................AFEP...V..DEQK..............NTS.N.VEIEDl....fDSS.VALen...............fviSELP..I..VN..S..RAGL...YIYLNA..ALV.GRPLI.DDMSIFNYLN---NRYQ.GDV..........------QTTTIDLILASFDVLA.NAV.SRN.---.E..G.NS..AAPLL-RS---FLMNKLPLLIE-................NL.SKHMypp..................ltaeFCITEALG.....RV.DT-.--..NT..F..P..TLS.SM..F....D..ES....RSNN.-P..F-T.D.....-...---.-...-S.VREEFCWACCLHGLVR.ESSIEGLLGE.TPY--.--..--.-.--QNLP.A.G..GR..Y.V.K.DNLVAECLADper..................................mqaLIG......ELDGKDGNAGA......-------................---..-----.---.--....-------.VCQ...ALTEVLG....QLCR..N.K..ETMSLKLLCSQ..L.-AQ...K...PL.....SLDVM.LLFEK...P.A.TILHPLCDL......LD-NW................K......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLVMAFAYRYNL...S..V.SD...L...GIV...........SP....---....--DSFVSK..LL.G.QGHQ..------.----..SRVFDELSEQQKG..HLDGWI.HGLFd......sEA..G.....GLGDELM......S.SCPPQDF..YLLVSTLFQNIVL.....AF...S...T...........G......HL-....S..........EES.LRGGVE............Y................L....VDTFLLPS.LVVAITYLSNS......LL.IER.S.E..-....-.-.....-..-C.QK....AI.V.RVL..KS.V.L.....E..P.T..S.I...S..KE...........ASDMLS..SVM....NIVAKPLEHSLRTYQRSD..PK....---------.---S..QEIEP.L...LRAI.....K......DS.....IP.LS.R.RT.GAAD.HV...E.L.E...............A.W............S...GV.QQ..HQ..-.---.......--.H.NH...Q..........N...V..G....FANTLRQTLQSLv....qWS.IHPAmd............rppPTYT..HR..Q.ILVAL..IILG...AKRL...LQLIYEDI.RQHSEA--....---.---..---...-.....GSGSIVYDVA.ANLVCAPD.AN.D...S..P...W.A-.N...A.LNFMD----N.........S......GNMPA..PIQKKLTMR.....................................EVLKSDAENCKrLQKTDMNLAEI.............................VVRLHRKVESQM..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------vvaqaaaiqadtmlqndlglgldggtgslddamaaatanv................................................................................................................................................................................................................
B6HSV8_PENRW/6-971                     .......................................................................................................................................................................................................................................................................................................................aip---EQWRTFLHQCLANRIDIDEFTDLSGLMFSRSPVK-....................-ENE...........................----------...........--------------.....---...-.....--...-LLD..LLLEARAs....ssVTW...DPL..LPLy..vDGLCKVGRVK.....SSSALASLLKH.SSVLdgsgsgegegeg.........................................................qssppkskkqkpSTLM.TDIK.VIQD.VM.V.F.IS..TG.S.IPKT.......................................................--..-..-......-V.IE.AA...DI..Y..S..ATVDWILA..V..V.AWHNNS....Mgasqh...........................tgglmgSPDAV.SL.F.E.SL....GI.......L....LAA.LS...G..T.S.KGLEvlssd...................ynqglkTKLGQ.A.LSSYL.P.LC.ID.-.---............VSLPL..RHR...LEEL.Qkvfhlypgqps...............ktlegpgidgvnVNAL...Q..LESSvm..........daPVV.N.TRAGL......---.---....................----..-..--..-..----...YVYINS..MVV.GRPLV.DDTILINYLT---NRYQ.GHN..........------DVLIEEIITAAF----.DVL.SNG.VYR.N..E.SS..RTMLLFRS---FLVNKLPAFFAA................IS.AA-Smvp..................ismeMCISHALS.....RL.DP-.--..NA..F..P..SFS.QM..F....S..--....MQGS.SV..L--.-.....-...---.-...SD.ARQEFLFACASHKLIR.ESSIEQLLGE.NPM--.--..--.-.--QTLS.S.G..GP..Y.V.K.DDLVSQINNNher..................................aeqLIG......EIESMEGNAGA......-------................---..-----.---.--....-------.IVG...AVVEVMH....NLCN..Q.K..ETMTLKNICNS..L.-SR...R...PQ.....TLDVM.LLFRT...T.K.QVLQPLCAV......LD-SW................K......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........NQP..........VYDE.FGSILLLVLAFKYRYDL...S..P.SD...M...GIS...........SN....---....--DSFLLK..LL.D.RGAC..------.----..SQKLSDLSEKQNK..DLGAWI.GALF........IA..E.....GISEETM......S.TCSPHEF..YMLVTTLFDQSLG.....A-...-...-...........-......---....-..........---.------............Y................L....LEPFLLPS.LVVALTWLGNH......IW.ESE.T.D..K....T.D.....P..-T.IP....--.I.KTL..HS.L.V.....K..P.S..S.I...S..GE...........AQAIHQ..TVL....NITGCPLEEQLKNVRTRN.tSR....T--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DALE.PY...I.S.F...............R.R............V...GS.CR.rSE..L.--D.......TW.T.SH...P..........T...G..G....LIASIRATLQSLv....lWS.ANPGis............mapHAYT..HR..Q.VLAGI..RMLG...ATRV...LSAIIDEV.KQQTEA--....---.---..---...-.....GSGHIALDIA.TTMVCAPM.TE.S...-..-...F.AV.D...Q.NNYHP---VD.........P......SKEPL..PRCAILTLR.....................................DALALQHENVPkISESDPLRAEVvvr......................lsrrVNMLMAPPSQ--..................-----......V..S.....NIDVSNIIQNM..HLGVE.GQEDR......MDLE.PSAA.D.V..AR.NTVNEDDPDNINQMLDKAA---ada.....................................................................................................................................................................................................................................................
A0A0G2HQW4_9PEZI/18-953                .................................................................................................................................................................................................................................................................................tsrrewqrflqrclfqrldfdkfaeyapllharhplghgpv--------------------------------------....................----...........................----------...........--------------.....---...-.....--...--AD..LVLRPTSw....nkYTL...DPR..VPHy..mQTLLDLGLVD.....TPAILAALYRY.STCHvllaadphlkredgeadg.............................................ggdkpaqapgknevtrwqSSFS.SEEV.IFYR.LT.K.A.VA..QG.L.AIKN.......................................................--..-..-......-S.RD.AL...DV..S..V..VMARWMTL..F..T.AASAV-....Fqaddddvimg..................gagskasqqrRDDMD.NS.R.A.AF....VM.......L....LLG.VC...E..N.P.VLLQalgkp...................fakgarKALSQ.S.LASFI.P.SI.MQ.N.ASQia........arLELFR..TET...LAGF.E......................................PIDK...K..KEAAna.........emdELL.D.ETLGL......---.--Qn..................lSIPD..L..HVdrS..RAGL...YIYLNA..ALV.GRPLI.DDAAFYNYLH---NRYQ.GDI..........------QLTAIDLILASF----.DVL.ANA.IFK.N..E.GQ..KTANLIRS---YLINKVPLILAS................FA.TPEPmyp..................fnseLCITNALI.....RV.DT-.--..NT..F..P..TLT.SL..F....E..NN....LSSN.PF..T--.-.....-...---.-...ES.VRSDFVTACCLHGLVP.ETSIDKLIGD.YTY--.--..--.-.--QTLP.A.G..GR..Y.N.K.DKLVQECLADplqe................................riqkLVT......ELESMDGNVGA......-------................---..-----.---.--....-------.CCQ...ALTEMLG....KLCS..N.K..ETMSLKTLCCK..L.-VG...K...PL.....NLDVL.LLFDK...P.T.TILSPLCEL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....D...D...Q....G.E...........YQP..........VYEE.FGSVLLLLLAFVYRYNL...S..A.SD...L...GIR...........SA....---....--DSFVAK..LL.A.NGQL..------.----..SRPLDELNDQEKN..QLNGWI.HGLFd......tDG..G.....GLADDLL......S.SCPPQDL..YLLIPTLFHNIVL.....AF...S...T...........G......NL-....T..........EET.LKTGIE............Y................L....VEPFLGPS.LVTGIMYLSN-......--.CLW.T.D..R....P.E.....E..--.NR....AT.V.KIL..QL.I.I.....R..P.S.qK.M...S..PE...........SSDMLN..TVK....NIVAKPLESGLRTYQRQN..PR....S--------.----..-----.-...----.....-......--.....QD.VE.P.LL.QVLK.GN...V.E.L...............S.R............R...TG.AA..GD..K.ELE.......QW.T.SS...G..........S...G..G....LTSSIRNTFQNLt....mWS.LNPGv..............mpTAYA..HR..Q.ILVGL..KLMG...ARRL...LQAILQEL.KQLTET--....---.---..---...-.....GNGSIAYDVA.IALVCAPD.AS.S...V..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------atdalaptpqqrrlslrealkweaeewkkiqkkdpamaetvvrlyqkve.......................................................................................................................................................................................................
F7VX65_SORMK/50-1013                   ...............................................................................................................................................................................................................................................................................................pivianlllkptkqssysldprrlqyl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....TILLNQKLVN.....IQSVLKVLHQY.STSHakiqsqhhadatheaata............................................nkgdqgqqgdkkpkrvfwqNSFN.DEEV.IFLQ.LS.K.V.IT..HG.Q.GIRH.......................................................-A..S..D......AY.EM.AA...NL..S..K..WITLYIDV..I..A.AFSRDT....Fgniq..............................nmrtRQDME.NS.L.Q.AF....SL.......L....LVH.FL...G..N.Q.RVVSafsrp...................dakghrKRLAA.S.IDQLI.P.YI.LQ.N.PNT...........sGIAVK..LEF...SRGQ.Tl...................................agEESS...D..LKDA..............AVA.E.MHSYM......DNM.IGLd.................awQIPD..I..PL..VnsRAGL...YIYINA..ALV.GRPLI.DDHSLYTYLH---NRYQ.GDL..........------QTTAIHLILASF----.DVL.ANA.VFR.Y..E.GS..KTGHLLKS---YVVNKVPLILGN................FA.ASSSpmyp.................fdaeFCISQALG.....QV.DT-.--..NV..F..P..TLS.NM..F....D..--....MSNT.SS..SFQ.D.....S...---.-...--.VRQDFCFACQLHGLLS.SSAIETLLGE.ITY--.--..--.-.--QTLP.D.E..GR..Y.V.K.ETLVQACLGDfer..................................sqkLIG......ELDNMNGNVGA......-------................---..-----.---.--....-------.AAQ...AIVEVIG....TLCR..N.K..ETMTLKQLCSR..L.-AS...K...PS.....SLDIL.LLFDK...P.Y.KILHPLCEL......LD-NW................G......-......-..........-.......-.......-....-....--...........G...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLLLAFVHRYSL...T..P.TD...L...AIR...........SP....---....--DSFVGK..LL.G.RGSL..------.----..SRPLDELSEQEKS..HLNGWV.HGLFd......sEA..G.....GLGDDLM......S.SCPPQDF..YLLMPTLFDQIVM.....AL...N...-...........-......---....-..........---.------............-................L....LDTLLLPS.LVPALLFLANN......LR.TDK.Q.A..G....Q.-.....-..--.-A....AV.I.KIL..QL.T.L.....R..P.N..S.I...S..NE...........ASIMLS..SVL....NIVAKPLELSLRSYQRQV..P-....---------.--AS..QQVEP.L...LRAL.....K......EN.....LA.VSgR.TG.GADH.SE...L.E.N...............-.-............-...-W.TG..--..-.-TH.......HN.G.SG...S..........V...G..G....LYGAIRHTVQNLv....qWA.QNSPgn............gvpTTYT..HR..Q.ILVAL..QICG...AKRV...LSALLKEL.KVQTEA--....---.---..---...-.....GNGPVAYDVV.TAIICAPD.VH.N...S..P...V.MD.D...D.PASTRGADAN.........H......NHTVQ..RKQRRITLR.....................................EALKFEAEDFKkIQKSDPLMAET.............................VVRLHRRVEAQMtlp...........ppppPPAQH......L..-.....-HHHQQAMLQP..ELSAL.GVVAG......DTMG.DSMM.N.A..A-.----------------------avavssgdhhqsvdams.......................................................................................................................................................................................................................................
A0A179IHU5_CORDF/483-904               .....................................................................................................................................................................................................................................................................................................................ahaiv--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.E..DTMALKPLCTQ..L.-AQ...K...PQ.....SLDVI.LLFDK...I.T.SILAPVCSL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.YGAILLLVFAFTYRYNL...S..P.LE...I...GIQ...........SV....---....--ESHVAK..II.A.KSHI..LRP---.----..---LDELSEQEMG..HVSGWI.NGLFd......nET..G.....GLGDDLM......S.SCPPHEF..YLLVAPIFQSIIT.....AY...T...Y...........G......YI-....N..........DES.LKGGVE............Y................L....VDTFLLPS.LVPAIRFLSDY......IW.VEQ.K.E..-....-.-.....-..--.QK....SI.V.KAL..QL.L.L.....T..P.S..S.I...S..GE...........ASTVLS..SVK....NLIAQPLEHALRTYQRQD..PR....N--------.----..-----.-...----.....-......--.....QD.IE.P.LL.RSLK.EN...I.P.L...............S.R............R...TG.GA..EH..H.EME.......SW.A.NG...P..........S...S..G....LFGAIRHTIQGLv....qWS.LQPGvn............vmpASYT..HR..Q.FIAGV..RIIG...PARL...LRLIMEEI.RQQSDL--....---.---..---...-.....GNASVVYDVA.ATLVAATD.ST.N...E..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------appvssnlldtagtmqsppqrplglrealetaaegykrlqkhdpflaea.......................................................................................................................................................................................................
D4AZE1_ARTBC/466-627                   .....................................................................................................................................................................................................................................................................................................................aivea--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...I...AE.....TLDIM.LLFKS...P.Q.AILQPLCVL......LD-SW................K......-......-..........-.......-.......-....-....--...........-...W.........E.....E...D...Q....G.E...........SQP..........VYDE.FGSVLLLVLAFKYKYDL...S..S.QD...L...GIF...........NP....---....--DSFMCR..LL.E.KGSS..------.----..SQKLEDLTQKQQQ..NLGAWV.TALF........IA..E.....GISDESM......S.SCSPQEF..YLLVATLFCQSLS.....AC...E...A...........G......KL-....E..........FDT.LKGGFE............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------cks.....................................................................................................................................................................................................................................................
A0A0D7BT94_9AGAR/450-793               ..............................................................................................................................................................................................................................................................................................................ervckdpaahat--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.FSK...ILLERVV....AMTT..S.M..EVEGLSNVCKI..L.-ST...H...GL.....ILDIF.SLYVP...V.S.GLLRHLILF......ID-KY................D......-......-..........-.......-.......-....-....CE...........T...V.........G.....-...-...-....-.D...........PQT..........AVSY.LGEIVLF-----TQYAL...T..Y.FN...M...DET...........SF....-KD....EDGTVSPR..FL.Q.TTAE..VRT---.----..---PDRMSTSHAT..AFKTWF.QTLFd......sSS..D.....GIEDGIL......R.SSQPKIL..LQISASLIFAAIK.....AK...D...E...........H......KI-....D..........NEV.LNNGVS............F................F....KEQLLNWT.SLGILKALTR-......--.EVH.Q.S..G....F.K.....-..QS.TH....--.L.DVL..QQ.L.L.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------taphcpktairlcgsqiiatlssknakacttfevgnlqsrvaevlgdteigrisraltstapnswhdqvrpviynaldqarsgqsifidvnrlsrsttptkllqslwn............................................................................................................................................
C5FF33_ARTOC/12-986                    ......................................................................................................................................................................................................................................................................................................................pkpe-----WRKLLQQCVIQRINSDEFQELARVMLRRYPIA-....................----...........................----------...........--------------.....---...-.....NK...DLVD..IILESRAv....tdFDW...DPL..IPDy..vDAVHKLAHID.....ISNILLSLLTH.SSIKsdiqrwkgqrkkrndea..............................................dqkndekealgsviakgpATLL.TDYG.IIQN.VI.T.A.VT..TG.Y.APKT.......................................................--..-..-......-A.LG.FM...NT..C..S..AIAEWILT..L..V.SWNTHA....Gsergeg.........................gggqllsSPDVV.SI.F.V.AV....GF.......L....FGA.LA...G..T.E.TGANalsfqna................dtfkhqrMKLAQ.A.LTAYA.P.LC.AE.-.---............ISIPL..RNR...LDQL.Q......................................KEFN...L..FAKG..............EKS.N.QDHVM.....eEIN.VST....................LEFE..S..RV..V..D---...----IP..PLV.GRPLI.DDNVLINYLN---NRYG.GNH..........------MALVEELITASF----.DVL.SNG.MYR.N..E.PQ..QTMFLFRA---FLVNKLPPFLSDla............gsV-.---Vepi...................pveLCITRALA.....RV.DP-.--..NT..F..P..SFS.EI..F....S..--....THGN.SV..L--.-.....-...---.-...SD.VRQEFLFSCALHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTLP.N.G..GR..F.V.K.HDLVSQINNNper..................................aeqLIN......GIESMDGNARA......-------................---..-----.---.--....-------.IVE...AISEVMH....NMCL..R.K..DTMTLKSICNS..L.-SR...K...PQ.....ALDIM.LLFKS...P.L.AILQPLCAL......LD-SW................K......-......-..........-.......-.......-....-....--...........-...W.........E.....E...D...Q....G.E...........SQP..........VYDE.FGSVLLLVLAFKYKYDL...S..Y.QD...L...GVY...........NP....---....--DSFMCR..LL.E.KGAS..------.----..SQKLEDLTEKQTQ..NLGAWI.TALF........IA..E.....GISDESM......S.SCSPQKF..YLLVATLFSQSLS.....AC...E...A...........G......KL-....E..........FDT.LKGGFE............Y................L....LEPFLLPS.LVMALSWIGKH......MW.KSG.T.D..L....T.T.....T..--.--....--.L.KLL..ST.L.V.....K..P.S..S.I...S..GE...........AQEIHH..TVL....SITARALGDELKTAKARH.pSR....T--------.----..-----.-...----.....-......--.....-D.IE.P.IL.QALE.PY...Q.S.F...............Q.R............A...GT.SN.rAE..L.--E.......GW.R.SN...S.........aP...G..G....MVTGIRNTFSSLv....lWS.TDPEis............mtpPSYT..HR..Q.LLAGL..KHLG...SVRV...LAGILEEL.KLQSET--....---.---..---...-.....GSGDLAIDIA.ATLICAPM.RE.Y...F..S...L.EQ.A...T.YQSV----GG.........G......LKDSL..PRCQVLNLR.....................................DALNLQRESLAkVIESEP-----.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------hraelivrlarrvdtltsipqmpqtvdnidvgnimadmdltgveddgqmqldvteqpkqqlqqqqnqittgtg...............................................................................................................................................................................
G4TV45_SERID/271-700                   ...............................................................................................................................................................................................................................................................................................................lettvstlvgl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.-HK..........WSNLAISQFCAELIRAAFAHYS.EA-.---.-YQ.S..R.RS..YPNNT-SIWSSFLYARLPALLQAl.............laRI.---Gaqpy.................pimeSAMGVAFE.....KL.PQ-.--..--..Q..P..NYS.LP..F....T..GM....----.-E..IDD.A.....S...PEL.S...PDsFRVEFLNSLFQMNLIT.ASAAKSLCEA.WKE--.--..EV.E.TESQLL.R.E..-M..-.-.-.-NDMKSLESF........................................VDF......FIDPSTSERV-......-------................---..QEILN.LF-.VK....DYRQQEA.FAI...YFFEKVT....TECD..Q.L..NLEAVSPICKL..L.-SS...R...PL.....VMDTL.ALHIS...I.T.QLVKRILYL......VD-HL................D......-......-..........-.......-.......-....-....--...........-...W.........E.....G...M...D....-.D...........PQS..........SMTS.LGPIILFLQATIGRLNF...S..S.HS...L...RKD...........DE....---....---GLSAD..YL.M.RAGS..------.----..TDTHSDLTSEEKV..AYTDWH.KALFd......aNS..D.....GIEDSLV......R.SRNPKIL..LKLLPVLVSDAIA.....AC...GrpgA...........G......SN-....E..........LAA.LNNGIN............Y................L....QESILSWT.LVGVIKCV---......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------alqmerapssvhaevlsqllksapanltkml.........................................................................................................................................................................................................................
MED5_PHANO/244-920                     ....................................................................................................................................................................................................................................................................................................................iflnsl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........---IDSQNMATDLITAAF----.DIL.ANA.MYR.S..E.PS..QNMFCLKS---FLINKIPILLLQ................IS.SSMFpm....................taeLSITQALS.....HV.DP-.--..NA..F..P..AFS.QG..F....D..DM....LGNT.NS..L--.-.....-...---.-...AD.VRQDFLNACALHGLIT.TATVERLLGE.TPM--.--..--.-.---QGP.P.G..TK..Y.D.K.STLLEQCKSNfdk..................................ismYID......ELDNLDGNAGA......-------................---..-----.---.--....-------.IVG...AIAEFIP....HLCE..T.Q..MTMYLKQLSSL..L.-FK...K...PQ.....AIDVI.LQFTS...P.A.SILRPLCQI......LD-DW................H......-......-..........-.......-.......-....-....--...........-...Y.........D.....S...D...Q....G.E...........YQP..........VYDE.FGAVLVLVMTFMYRYDL...T..Y.HD...I...GIG...........AE....---....---SFVAR..LM.T.KGNQ..------.----..SMLPDEMTDEQSK..HLGHWL.KGLYd......aGN..E.....GLSNDVF......A.SCSPREF..YFIVPTLFKQTVM.....AL...S...A...........G......IL-....T..........FES.VKGGLE............Y................L....METFLLPS.LIGGLIWMSSY.....aLI.QSH.S.D..-....-.-.....-..--.LD....AI.M.RIF..RE.V.I.....S..S.A..P.S...S..GD...........AQAMHS..TIL....SIVSSRLEKCLRTIQRRD.aSR....A--------.----..-----.-...----.....-......--.....NS.IE.P.LI.QAIK.GN...L.H.S...............E.R............S...MF.AS.mKE..L.--E.......QW.T.NA...P..........N...S..T....LHTSLRHTVQQLs....qWA.STSSiq............pnpPSYT..HR..Q.VYVSL..KIMG...ASKV...IKAIVDEL.KAQTEA--....---.---..---...-.....SNGAAALDVG.VSIICAPT.VD.D...S..P...V.PV.A...W.LS-------S.........P......IPASN..PPRTRLNLR.....................................EMLKHEFDNAAaLVATDPLAAET.............................VVRLHRRVEAQL..................SSIAEn....aL..QghgsvLNLPNVNMGDM..QSQSI.PDDIT......KAID.DAAA.A.S..IA.DDITTMDNKALQRSMDDL----tg......................................................................................................................................................................................................................................................
A0A0J8RX20_COCIT/10-991                ........................................................................................................................................................................................................................................................................................sgpewallleqcishriistefrdfsvimmrrhp-----------------------------------IS-....................----...........................----------...........--------------.....---...-.....EK...ALIR..IVLEARSa....tgLMW...DPL..IPLy..vEVLQKLGYVS.....LPEILKTLLLF.STIYddshpvskagp...........................................................ngkgvkrkkktSTLM.TDNK.IIQN.VM.A.T.IT..MG.Q.GPKA.......................................................--..-..-......-T.RG.AT...DV..L..C..AVADWIST..L..L.AWSPSG....Egpesdq..........................pgdilgHQDGA.CI.F.G.SL....GL.......L....LVA.LV...G..T.E.KGVSalssl....................skkdrKCLGQ.A.LSSYT.P.IC.AS.-.---............YSLPL..RNR...LDSI.Qkdfn..............................iypsDSSK...G..LEES..............MMG.D.VNVAV.....lQFE.SNVv.................diPTTS..-..--..S..RAGL...YIYINA..LLA.GRPLI.DDSMFLNYLN---NRYG.GDH..........------ISMVEELITAAF----.DVL.SNG.MYR.N..E.SS..KTMFLFRA---FLVNKLPPFLAY................-M.SASSmsq..................ipmeVCITRALS.....RV.DP-.--..NT..F..P..SFS.ET..F....S..--....MQGN.SV..L--.-.....-...---.-...SD.VRQEFLFSCALHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTLP.V.G..GQ..F.M.K.DTLIAQINNNper..................................aeqLLN......GIESMEGNAGA......-------................---..-----.---.--....-------.IVD...AIIEVMH....NLCS..R.K..ETMTLKSICNS..L.-SR...R...PQ.....TLDII.LLFKS...P.S.FILQPLCSL......LD-AW................K......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQL..........VYDE.FGSILLLVLAFKYKYDL...T..P.LD...L...GIN...........KP....---....--DSFILR..LL.D.TGAS..------.----..SQQLKDLTEKQNQ..NLGAWI.TALF........VA..E.....GISDESM......S.SCSPQEF..YLLVATLFSQSLT.....AC...E...A...........G......KM-....E..........FET.LKGGFE............Y................L....LEPFLLPA.LVMALTWLGNH......IW.ESE.S.D..-....-.-.....-..--.LE....TS.L.KIL..HG.L.V.....K..P.A..S.I...S..GE...........AQEIHR..TVL....CIASRTLEATLKDTRARH.pSR....T--------.----..-----.-...----.....-......--.....-D.IS.P.IL.DVLE.QY...H.S.F...............-.R............R...TG.AT..NQ..T.ELD.......SW.R.AN...P..........A..gG..G....LVTSIRNTFSSLv....lWS.TDPEis............mtpPSYT..HR..Q.MLAGI..GHVG...SERV...LQGLIDEL.KLQTET--....---.---..---...-.....GSGNLAFDIA.ATLICAPM.AE.S...F..T...L.EQ.I...L.YRQMD-----.........Q......DKYPL..PGCRMLTLR.....................................DALGIQRESLSkLIEADPHRAEL.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------iirlhrrvealcsipqiapgdvdvgnimdsihleavggddeqreqhqqqqpdadqsnqgvvaptgntpgnldamldaaa.........................................................................................................................................................................
G1XKU5_ARTOA/293-884                   ........................................................................................................................................................................................................................................................................................................................gl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...YVFINS..LLF.ARPLV.DDEYLIHHLL---NRYK.EIG..........------GQVALDLIIAALDCIA.NAI.SRS.---.E..S.ES..TIALF-RH---FLVNKIPLLLQRf.............nmPV.IQAQ.........................YVVTQALA.....KS.GS-.--..NP..L..S..-LD.PS..L....D..T-....---M.LD..L--.-.....-...---.S...ND.IKQEFLFACALHQIIE.ESSVEVILGD.VPL--.--..--.-.---QTM.A.K..RR..Y.T.Q.GELVAECMSDgdr..................................verLIS......EIEELDGNSGA......-------................---..-----.---.--....-------.IVG...AVVEMLR....IMCE..Q.R..ATMGLYTLCKN..L.-IS...R...PK.....TIDLL.LLYSS...P.A.TILEPLCIV......LE-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...D...Q....G.E...........YEP..........VYKE.FGYILLLILTIYYRHDL...C..F.SS...L...GPS...........IT....---....-STSFVPM..FI.K.QCWK.dISV---.----..--EDLGRMGDRHA..QLGGWI.KALY........EG..E.....GMTDEVM......Q.SCRPQEY..YSLVPTLMAQTVE.....AY...E...R...........G......VL-....D..........MRV.LKEGLD............Y................F....QLPSLIAS.EVAIIFWLTDY......IW.QTM.S.S..Q....G.D.....-..--.IS....NA.L.RIL..HT.L.V.....T..N.A..P.S...-..-E...........VTQTHK..TIL....AICSHSLERVLKDVLRSE.gTA....NN---PSSA.IHQ-..-----.-...----.....-......--.....-Q.AE.Q.IL.KHVS.SS...R.D.W...............R.R............T...GL.PS.tSE..L.--E.......GW.T.-K...H..........S...G..G....ILGALKSAVQGVv....mWS.STPDla............lqpAGWN..PR..L.LYAAW..RLLG...AK--...--EVVRVL.VDEVVSV-....---.---..--G...T.....DVGDVAVDLV.ASLIVAPV.VE.D...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------wrwkvgevtgrkehtsv.......................................................................................................................................................................................................................................
A0A1E4RWS7_CYBJN/73-894                ................................................................................................................................................................................................................................................................................................................gnfklatvls--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.---N.......................................................LE..S..A......LG.AN.QE...II..L..T..ALITQLRH..TpkI.PFNSQE....L......................................SDSVN.AL.V.D.YL....RY.......L....LNH.KS...S..N.D.LLMGaagrfivlfgg.......svphdltlaplsEEQSN.T.LKSFV.M.AI.QD.K.IPEvtddlteftekfMRKNS..VNI...RQSV.S......................................LTSP...H..SSTS..............---.-.-----......---.---....................HISF..M..KT..N..KLPK...VLWLNY..ALE.HWKTH.LPTFLVSFDH----FVR.VK-..........----TNQNVLNELLTTAFEGYA.IEQ.Q--.---.-..D.KK..GSQYFAKNWELFLLKRVPVLIRE................LK.LKST........................eSSLVSALS.....VI.LAK.AS..QA..I..K..LQA.NG..N....A..--....--SG.ED..MFA.S.....F...PST.V...TD.VRHEFVKSCIALQLLP.RSAFNTILKQ.DAAAY.SG..TI.P.TTDDIL.D.SmgEP..V.D.I.KAKFNHTVVE........................................VNP......EFTSLE-----......------D................SGL..LEFLQ.SVE.GM....EGTKQIQ.IAD...LILSSIQ....EFIK..A.E..DSAHLYRLCLG..L.SLS...V...-N.....SLHAI.VFHLS...P.Y.AILRPIMAC......LD-KW................Q......-......-..........-.......-.......-....-....--...........-...M.........S.....T...E...E....T.N...........FQE..........NHSE.FGGILLFFMLIVQKFSV...S..V.VD...L...VSL...........KT....-NV....ESESFCIN..YL.T.TLGS..S-----.--SR..RNPSLELNQHKSE..VITAWI.SALF........DS..G.....GISDDLM......R.LSNVQEC..FELFPIIFQQALI.....AV...K...Q...........N......LT-....D..........VET.VKGGLE............Y................F....LQPSLLAT.VVGIVSWCEDY......LW.RAE.D.V..-....-.-.....-..--.-D....LI.V.SLL..KV.L.V.....C..P.T..E.L...S..GE...........SVHIHR..IIL....SIFGPRLHKCLSTIDSS-..--....---------.----..PTIPS.K...IDPV.....F......LS.....SL.HT.S.IK.DSDR.LE...F.F.E...............V.G............T...SR.TL..DA..L.-FS.......ES.Q.TN...S..........H...A..S....LMHVFGTRFHALl....sWG.QSPV................lPLYD..HM..F.LPNMI..TFFG...IG--...--TVIDYL.LSQVQAA-....---.--Q..VSA...S.....KNSDLVIEVA.VFILVAPY.VGfS...S..H...D.KN.V...V.LATLKSQS--.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------lvpytykttpqlhellqellrrkehyeegtlqyetfdcf.................................................................................................................................................................................................................
A0A066V4B1_TILAU/568-780               ..................................................................................................................................................................................................................................................................................................................tqclqakl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-LVEQFT....GWIS..S.K..DLETAANWSRI..L.-VD...H...CA.....TLDII.VSHTS...P.Q.ELFRPVCQW......LN---................-......-......-..........-.......-.......-....-....--...........-...-.........A.....D...G...L....L.N...........PAE..........ESTS.VGTLILFAQLLIKRYQV...C..L.PE...L...SDD...........QL...sSVI....RSDSWAYQ..--.-.----..------.----..---LHELSKEHRA..LVDRWI.TALF........DS..D.....GISDELL......R.ESPPRTL..LLLAPTLFAQSIA.....TC...R...S...........G......LI-....D..........LEL.LRNGLT............Y................F....LEDPLSYT.LPGALLWL---......LD.EIQ.R.T..P....L.I.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------akser...................................................................................................................................................................................................................................................
M9LYX4_PSEA3/549-884                   ....................................................................................................................................................................................................................................................................................................fpeghklasevqnlaqslrmda--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......QLEGLALNTLF......-ETRVPS................DDP..MELLQ.RVA.SD....PGTHYSF.ARQ...LVVQ-VH....AWLE..Q.H..DLESIARWCRA..L.GDD...A...THg..gaMLDTV.MLYID...P.T.ELVDPLAGI......LD-HQ................D......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...L....G.Q...........TSD..........EQAT.LSNIILFVQLLCYRYSV...P..P.SR...I...SRF...........TSgasgEME....VDGTTRSA..EA.T.GGQP..FLASYL.ASAS.vCYPLSALGEEERG..LVGRWV.HALF........GN..E.....GISDDLI......Q.ASPPTTL..LRLAPLLFAQSIG.....AC...V...H...........G......VI-....D..........LET.LRGGLS............Y................F....LQDLLSFT.LPGALAWL---......LA.EIV.R.V..P....L.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------qpildvlaeaglqssvvdvpssdgtlanglprnansrtvhlevvall.........................................................................................................................................................................................................
A0A180FZN5_PUCT1/278-387               ......................................................................................................................................................................................................................................................................................................................gskl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------PETHKS..TLQVWF.KALY........CS..S.....GIPNALL......S.TTNPRIF..FAIAPSLFKQSFN.....AL...N...V...........C......LI-....N..........LQT.FRDGLS............Y................F....EHKLLI--.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------swaavgvldklsrlgpisstlyptnlleilkail......................................................................................................................................................................................................................
F9G7R4_FUSOF/36-270                    ...................................................................................................................................................................................................................................................................................adkkkqatnaamdelldsavgldnfvvaeipvsntragl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...YIYLNA..ALI.ARPLL.DDHALFSYMS---NKYQ.GDI..........------QSSAIDLILASF----.DIL.ANA.VFR.N..E.GQ..KDAHLLRS---FLINKVPILLYQllp..........pgfPG.TSAE.........................FCITEALS.....HV.DT-.--..SL..F..P..TAS.LM..F....D..ES....RNNN.PY..T--.-.....-...---.-...ES.IREEFCAACVLHGLVQ.REHVERILGE.ISL--.--..--.S.YEPSLQ.KhS..KD..K.L.V.QDCLSDTEKIq......................................gLVR......ELDKMDGNVG-......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------avcqa...................................................................................................................................................................................................................................................
I2G037_USTH4/566-899                   ..........................................................................................................................................................................................................................................................sevqslsqslrmdaqlegmalntlfetristddplellqrvasdsgthfifarqlvlqvqgwle--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..Q.H..DLESVARWCKA..L.SQD...A...CDgaggvMLDTI.MLYLD...P.A.EVVEPLASI......LD-HQ................D......-......-..........-.......-.......-....-....--...........V...-.........-.....-...-...-....G.Q...........TSD..........EPST.LSDVLLFVQLVCYRFDV...A..P.SR...I...KRY...........SVnqedDMQldgsSTQQDSAN..AS.S.SSPP.fLATYLA.TSSA..SYPLPSLTGENRL..LVSRWI.QALF........GN..E.....GISDDLI......S.ASPPPTL..LRLSPLLFSQSIS.....AC...L...Y...........G......II-....D..........LET.LRGGLS............Y................F....LQDLLSFT.LPGALNWL---......LA.EIP.R.V..P....S.Q.....P..--.--....-I.L.DVL..N-.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------eaglqaavvdvpssdgmlanglrrnttsrtvhlevlall.................................................................................................................................................................................................................
A0A1E3QSH7_9ASCO/182-573               ..................................................................................................................................................................................................................................................................................datarlcdavarvssalrtrdphtariltakyaalqqsaq--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..SSYS..............TQG.-.-----......SLK.SAVpka.............ptssSANS..A..AK..A..R--R...LLWLSP..MVH.QWQTA.AKNFLVAFEN----ALK.I--..........---QSPFLLVTELVAAAFDGYAiTRL.SNR.---.-..-.TT..LATLAEQNWRLFVTKKLPLLIRE...............lGI.HGAE.........................TTIVGTLA.....AL.DPK.VV..KV..L..K..KAA.DA..N....D..DF....MNLN.TDdsLLD.DdefnsF...PST.S...RD.IRHDFVVACAQLGLML.RDVFRRLAQE.KHL-D.--..-V.A.LDDDNW.S.A..SP..P.M.D.LAAEFARTLN........................................VNA......ELVSFE-----......------D................SML..TEFLQ.GIP.RA....PLGTQNE.FVE...VLLTTIG....QLVK..D.S..SLVALHRLCLG..L.-AT...V...PE.....VLDIV.VALQS...P.R.ALLVPLVRV......VD-SW................N......-......-..........-.......-.......-....-....--...........-...A.........D.....A...E...D....M.N...........FQD..........TYTD.FGCVLLLVIFVCKRYQT...S..P.SD...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------dsseg...................................................................................................................................................................................................................................................
A7E5V4_SCLS1/162-719                   ........................................................................................................................................................................................................................................................tqtlitilpvnkkeqaanaeindildstmgmnidniviadlpavnsraglyiylnslqclsdserv--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................EGL..ISELE.NMD.GN....AG----A.VSQ...AIAEVIK....HMCG..N.K..ETMTLKSLCSQ..L.-AR...N...PS.....SLDIM.LLFNK...P.T.SFLQPICEL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLVISFTHRYNL...S..T.VD...L...GIK...........NP....---....-AESFVAK..LL.V.QGHL..-SR---.----..--AFDPLSQQDQN..HLDGWI.RGLFe......pEG..G.....GLGDELM......S.SCPPQEF..YLLVPTLFHHIVL.....AL...S...T...........D......TL-....S..........EEG.LKGGLE............F................M....VEPFLLPS.LIPGITWLSAH......LW.EAR.H.Q..A....-.-.....-..--.-T....YI.L.QIL..SA.L.I.....K.nP.P..S.I...S..NNm.........eASHLLN..SIL....KIVAKNLEQSLRWLQRAE.pQR....Q--------.----..-----.-...----.....-......--.....-D.IE.P.IS.KALE.SN...I.G.W...............E.R............R...GA.SK.hSE..L.--E.......SW.T.AT...P..........G...G..G....MSASIKHTIAILv....qWG.LQWArnpg........mhimpASYT..HR..Q.ILSGL..KMLG...AKRL...LNIIIDEV.KAQTEA--....---.---..---...-.....GNGSVALDIA.TSLVCAPD.PT.S...-..F...D.SG.R...G.MDILS-----.........-......GNTPH..PLQRRLTLK.....................................EALKAEAENMPkVHKTDTFHAET.............................VIRLYR------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------rveaqsaiqqqllphedglnalnevmgdavmgd.......................................................................................................................................................................................................................
A0A0H2RBR4_9AGAM/457-716               ..................................................................................................................................................................................................................................................................................qelntyiesklsaetsfddalaflertmedvtnhtlisva--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.IKN...RFDSLCS....GKQD..A.A..SVEGLSILCKL..L.--N...A...HT.....VALDI.LSLQV..rI.T.DVVAAALHF......VD-NF................-......-......-..........-.......-.......-....E....CE...........V...V.........G.....-...-...-....-.D...........PQT..........AVGH.LGAVILFLQSTMVRYQL...A..S.FQ...F...TYA...........KG....---....---ALRAD..YL.L.STST..VFRRL-.----..-----EFNNEETA..AYLGWL.KALFd......sSS..E.....GIEDGIL......R.ATKPKTL..LKLTATLIQTVLQ.....LH...F...S...........Q......KI-....T..........LDA.LNNGIS............Y................F....TGDLLNWT.LVGVIKWL---......LQ.EIA.Q.K..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ewvfllsvcsl.............................................................................................................................................................................................................................................
W6Q159_PENRF/8-989                     .......................................................................................................................................................................................................................................................................................................................aip---EQWRTFLHQCLANRIDIDEFTDLSGLMFARAPVK-....................-ENE...........................----------...........--------------.....---...-.....--...-LLD..LLLEARAs....ssVTW...DPL..LPLy..vDGLCKIGRVR.....SSSALTSLLKH.SSVMdalgtgdgdgeeg......................................................qghgspskakkhkpSTLM.TDIK.VIQD.VM.V.F.IS..TG.S.IPKT.......................................................--..-..-......-V.IE.AA...DI..Y..S..ATVDWILA..V..V.AWHNHS....Sdseha...........................tgglmgSPDAV.SL.F.E.SL....GI.......L....LAA.LS...G..T.G.KGLEvlssd...................ynqelkAKLGQ.A.LSSYL.P.LC.ID.-.---............VSLPL..RHR...LEGL.Qkvfhlypgqps...............kalggpaidgvnVNAL...Q..FESSvm..........dgPVI.N.TRAGL......---.---....................----..-..--..-..----...YVYINS..MVV.GRPLV.DDTILINYLT---NRYQ.GHN..........------DVLIEEIITAAF----.DVL.SNG.VYR.N..E.SG..RTMLLFRS---FLVNKLPAFFAA................IS.AA-Smvp..................ismeMCISHALS.....RL.DP-.--..NA..F..P..SFS.QM..F....S..--....MQGS.SV..L--.-.....-...---.-...SD.ARQEFLFACASHKLIR.ESSIEQLLGE.NPM--.--..--.-.--QTLP.G.G..GP..Y.V.K.DDLVSQINNNher..................................aeqLIG......EIESMEGNAGA......-------................---..-----.---.--....-------.IVG...AVVDVMQ....NLCH..Q.K..ETMTLKNICNS..L.-SR...R...PQ.....TLDVM.LLFRT...T.K.QVLQPLCAV......LD-SW................K......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........NQP..........VYDE.FGSILLLVLAFKYRYDL...S..P.TD...M...GIS...........NN....---....--DSFLLK..LL.D.RGAC..------.----..SQKLSDLSEKQNK..DLGAWI.GALF........IA..E.....GISEETM......S.SCSPHEF..YMLVTTLFDQSLG.....AC...E...S...........G......KL-....D..........FDT.LKGGFE............Y................L....LEPFLLPS.LVVALTWLGNH......IW.ESE.T.D..P....T.I.....P..--.--....--.I.KTL..HS.L.V.....K..P.N..S.I...S..GE...........AQAIHQ..TVL....NITGCPLEEQLKNVRTRN.qSR....T--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DALE.PY...I.S.F...............R.R............V...GS.CR.rSE..L.--D.......TW.T.SH...S..........A...G..G....LIASIRTTLQALv....lWS.ANPGis............mapHAYT..HR..Q.VLAGI..RMLG...ATRV...LGAIIDEV.KQQSEA--....---.---..---...-.....GNGHIALDIA.TTMVCAPM.TE.S...-..-...F.AV.D...Q.NNYHP---VD.........P......SKEAL..PRCAILTLR.....................................DALSLQHENVPkISESDPLRAEVvvr......................larrVNMLMAPPSQ--..................-----......V..S.....NIDVSNIIQNM..HLGVE.G-HED......RMDL.EPSA.AgV..SG.DTVNEDDPDNINQMLDKAA---ada.....................................................................................................................................................................................................................................................
A0A094CU64_9PEZI/21-759                ...................................................................................................................................................................................................................................................................................leqfakvlstksplatpliaelllrpsesrhyeldpqvs--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..LYA....QALLQIGILD.....VPSVLRALLRH.STSRpveaakdeqe.............................................................ganssqtrwtKSYG.HEER.LVYG.LS.K.I.VA..AG.D.RPKS.......................................................--..-..-......-A.QE.AL...GT..V..N..ALTEWMRL..L..V.MTNAAD...dMmreig...........................agndahNQETT.AV.R.V.AV....GA.......L....LVA.LA...E..N.T.TVNEalrnr...................cpkdtlKGFSQ.S.LSNFT.P.LL.IN.G.SSM............FAERL..ELY...TKTL.Valepvd.........................kkaqkagA---...-..---Eid..........qiIDS.A.-----......---.--Malgmd..........nipvvEIPT..M..NS..R..A-GL...YVYLNS..LLT.GRPMV.DDNQLLNFLH---NRYQ.GDI..........------QTTCIDLIVSSF----.DIL.ANA.IFR.S..E.NT..ETTFLLRS---FLINKVPLLIS-................-I.ISAPmfpp.................lspeLCITEALT.....HV.DT-.--..NA..F..P..TFS.SM..F....D..DT....--SA.GD..MFS.D.....S...---.-...--.VRQDFCFSCCLHGLIP.EESIERLLGE.IPM--.--..--.-.--QTLP.A.G..GC..Y.T.K.DEVLEQCLSDsek..................................ieaFTD......ELEHMDGNVGA......-------................---..-----.---.--....-------.VSE...AITELLR....RLCE..N.K..DTMALKSLCVH..L.-AR...K...PS.....SLDVL.LIFDK...P.L.TFLPPICQL......LD-TW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...D...Q....G.E...........YQP..........VYEE.FGSILLLVLAFVYRYDL...S..A.TE...L...GVQ...........TP....---....--DSFIAK..LL.I.RGST..------.----..ARHMDDLSSLETS..QLDGWI.KGLFn......aEG..G.....GLGDEPM......A.LCPPQDF..YLLVPTLFNQIVL.....AS...Q...H...........G......HL-....T..........NDV.LHGGLE............Y................L....LDPSLLPS.LIPALLSLA--......-S.NIL.T.T..P....P.P.....-..--.--....--.S.SLL..NA.L.I.....L..P.Q..S.I...S..AE...........ASLLHN..AIL....PLPAPHLSRALRALQRAT.pSR....---------.----..TDLEP.L...ITAL.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------rphlhfsrsain............................................................................................................................................................................................................................................
A0A553I5E0_9PEZI/54-947                ......................................................................................................................................................................................viadiclrpqpsnhesldprisrylqvltqhqlvdtpsilnglckystsqmylhtpgadvhdqaqdqdqlplrwassytpeeilfyrlskavrlgsgirnagealgicvqmarwmtmfttasaafaqdvmaq--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..L......QN.TS.RE...EM..E..A..ARAAFVML..L..L.SVCENH....Lv...................................lrGLSRP.AA.K.E.SL....AS.......FipsiLQS.SS...Q..I.A.SRLE..............................LFRTE.T.LASFE.P.VD.KN.K.KEV............SNMDI..DDL...ESSM.A......................................LDSI...V..IPDI..............PIS.N.SRAGL......---.---....................----..-..--..-..----...YIYLNA..LLV.GRPLI.DDAALFSYIH---NRYQ.GDI..........------QTTTIDLILASF----.DVL.ANA.VFR.R..E.DQ..KTGHLLRS---YLINKLPLLLATl.............agS-.---Mfap..................ltpqYCITEALA.....QV.DT-.--..NA..F..P..TLS.AM..F....D..--....TNNN.NN..MFT.D.....S...---.-...--.VRQDFCFACCLHGLIP.ESSIESLLGE.ITY--.--..--.-.--QTLP.Q.D..GR..Q.V.K.ETLVERCIADper..................................iqeLVR......EIDNMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALIEMIG....RLCA..N.K..ETMSLKLLCSQ..L.-AK...K...PL.....SLDVM.LLFGK...P.A.AILHPLCEV......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGAILLLVLAFVYRYNL...T..A.FD...L...GIR...........SS....---....--DSFVAK..LL.N.QGQL..------.----..SRPLDELTDAEQV..HLDGWI.QGLFd......tET..G.....GLGDELM......S.SCPPQDF..YLLVPTLFHNIML.....AL...D...T...........K......YLA....D..........-ES.LKTGVE............Y................L....VDTFLLPS.LVVAITYMSNQ......LW.TES.R.P..D....Q.K.....A..--.--....-A.I.TIL..QL.I.L.....L..N.K..K.G...S..DE...........AQTMLS..AVL....NIVAKPLEHSLRSYQRQD..--....---------.----..PK---.-...----.....-......-C.....QE.IE.P.LL.NAIK.DN...I.R.L...............S.R............R...TA.GA..GH..N.ELE.......AW.A.ST...N..........N...G..G....LTASVRQTIQGFv....qWS.LHPGin............mipTSYT..HR..Q.ILAAH..RILG...ARRL...LHIILDEV.KQQTDT--....---.---..---...-.....SSCSIMYDIA.TALICAPD.AT.N...A..P...P.PA.V...M.TLLVD----P.........N......NPIIT..P-QRRMTLR.....................................EALKSEAEDFKtIQKSDPALAE-.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------hivrlyrrveaqlmmpqpadtmlqsg..............................................................................................................................................................................................................................
A0A1S9DZG7_ASPOZ/2-967                 .........................................................................................................................................................................................................................................................................................................................t-SSEQWRAFLHQCLMRRIDAAEFKNLSKILFRRCPTA-....................----...........................----------...........--------------.....---...-.....EG...TLLD..VLLEIRLa....tgIKW...DPL..LPLy..iDCLCKMGKVQ.....TSTVLTSLLKY.SSIHdkpqspsse..............................................................tvqskmalkcYTLM.TDIR.VIQD.AM.L.S.VS..TG.S.TPKS.......................................................--..-..-......-L.AE.AV...GI..F..S..AIIDWIQA..V..V.AWHNNH....Idpsqq...........................tgglmsSPDAV.SL.F.E.SL....GI.......L....LTA.LS...G..T.G.KGIEvlssd...................shealkVKLGQ.A.LSAYL.P.LC.ME.-.---............VSLPL..RNR...LDSL.Qkgfnlygeppn................kslqsmmdnvnVNAL...Q..FEASvm..........dgPVI.N.SRAGL......---.---....................----..-..--..-..----...YIYINA..MLV.GRPLV.DDSMLLNYLT---NRYG.GHY..........------DVLVEEVITATF----.DVL.SNA.LYR.N..E.SS..RTMFLFRS---FLVNKLPSFFAA................-M.LAASmvs..................lpmeMCISHALS.....RL.DP-.--..NT..F..P..SFS.QM..F....A..--....MQGS.TV..L--.-.....-...---.-...SE.VRPEFLFACASHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTPP.V.G..--..Y.N.K.DDLVSQINTNqer..................................aeqLVS......ELESTEGNAGA......-------................---..-----.---.--....-------.IVA...AITEVMH....NLCN..Q.K..ETMTLKSICNS..L.-SR...R...PQ.....ALDVI.LLFRS...A.K.QVLQPLCAL......LD-SW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQP..........VYDE.FGSILLLVLTFKYRYDL...R..P.YD...L...GIT...........SN....---....--DSFVLK..LL.D.CGSS..------.----..SQNLDDLSEKQNR..NLGAWI.TALF........IA..E.....GISEETM......S.SCSPQEF..YLLVTTLFNQSLT.....AC...E...A...........G......KL-....E..........FDT.LKGGFE............Y................L....LEPFLLPS.LVVALTWLGNH......IW.ETE.S.D..P....T.I.....P..--.--....--.L.KTL..QS.L.V.....N..P.S..S.I...S..GD...........AREIHK..TVL....NITARSLDEQLKDIRSRH.pNR....A--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DVLE.PC...L.S.F...............Q.R............T...GS.CH.rSE..L.--D.......SW.T.TH...S..........P...G..G....LLGSIRSTFQGLv....lWS.TSPGvs............mapHSYT..HR..Q.LVAGI..RMLG...SARV...LTAIVDEL.KMQTET--....---.---..---...-.....GNADLALDIA.VTMICAPL.AE.S...-..-...F.AI.E...Q.SNYHP---VD.........P......NKEPL..PRCPVLTLR.....................................DALNLQHENVPkLSEKDPLRAEVivr......................lyrrVNALMTPTSQMP..................-----......-..-.....NLDMSNIIQDM..QLGV-.-----......----.----.-.-..--.----------------------edhgqmdlepagaghgvgdddaanlnrmldnaaaa.....................................................................................................................................................................................................................
A0A1F7ZZ98_9EURO/2-966                 .........................................................................................................................................................................................................................................................................................................................t-SSEQWGAFLHQSLMRRIDATEFKTLSKILFRRCPIA-....................----...........................----------...........--------------.....---...-.....EG...TLLD..VLLEIRLa....tgIKW...DPL..LPLy..iDCLCKMGKVQ.....TSTVLISLLKY.SSIHdkpqspgsg..............................................................avqsknalkcYTLM.TDIR.VIQD.AM.L.S.VS..TG.S.TPKS.......................................................--..-..-......-L.AE.AV...GI..F..S..AIIDWIQA..V..V.AWHNNH....Idpnqq...........................tgglmsSPDAV.SL.F.E.SL....GI.......L....LTA.LS...G..T.G.KGIEvlssd...................shealkVKLGQ.A.LSAYL.P.LC.ME.-.---............VSLPL..RNR...LDSL.Qkgfnlygeppn................kslqsmmdnvnVNAL...Q..FEASvm..........dgPVI.N.SRAGL......---.---....................----..-..--..-..----...YIYINA..MLV.GRPLV.DDSMLLNYLT---NRYG.GHY..........------DVLVEEVIAATF----.DVL.SNA.LYR.N..E.SS..RTMFMFRS---FLVNKLPSFFAA................MM.AASMvsl...................pmeMCISHALS.....RL.DP-.--..NT..F..P..SFS.QM..F....A..--....MQGS.TV..L--.-.....-...---.-...SE.VRPEFLFACASHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTPP.V.G..--..Y.N.K.DDLVSQINTNqer..................................aeqLVS......ELESTEGNAGA......-------................---..-----.---.--....-------.IVA...AITEVMH....NLCN..Q.K..ETMTLKSICSS..L.-SR...R...PQ.....SLDVI.LLFRS...A.K.QVLQPLCTL......LD-SW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQP..........VYDE.FGSILLLILTFKYRYDL...R..P.YD...L...GIT...........SN....---....--DSFILK..LL.D.CGAS..------.----..SQKLDDLSEKQNK..NLGAWI.TALF........IA..E.....GISEETM......S.SCSPQEF..YLLVTTLFNQSLT.....AC...E...A...........G......KL-....E..........FDT.LKGGFE............Y................L....LEPFLLPS.LVVALTWLGNH......IW.ETE.S.D..P....T.I.....P..--.--....--.L.KTL..QS.L.V.....N..P.S..S.I...S..GD...........AREIHK..TVL....NIAARSLDEQLKDIRSRH.pNR....A--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DVLE.PC...L.S.F...............Q.R............T...GS.CH.rSE..L.--D.......SW.T.TH...S..........P...G..G....LLGSIRSTFQGLv....lWS.TSPGvs............mapHSYT..HR..Q.LVAGI..RMLG...STRV...LTAIVDEL.KVQTET--....---.---..---...-.....GNADLALDIA.VTMICAPL.AE.S...-..-...F.AV.E...Q.SNYHP---VD.........P......NKESL..PRCPILTLR.....................................DALNLQHENVPkLSEKDPLRAEVivr......................lyrrVNALMTPTSQMP..................-----......-..-.....NLDMSNIIQNM..QL---.-----......----.----.-.-..--.----------------------gvedhgqmdleptgaghgvgdddaanlnrmldnaaa....................................................................................................................................................................................................................
A0A0M8N2D0_9HYPO/427-806               .................................................................................................................................................................................................................................................................................................................yteslihsw--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........R...Y.........E.....D...D...Q....G.E...........YQP..........VYEE.FGSILLLVLAFAYRYNL...S..P.GD...M...GLQ...........SA....---....--DSNVAK..II.G.RGHI..------.----..SQELDELSEAELG..HINGWI.HGLFd......sEA..G.....GLGDDLM......S.SCPPQEF..YFLIATIFQNIVG.....AY...T...Q...........G......YLT....D..........-DS.LRAGIE............-................-....--------.---SIRFLADY......LW.VEQ.K.E..-....-.-.....-..--.QQ....SI.I.KVL..QL.I.L.....L..P.S..S.I...S..GE...........ANTMLG..SVK....TIIAKPLEHSLRAYQRQN..-P....K--------.---N..QNIEP.L...----.....-......--.....--.--.-.-L.KALK.DS...L.PlS...............R.R............T...GG.AE.vNE..L.--E.......AW.A.TT...S..........T...H.cG....LVGGVKNTISALi....qWS.LHPVmt............ampASYT..HR..Q.IIGTL..KIVG...ATRL...LRVMVEET.RQHAES--....---.---..---...-.....ASGNVVYDVV.SALICAPN.VM.N...E..P...P.A-.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------pstlideagnmwpllqrrltlrealkteadevrklrrkdpalaeavvrlhrrvea.................................................................................................................................................................................................
A0A367JQ52_RHIAZ/31-399                ...........................................................................................................................................................................................................................................eddimkmindmsystdlnasavvkaiktlsnhdiytnivhackrlgfvrpkvatellkgnedmmeidesieakaspsai--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.V.DQNIDQRMEI........................................LRT......NLTFVE-----......-------................--L..TELLH.-IG.LV....SPLHLQR.IID...FIIQLLQ....EKAI..E.D..DFYSVSKICDA..L.-IE...S...PC.....TVDLI.LQLYT...P.S.DLLGPLERF......CN-HW................T......S......D..........Q.......S.......I....N....DI...........D...M.........D.....E...Q...T....S.N...........RRGskeelegirlLYNK.FGKIWNLVVSVVKRFKV...H..R.D-...L...NKV...........F-....--K....ESDGFAYQ..FF.S.RGPF..IYG---.---Q..DIQDDR----IEG..QINSWL.STLA........GR..G.....DSLDNLL......Q.TTKPQDL..LLMAPTIIHRCIL.....LY...A...Q...........G......QI-....Q..........NDT.LMGMAS............Y................F....QKSFLDFT.QMSILTTLCDE......LL.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ngeskialaclrlfimssiplsrqtn..............................................................................................................................................................................................................................
A0A5N5X4L5_9EURO/2-965                 .........................................................................................................................................................................................................................................................................................................................t-SSEQWGTFLHQCLMRRIDAAEFRNLSRLLFRRSPIA-....................----...........................----------...........--------------.....---...-.....EG...ALLD..VLLEIRLa....tgIKW...DPL..IPLy..iDCLCKMNKVQ.....TSTVLTSLLKH.SSIHdkpqspgse..............................................................avqsktnskcYTLM.TDIR.VIQD.AM.L.S.VS..AG.S.APKT.......................................................--..-..-......-L.AE.AA...GI..F..S..AIVDWFQA..V..V.AWHNNH....Idpsqq...........................tgglmsSPDAV.TL.F.E.SL....GI.......L....LAA.LS...G..T.G.KGIEvlssd...................shealkIKLGQ.A.LSAYL.P.HC.ME.-.---............FSLPL..RSR...LDSL.Qkgfnlygepps................kslqsmidnvnVNAL...Q..FEASvm..........dgPVI.S.SRAGL......---.---....................----..-..--..-..----...YICINA..MLV.GRPLV.DDSMFLNYLT---NRYG.GHY..........------DVLVEELITATF----.DVL.SNA.FYR.N..E.SS..RTMFLFRS---FLVNKLPSFFAA................-M.LAASmis..................lpmeICISHALS.....RL.DP-.--..NT..F..P..SFS.QM..F....A..--....MQGS.TV..L--.-.....-...---.-...SE.VRPEFLFACASHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTLP.V.G..--..Y.N.K.DDLVSQINACper..................................aeqLIN......EIESTEGNAGA......-------................---..-----.---.--....-------.IVA...AITEVMR....TLCV..Q.K..ETMTLKNICNS..L.-SR...R...PQ.....ALDVM.LLYRS...T.K.QILQPLCNL......LD-SW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQP..........VYDE.FGSILLLVLTFKYRYDL...R..P.YD...L...GIT...........SN....---....--DSFILK..LL.D.RGSC..------.----..SQKLDDLSEKQNK..NLEAWI.TALF........IA..E.....GISEETM......S.SCSPQEF..YLLVTTLFNQSLA.....AC...E...A...........G......KL-....E..........FDT.LKGGFE............Y................L....LEPFLLPS.LVVALTWLGNH......IW.ETE.S.D..P....T.I.....P..--.--....--.L.KAL..HS.L.V.....S..P.N..S.I...S..GD...........AREIHR..TVL....NITARSLEEQLKDIRSRH.pSR....T--------.----..-----.-...----.....-......--.....-D.TK.P.IL.DALE.PC...L.S.F...............Q.R............T...GS.CH.rSE..L.--D.......NW.T.--...A..........H...G..G....LLGSIRSSFQGLv....lWS.TSPSvs............mapQSYT..PR..Q.LVAGI..RMLG...STRV...FRAIVDEL.KMQSET--....---.---..---...-.....GNAALALDIA.AAMICSPL.AE.S...-..-...F.AI.E...Q.INYHP---VD.........P......NKEPL..PRCPILTLR.....................................DALNLQHESVPkLSEKDPLRAEVivr......................lyrrVNALMAPTSQMP..................-----......-..-.....NLDVSNIIQNM..QLGV-.--E-D......HGQM.DLEP.A.S..AG.HGVGDDDAANLNQMLDN-----aaaa....................................................................................................................................................................................................................................................
A0A5B0RD69_PUCGR/446-751               .................................................................................................................................................................................................................................................................................................................hpnlvlghh--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......---SDLD................LGI..HPLLD.SLG.KS...sKETPISE.LAV...KLHQSIV....TATK..S.F..DLSTCITLTEA..L.-SS...L...-D.....SLSTL.FLWIE...P.R.KLLGPVRDL......LD-HW................N......D......I..........R.......N.......N....V....NQ...........LvnnS.........D.....N...D...E....S.S...........SGS..........EFEK.FGRLLGWLQGVVGRFSL...M..S.-N...L...SY-...........--....HLG....ATTGFTIH..HL.S.NPST..---SYP.IS--..-----SLPASHQS..TLSSWI.EALY........GS..S.....GIPDDLL......G.HTDPRIF..FSISASLFKQSFD.....AL...T...I...........G......LI-....D..........LQT.FRDGLS............Y................F....EHKLLVAGcAVGVVGWLLNE......LT.RVG.R.I..-....S.A.....S..SY.PT....AL.L.EIL..QS.I.L.....L..S.D..A.I...T..P-...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------talhlvsarslavlrafdanfsr.................................................................................................................................................................................................................................
A0A369GPW3_9HYPO/323-874               ...................................................................................................................................................................................................................................................................................................................iylnaag--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----ETQSGAIDLIVASF----.DIL.ANT.VFR.S..E.GP..KDAHLLRS---FLINKLPLLLCQlfa..........aqfST.ASSE.........................YCITAALN.....QV.DT-.--..SV..F..P..TAS.LM..F....D..ES....RSNN.PY..T--.-.....-...---.-...ES.VREDFCTACALHGLVR.REHVERILGE.TSMSY.E-..--.-.-----P.S.L..EK..Y.S.K.DKLVQGCLSDpdr..................................iqgLVR......DIDKMDGNVGA......-------................---..-----.---.--....-------.ICQ...ALVELMR....QLCD..S.K..DTVSLKLLCSQ..L.-AH...K...PQ.....SLDIL.LLFER...L.P.AVLEPLCQL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...D...Q....G.E...........YQP..........IYEE.FGGILLLVLAYAYRYNL...R..A.AD...I...GIV...........SP....---....--NSCVAK..IL.D.RAHI..-S----.----..-RPLNELTEQEKT..HVNGWI.HGLFg......sET..G.....GLGDDLM......S.SCPPQDF..YLIVASLFQYIVS.....AY...A...H...........G......YL-....N..........DDS.LKSGIE............Y................V....VDTFLLPS.LVPAIRFLADY......LW.VNQ.K.E..Q....-.-.....-..--.-K....SV.I.KIL..QL.I.L.....L..P.S..S.I...S..GE...........ASAMLS..SVK....NLIAKPLEYSLRSYQKQD..PK....---------.---N..QDIEP.L...LRAL.....W......--.....--.--.-.--.DNLP.--...L.S.R...............-.R............T...GG.AE.hHE..L.--D.......SW.S.NS...S..........S...S..G....MSGAIRHTVQGL......AQ.MHHGln............vmpTSYT..HR..Q.TIAAC..RMVG...TNRV...LRAMIDEI.RHQPEAYD....VV-.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------amlvcapdvtmeppasgml.....................................................................................................................................................................................................................................
A0A1L9X209_ASPA1/2-973                 .........................................................................................................................................................................................................................................................................................................................t-SSEQWGIFLHRCLLHRIDAAEFKSLSRLLLQRCPIT-....................----...........................----------...........--------------.....---...-.....EA...LLLD..VLLETRLs....tgIKW...DPL..LPLy..iDCLCKMGLVQ.....TSTVLKALLKH.SSIHdknqsssve..............................................................vypgkksrscYTLM.TDIR.VVQD.AM.L.S.VS..TG.S.VPKS.......................................................--..-..-......-F.SE.AI...SI..F..T..AIIDWIQA..V..V.AWNSSH....Idsghq...........................npglisSPDAV.SL.F.E.SL....GI.......L....LAA.LS...G..T.T.KGLEvlsad...................sqealkVKLGQ.A.LSAYL.P.IC.VE.-.---............VSLPL..RNR...LDSL.Qkefnlygetpa...............kpldvsmmegvnVNAL...Q..FEASvm..........dgPMI.N.SRAGL......---.---....................----..-..--..-..----...FVYINA..MLV.GRPLV.DDSMLLNYLS---NRYG.GHY..........------EVLIEETITAAF----.DVL.SNA.SYR.S..E.SN..RSMFLFRS---FLVNKLPAFFAA................-M.LAASmvt..................lpmeLCISHALG.....RL.DP-.--..NT..F..P..SFS.QM..F....T..--....MQSN.TA..L--.-.....-...---.-...SD.VRQEFLFACASHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTLP.V.G..GP..Y.N.K.DDLVNQINANper..................................aehLIG......EIESMEGNAGA......-------................---..-----.---.--....-------.IVG...AIIEVMH....NLCN..Q.K..ETMTLKNICNS..L.-SR...R...PQ.....AMDVI.LLFRS...T.K.QVLQPLCSL......LD-AW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQP..........VYDE.FGSILLLVLAFTYRYGL...R..A.HD...L...GLG...........GS....---....--NSFVLQ..IL.G.GGSC..------.----..SQKLDSLSDKQNK..NLGGWI.TALF........IA..E.....GISEETM......S.ACSPQEF..YLLVATLFSQSLG.....AC...E...A...........G......KL-....E..........FDT.LKGGSE............Y................L....LEPFLLPS.LVLALNWLGNH......IW.ETE.G.D..P....S.I.....P..--.--....--.L.KAL..HS.L.I.....N..P.T..S.I...S..GE...........AKEIHR..TVL....NMTARRLEEQLKDVRARH.pSR....T--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DALE.PC...L.S.F...............E.R............S...GS.CH.rSE..L.--D.......SW.T.SH...S..........P...G..G....LLGSIRSAFQSLv....lWS.ASPHvs............vapHSYT..HR..Q.LVTGV..LLLG...ATRV...LGALVEEL.KLQTET--....---.---..---...-.....GSGDIALDIA.ATLICAPM.AE.Y...-..-...F.AI.D...Q.NN-HSHQPLD.........P......TKESF..PRCPILTLR.....................................SALNLLHDNIPkISEKDPSRAEVivr......................lyrrVNALMTPPAQVP..................-----......-..-.....NLDMNNIIQHM..QLGVG.G--PG......QMDL.DP-Q.G.A..SG.HGVTDDDAANLNRMLDNAA---aa......................................................................................................................................................................................................................................................
A0A150VID6_9PEZI/25-648                ..................................................................................................................................................................................................................................................................................................................iirtragl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...YVWLNA..CLC.GRPQM.DDLAMLGYLQ---ARYS.GDI..........------QTAIIDLLTAAF----.DVL.TNA.LLC.K..E.RT..DTVWIIRS---FISNKIPTLLALl..............aSY.L--Appm...................tveNCIQMAF-.....-M.TEI.TI..DV..L..P..PIS.EG..D....K..DV....---C.ET..L--.-.....-...---.-...RR.TRAEFLRACVLHGLMS.ESLIEHILQE.PSN--.--..--.-.---SQP.A.G..TK..F.T.K.EGLLAQCVNNvgr..................................lepLLR......ELQSMRGNAGA......-------................---..-----.---.--....-------.VAE...CIVQLIN....NLYL..A.K..DTMSLKTVCNL..L.LKR...I...-P.....DLDIL.MQYTQ...P.A.NLLLPLCTV......LN-DW................T......-......-..........-.......-.......-....-....--...........-...H.........D.....Q...D...Q....A.E...........FTP..........SYEE.FASILLFTLAFIHRYNL...T..K.AD...A...EIL...........PS....---....--GNFVFD..LM.Q.NIST.sIPL---.----..----SDLSEDQNV..QLSKWI.EGLFatd..ehgET..S.....GISDDVM......R.QCPPKDF..YKLVPTLFEQSVL.....AC...R...S...........N......CL-....P..........MNT.FKGGLE............L................L....LEPFLLPS.LIGGLNWL---......IM.HSW.A.D..H....G.D.....V..D-.--....VL.L.HVL..DK.L.L.....K..P.S..S.S...S..QD...........TQTMHK..AIL....GMVATRLSYSLHELLRKQ..--....P-------D.KRAA..---TG.L...IN--.....-......--.....-L.LK.P.YT.DQIS.RR...T.Y.Q...............-.-............-...-S.GR..KE..L.--R.......EW.A.AV...E..........G...G..G....LLQCIRSAVRELs....vWIpTNPP.................PRYN..HG..Q.FLAAC..ELCG...ADAV...LSAISTEL.KEQTTS--....---.---..---...-.....GNGAQTLDVC.VALICSPT.IA.T...A..K...S.DS.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------vrhalrlvisdtqtmlqkpnaeaeamirlarrveaqlav.................................................................................................................................................................................................................
A0A2S7PR84_9HELO/29-978                ............................................................................................................................................................................................................................................................................................tyirilssksplsssyicsiflrpqshndt--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......-SI...DPR..ILRy..lQILLAEELVD.....CAGVLRALLKY.SSLWtfrhdgnlqqeatgg...................................................tekakgvkeaaqrwkNSYS.AEEM.MLYR.LA.K.T.VS..SG.A.APKS.......................................................--..-..-......-A.QE.AV...EI..L..A..VCIQWMEM..V..T.TAMGQG....Ahaml.............................npeshAEEIG.ML.G.M.AL....GT.......L....MVA.VV...G..N.V.KILEalekgh..................cqkgtvKELGK.A.LNGFV.P.LL.LQ.N.SP-............QNAAR..LDV...FRSQ.Tlltitpvdkkeqa...........adeeineiidstigIDSI...A..VADL..............PTV.N.SRAGL......---.---....................-YVY..L..SS..L..G-VM...NILANRrfQLV.GRPLI.DDSAIFTYLQ---NRYQ.GDI..........------QATMIDLILTSF----.DVL.ANA.TFR.N..E.GQ..QTTTILRS---FLVNKLPLLLSTl..............aT-.---Slypp.................ltseYCITEALG.....HV.NT-.--..DA..F..P..TLS.TL..F....A..ES....--SN.ND..MFS.D.....S...---.-...--.VRQDFCFACCLHGLIP.EPSIETLLGD.IPM--.--..--.-.--QSLP.A.G..GR..Y.S.K.HDLVQQCLSDser..................................tegLIS......ELENMDGNVGA......-------................--R..YNILP.NYI.MI....SNK----.---...--RQVIR....HLCS..S.K..ETMTLKSLCSQ..L.-AR...N...PS.....TLDVM.LLFDK...P.T.SFLQPICDL......LD-NW................H......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLVVLFTHRYNL...S..V.VD...L...GIR...........AP....---....--NSFVAR..LL.T.QGHL..------.----..SRALEPLTEQEQS..HLDGWI.RGLFe......pEG..G.....GLGDELM......S.SCPPQDF..YLLVPTLFHHIVL.....AL...S...T...........N......NL-....T..........EEG.LKGGLE............F................M....VEPFLLPC.LIPGINWLSAH......LW.ASR.G.D..-....-.-.....-..--.AN....AV.L.QIL..SA.L.I....tN..P.S..S.S...N..AE...........ASQLLN..SIL....KIIAKNLEHSLRWLQRAE.pVR....H--------.----..-----.-...----.....-......--.....-D.IE.P.IS.KALK.PN...L.G.W...............E.R............R...GA.SG.hTE..L.--E.......SW.T.AT...P..........G...G..G....LVASIKHTISTLv....qWG.LDPAmn............tmpASYT..HR..Q.ILIGM..KILG...AKRL...LNAIIDEV.KTQTQA--....---.---..---...-.....GNGSVVLDIA.TSLICAPDpVS.F...D..S...S.TS.A...S.IDLLS----G.........V......SSSPQ..PLQRRLNLR.....................................EALKVETDKMPkVHKTDTFHAETvirl.....................frrvE-----------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------aqlaqqqsllphddglgglnavmg................................................................................................................................................................................................................................
A0A080WR42_TRIRC/1-180                 .........................................................................................................................................................................................................................................................................................................................m--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........-------ALVEELITASF----.DVL.SNG.MYR.N..E.PQ..QSMFLFRA---FLVNKLPSFLSDla............gsV-.---Vepi...................pveLCITRALA.....RV.DP-.--..NT..F..P..SFS.EI..F....S..--....THGN.SV..L--.-.....-...---.-...SD.VRQEFLFSCALHKLIP.ESSIERLLGE.NPM--.-Q..TL.P.NGGRFV.K.H..DL..V.A.Q.INNSHERAEQ........................................LLN......GVESMDGNARA......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------iveaiaevwafhrtkilqstn...................................................................................................................................................................................................................................
J7RAF4_KAZNA/1-1131                    ..........................................................................................................................................................................................................................................................................................................................MTNESLYSLAVKCSQRQLSSGEFLNLYKEFYNEKLASE....................AGSVddd....................seppSNAESKTTAT...........TICTQMAQEFTKIF.....KEQ...H.....NL...ILID..YLIEILF.......VNY...NPD..LIH....LFLPLLKTVStgdgnNDNLLIHFLSK.LSAY.................................................................................FVQL.RDKL.VGDQ.LV.K.D.LP..GV.I.IPNL.......................................................LE..I..Q......YG.N-.NN...EL..S..V..ALAKCLLV..L..L.KYPSNV....L......................................TIESV.SC.R.D.NA....HH.......L....LSK.LS...D..I.S.RLVY..............................KKLLH.T.LDNKV.N.FK.DS.N.GLTk..........dVSGQE..PSS...IYSP.S......................................ITSP...Q..FISS..............PLF.S.MKTPSl....pNNK.DGTvs................tmKYKD..M..KL..F..RYYK...NIWLNN..KIM.NWEMI.GSEFLSKYNSISSTLFP.ESAdg......nhVTVPNVDMLLIDLIETSFTCFA.QYV.SNK.QYH.R..T.NS..NLNLLERQWIIFISKHLPILLLN................HS.SKNP.........................QIVTTALE.....QI.DPK.VI..KA..I..T..SYY.SE..K....D..DM....RVRN.DD..LFD.D.....F...SST.S...FD.VRHDFIKSLVSLGLQP.PTLINEFLRE.DQAVD.PK..SL.P.VTDDLV.I.T..TS..Q.G.T.QETVGDIQSF........................................IIS......SLDSLELENIC.....sDDVNSESdiphsnvrssisgdsfNGI..HQILQ.NNE.TI....PPTKMKE.IST...VIFELLK....DAIA..V.G..NHSRISKICAL..L.CFN...F...NH.....SLIAF.FSFQS...P.Q.GIIEDLLHF......VDKVW................P......N......S..........S.......H.......S....S....KD...........D...N.........T.....A...P...D....-.E...........SND..........LFLS.FSWALLLLTSINKNIGI...S..L.VD...V...ALK...........SS...lDIP....LEDSFTIK..FI.D.QLTE..IPDDYS.IEPQ..NRTLPEVQTQSHK..LVRNWL.SDLF........IN..G.....SLSDQLT......Q.NTDAKQL..ATLLPFILKQVLY.....AL...E...C...........N......VVT....D..........MNN.VIGGFE............Y................F....LQPFMIVG.LIKIVFWLEKY......LS.YLN.N.E..P....E.L.....V..EL.TQ....KV.L.VIM..NS.L.L.....N..P.T..T.L...N..ED...........SRTFHC..AAL....RLNAIPLLKMLRKFCVPQ..TQ....TEYGVYSSD.TQEP..PMVES.L...IKKL.....I......SV.....IN.FA.P.VY.NMDP.RI...V.S.T...............-.D............N...IY.LQ.qKP..I.GYG.......KL.Q.IL...N..........E...N..P....IDKIMTNQINSF......WN.LHSS.................TYYN..ID..F.LNEII..KLIT...PKKF...FFDVLNTL.TYKISVYG....VPA.ARN..KMS...T.....VDSDHVIDYL.FYFLVLHD.CE.S...Q..V...D.AG.Y...M.VQLLSGNLEI.........D......NSAIK..PKKDLVKAKeqpad...........................dlvgvPKSEIAQ----.DDDFVMLFGEN.............................DTSSHNMNDD--..................MQDVH......F.eSse.ddEVKKLQKFYAL..KKDSF.GVILY......QLKL.VHDA.A.V..KD.GDLSKTEYEKFNKHYEKYLSML........................................................................................................................................................................................................................................................
A0A2C5ZMZ3_9HYPO/302-894               ...............................................................................................................................................................................................................................................................................................................aglyvylnaag--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----ETQSSAIDLILASF----.DIL.ANT.VFR.N..E.CP..KDAHLLRS---FLINKLPLLLCQlfa..........pqfST.ASSE.........................FCITEALN.....QV.DT-.--..SV..F..P..TAS.LM..F....D..ES....RSNN.PY..T--.-.....-...---.-...ES.VREEFCTACALHGLVQ.REHLERILGE.TSMS-.--..--.-.---YEP.S.L..EK..Y.S.K.DKLVQSCLSDpek..................................iqgLVR......EIDKMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALVELMR....QLCD..S.K..ETMSLKLLCGQ..L.-AH...K...PQ.....SLDIV.LLFER...L.P.TVLEPLCQL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...D...Q....G.E...........YQP..........IYEE.FGAILLLVLAYAYRYNL...R..A.AD...I...GIV...........SP....---....--DSCVAK..IL.N.RAHI..-SR---.----..--PLGQLTEPEKG..HVNGWI.HGLFg......nET..G.....GLGDDLM......S.SCPPQDF..YLVVASIFQYIVV.....AY...S...N...........G......YL-....N..........DES.LKSGIE............Y................V....VDTFLLPS.LVPAIRFLADY......LW.VEQ.R.E..Q....-.-.....-..--.-K....SV.I.KIL..QL.M.L.....L..P.S..S.I...S..GE...........ANTMLS..SVK....NLIAKPLEYSLRSYQKQD..PK....N--------.----..-----.-...----.....-......--.....QD.IQ.P.LL.RALK.DS...L.P.L...............SrR............T...GG.AD.nNE..L.--E.......SW.S.SS...S..........S...S..G....LSGAVRHTVQGL......VQ.MHHGin............vmpTSYT..HR..Q.LIAAC..RMVG...TSKV...LRAMVDEV.RHQSEA--....---.---..---...-.....GAASVVYDVV.AALVCAPD.VT.M...E..P...P.TG.S...L.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------lgseargtqrrptlrealkleaegcqklhkkd........................................................................................................................................................................................................................
S3BZ01_OPHP1/240-1045                  ......................................................................................................................................................................................................................................................................vstdlseqafkqdgtescrtafvllllavledpvvldtlkqpyakaarrals--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.Q.TL....PS.......F....MPI.VS...H..S.S.AVAV..............................ARLDQ.F.HSGFLsQ.FD.QD.K.EKKe..........eVNDNI..HDL...LDSTvG......................................LQNL...A..IPEL..............PIS.N.SRAGL......---.---....................----..-..--..-..----...YIYLNA..ALV.GRPLV.DDASIFAYLH---NRYQ.GDL..........------QSTAIDLILASF----.DVL.ANA.VFR.R..E.GQ..TSAHLLRS---YLINKVPVLLA-................SL.AASPlyp..................fdsqFCISEALS.....RV.DT-.--..NA..F..P..TMS.SM..F....D..DN....QNAN.T-..-FT.D.....-...---.-...-S.VRQDFCFACCLHGLIP.ESSIETLLGE.MTY--.--..--.-.--QSLP.A.G..GR..F.T.K.QSLVQQCMGDygq..................................idvLIG......QLDSMDGNVGA......-------................---..-----.---.--....-------.VSQ...ALVEILG....HLCR..T.R..DTATLKTLCNN..L.-VK...K...PL.....AFDVL.LLFDR...P.S.AILYPLCQL......LD-GW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....D...D...Q....S.E...........YQP..........VYEE.FGSVLILLLAFVYRYDL...S..I.VD...L...GIQ...........WS....---....-ADSFVAK..VL.S.VGPQ..------.----..SRTLVELSDQERE..NLGSWI.RGLFd......tEA..G.....GLSDDLM......A.SCPPQQF..YMLTPTLFQQIIQ.....AT...S...T...........G......AL-....K..........EEA.LKIGIE............Y................L....VDTFLLPS.LVTALVYL---......SS.ALK.V.D..K....P.V.....E..--.QK....AI.I.RIL..QL.I.L.....Q..P.A..S.I...S..SE...........ASLMLT..ALL....NIVAKPLEHALHIFQAQD..PR....N--------.EDID..PLLNA.L...KQSI.....P......RS.....RR.TA.A.AEhNELV.NW...A.R.S...............-.S............A...GS.SG..KN..M.SSS.......G-.R.VP...T..........A...G..G....LYTAVCQTMQGFv....qWS.LHPGan............ampTSYT..HR..Q.FVAGL..GLIG...APRT...LQLILDEV.QRQTEA--....---.---..---...-.....GNGSVVYDVA.CALICAAD.VT.N...E..P...S.PD.S...L.YVLVDGESSS.........D......NGENG..DADGTHNERav................................agtV----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------vantaavqrritlrqfltfkaeewkkiqrsrdpvdiamaeaivrlhrkvea.....................................................................................................................................................................................................
C7YTM5_NECH7/14-952                    ......................................................................................................................................................................................................................................................................................................................tidf-----WKKFVSRCIARRVDTDRFEVLVQQVYAEHPLP-....................----...........................----------...........--------------.....---...-.....PA...VIAD..FFLRPQPs....ndNSL...DPR..IPPy..lQALTRLGYID.....TPSVLQALYKY.SSSHaqaqqpndgddkneaaqp............................................prtphikhwkssywaeeaiFYSL.TKAV.VEGR.AI.P.DsTI..AL.D.VVKI.......................................................IS..K..Y......MT.LF.TA...AS..T..A..FAADMLG-..-..-.QLHSPQ....I......................................RDEME.SA.R.A.GL....VA.......L....LLR.LC...E..N.D.VLVKavskp...................fakdarKELAA.S.LASFV.P.TL.QL.V.PEL............TEKLE..LFR...TETL.A......................................SLDP...A..DKKKq............vANA.A.MDELL......DST.VGLen...............fviPEIP..I..SN..T..RAGL...YIYLNA..ALI.GRPIL.DDNALFSYMN---NKYQ.GDV..........------QSSAIDLILASF----.DIL.ANA.VFR.N..E.GQ..KDAHLLRS---YLINKLPLLLYQlcp..........pefPG.TSAE.........................FCITEALH.....HV.DT-.--..SL..F..P..TAS.LM..F....D..ES....RNNN.PY..T--.-.....-...---.-...ES.VREEFCASCVLHGLVQ.RDHVERILGE.ISLSD.EP..SL.Q.K-----.Y.S..KE..K.L.V.QDCLSDMDKIq......................................gLIL......ELDKMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALIELLR....QYCH..S.K..ETMSLKLLCSQ..L.-AA...K...PQ.....SLDVI.LLFEK...L.P.TILEPLCQL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLVLAFAYRYNL...T..A.TD...A...GAI...........GP....---....--DSCVAK..II.G.RGHI..-AR---.----..--QGNELTEQENG..HLGGWI.HGLFd......tEA..G.....GLGDELM......S.SCPPQEF..YLLVATLFQNIVV.....AY...A...H...........G......YL-....N..........DES.LKGGVE............Y................L....VDTFLLPS.LVPAIRFLSDY......LW.VDQ.K.E..-....-.-.....-..--.AK....SV.I.KVL..QL.I.L.....L..P.S..S.I...S..GE...........ASTMLS..SVK....NLIARPLEHALRTYQRRD..PK....N--------.----..QDIEP.L...LR--.....-......--.....--.--.T.LK.DSIP.L-...-.-.S...............R.R............T...GG.AD.iNE..L.--E.......SW.T.ST...A..........T...N..G....LASAIKHNIQGLv....hWS.MHPAin............smpTSYT..HR..Q.MLAAL..KLLG...SKRL...LHIILDEV.RQQTEA--....---.---..---...-.....GNANSVYDVA.TSLICAPD.AA.K...-..D...A.PV.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------gmldvngnmpptlqrprtlremlkaeaegckklqkkdaalaeivvrlhrrvemlmvmpeaqamlqtadm...................................................................................................................................................................................
A0A167D9E0_9ASCO/66-641                ...............................................................................................................................................................................................................................................leyicalasdpksllplpsliqyleksslnsraksdvlifiaksvgswnnlglssimgqlgsvlahymislsnap--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................EKQQL.LE.F.K.AL....AY.......F....LVK.LA...E..S.G.HVTSsllvgqvssdagsdktgfsqfqvslkrvygKKLIG.K.SDPYL.E.QL.VK.N.SFK............SILDD..QSN...VDGA.Sg...................................tdSLSL...A..LGAA..............TGI.N.GTAVG......-TG.SISgl................ggSNTA..I..KN..S..RAYR...ILWLES..LML.TVSKI.QGATFIRELN---IFFG.GQN..........-----SLSIVSKLITTAFDCLA.VAL.QRK.---.-..-.DS..PMYVP--LWKGFIGKRLPLIIRRlqgnndk..sssgngdS-.---GsdssrgkdkdgsssandstdpypfeSAICRPIA.....ML.DRG.TV..NL..L..R..VYG.GG..D....V..--....---L.DE..MFS.S.....F...PST.T...SD.IRHEFLKACVDMGLIK.PDSLQQTLGA.DANV-.--..--.-.VEDNTK.P.S..YG..P.A.R.SNFLLRKDGIt.....................................qiNIN......DLFNVAFTENP......EHVTFEN................STI..LWLVQ.SFD.NI....DGYRQQR.IAR...GLLKFVEgwadDSTDngN.Q..NTASLSRLCQA..L.SLN...T...-D.....MLDIL.FLHIT...P.A.SLIVPLIKF......LD-HW................K......-......-..........-.......-.......-....-....--...........-...E.........D.....E...D...E....N.D...........FQE..........VYSH.LGSVILFIELVYERYPL...N..K.DD...L...MTN...........IN....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------gqhakngts...............................................................................................................................................................................................................................................
A6R7P5_AJECN/516-700                   .......................................................................................................................................................................................................................................................................................................................lgr--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.E...........SQP..........VYDE.FGSILLLVLAFKHKYGL...S..H.YD...L...GIS...........NP....---....--DSFVLR..LL.N.YGSS..------.----..SQRLDDLDEKQKN..NLGAWI.TALF........IA..E.....GISDDLM......S.SCSPQEF..YFLVATLFSQSLA.....AC...E...A...........G......KL-....E..........FET.LKGGFE............L................-....--------.--MALTWLGHH......IW.ESE.S.D..L....T.T.....S..--.--....--.L.KLL..LA.L.V.....K..P.S..S.I...S..GE...........AQEIHR..TVL....LITAKPLEDQLKGI----..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------vag.....................................................................................................................................................................................................................................................
A0A2I2EYQ6_9EURO/1-826                 ..........................................................................................................................................................................................................................................................................................................................--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................---M.TDGR.VMQD.VM.L.S.MS..AG.N.IPAT.......................................................--..-..-......-M.AE.AI...GI..F..S..ATVDWIQA..V..V.AWHNSH....Mdagqq...........................tgglmsSPDAA.SV.F.E.TL....GI.......I....LTA.LS...G..N.V.KGLEvlsgd...................shaalkIKLGQ.A.LSAYL.P.LC.AE.-.---............VSLGL..RDR...LASL.Qkafnlygepns...............kgldmsmmdsvnVNAL...Q..FEASvm..........dgPVV.N.SRAGL......---.---....................----..-..--..-..----...YIYINA..MLV.ARPLV.DDNVLLSYLA---NRYA.GHY..........------DALIEEIITASF----.DVL.SNA.MYR.N..E.SH..RTMFVFRS---WLVNKLPSFFA-................AM.SATSlvp..................snmsPYINNALS.....RL.NP-.--..KI..Y..P..SFS.QM..F....S..--....MQGN.AV..L--.-.....-...---.-...SD.VRQEFVFACASHRLVP.EHDIERLLGE.PPMQA.PR..VG.Y.IKDDLV.T.Q..--..-.-.-.INSHHERAEQ........................................LIG......EIESTEGNAGA......-------................---..-----.---.--....-------.IVG...AITEVMH....NLCS..Q.K..ETMTLKNICNS..L.-SR...R...PQ.....ALDVI.LLFRS...P.K.QMLQPLCEL......LD-SW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQP..........VYDE.FGSILLLVLTFNYRYNL...H..P.HD...L...GIV...........GS....---....--DSFVLR..LL.E.RGSC..------.----..SQKLEDLSDKQNK..NLGAWI.GALF........IA..E.....GISEETM......S.ACSPQEF..YLLVSTLFDQSLT.....AC...E...A...........G......KV-....E..........FDT.LKGGFE............Y................L....LEPFLLPS.LVVALTWLGNH......IW.ETE.S.E..P....T.I.....P..--.--....--.I.KAL..QS.L.V.....N..P.S..S.I...S..GE...........AREIHR..TVL....NITARSLESQLKDVRARH.pSR....A--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DALE.PC...L.S.F...............Q.R............T...GT.SH.rSE..L.--E.......TW.T.TH...P..........G...G..G....LLDSIRNTFQSLv....fWG.SSPDvt............mepPSYT..HR..Q.LLSGI..RILG...APRV...LHALLDEI.KLQTET--....---.---..---...-.....GNGDIALEIG.AVIVCAPL.PE.S...-..-...-.--.F...A.VEQNSFHPVD.........T......SKEPA..PRCPILTLR.....................................DVLFLAHDSVPkLSEKEPLRAEVlvr......................lfrrVNTLMAPSQTPN..................LDV--......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------tniihnmslpvgdharm.......................................................................................................................................................................................................................................
A0A167M174_CALVF/670-813               .................................................................................................................................................................................................................................................................................................................llttsrphp--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..---LRDLSSEEKS..LLARWL.KALF.......sPN..E.....GIDDPML......R.ATDPAML..LRLTTTFFDQAIL.....AR...S...L...........D......VI-....D..........SET.LHNGVG............Y................F....LSGLLSWT.LVGIVQYL---......-A.AEA.E.R..Q....G.P.....Y..SS.LH....--.F.EIL..QM.I.L.....V..S.E..S.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------cpkpvlavtgasvlrlltntrl..................................................................................................................................................................................................................................
A0A397V815_9GLOM/179-473               ...................................................................................................................................................................................................................................................................................gsdsmeidsyagsilddpnsdmiekfvseipkrfmdqes--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.RIE...TILRLIT....EWSN..D.Q..KLRHLSILCRL..L.-GE...T...SA.....LLDII.HLYHH...P.S.KILQPLEQL......CN-TW................E......R......S..........-.......-.......-....-....--...........N...N.........D.....D...N...F....E.S...........YLQ..........DCES.FGTIFLFFVNIIDRYELy.kN..L.KD...I...LCN...........E-....---....--KGFCHM..WI.L.QSSV..VYE---.----..---KRSLNPEKSD..MVDFWV.SAMS........AT..E.....DIHNELI......M.ATNPRIL..IELAPTIFKYALA.....GI...N...K...........H......SISvttvT..........FET.LSKNFE............F................F....LKPYSSYA.LVGAIQWLCD-......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------dvffkgqntisskvlkflisskdfpvsvarlvankvmnildns.............................................................................................................................................................................................................
A0A1E4TBI0_9ASCO/15-352                ................................................................................................................................................................................................................................................................pssqflldlgdhlialkqinslnditsdpllaeylvaysttsrqtkpsdlihslfvst--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..N......YS.-L.LS...NV..F..I..TLAFALTP..T..L.VSDPNP....Yikav..............................tpilGACPD.QI.R.E.SL....AS.......F....LIA.LS...R..L.S.HINTmda........................enaQSFSS.S.LSAYM.S.A-.--.-.---............LSESH..PPL...AHAL.T......................................QAYS...Q..LLA-..............-GS.N.PKAPL......SLS.CVS...................nRRTG..F..LS..L..RVSR...LLWLSS..LMC.SLPEV.HSPTFENALK---NKLP.DSS..........-----PQLTASILVESAFDALA.SSI.LSK.---.D..S.AA..RIS----LWKLFLCHRLPHVLKSv.............lsPL.SNTA.........................ALISSIVQ.....SM.DKY.VI..SI..C..N..SQD.TP..V....S..SF....DGEL.ED..MFS.A.....F...PST.N...SD.IRIEFIISCISIGLLE.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------tvpaf...................................................................................................................................................................................................................................................
A0A0C7N442_9SACH/2-1068                .......................................................................................................................................................................................................................................................................................................................eek--RDSVYALALNCAKRHLPPAQFVNFYNELVNELYGSI....................INSS...........................-EDAKSEFKV...........DVYEELSGCLLRIL.....ESQ...P.....CM...LLSD..YVNEVLL.......VNY...NTE..LAH....RLFPKLYTIK.....NLSHLAVLLSK.ASAF.................................................................................FLDL.NDKL.LIDQ.IC.S.D.LS..DL.I.IPCI.......................................................FA..V..D......FG.AQ.SD...QI..V..L..AVAKFLRN..V..S.SLSTNP....I......................................SVTDI.KT.K.D.KI....DI.......F....MSQ.LA...K..A.N.KLLY..............................RKICH.N.FESIF.K.FD.GV.P.SSD............ANEYS..PNS...LVSP.S......................................AVSP...K..FKGI..............PSA.T.ARGSN.....sVVS.SSA....................KSQN..G..KL..V..RFCK...NLWLNN..KIL.NWSTN.SRDFISDYGAIEAAIIV.DAI..........AGSKSVEKVMTDLIETSFTSFA.QFV.SNK.LYH.Q..P.NF..NFYLLEKQWTIFITKQLPLHILE................CI.PKSP.........................ESVVSALE.....DL.DHK.VV..KV..L..K..SYA.SD..K....D..DS....KTGG.ND..LFE.D.....V...PNK.N...MD.IRHEFLKNLIILGCQP.PSILNDYLRE.DHVVD.TK..SL.L.CNDTVV.I.R..NA..Q.G.V.KESISDFLRF........................................IKE......KIYALDVESLFdi..vdSSMESND................SDI..VQVLR.KFD.TL....AASKQRE.LSE...AFHEIFC....ESAR..T.F..DCKTFSKICCL..M.CFN...L...SH.....SLTTI.LTFVA...P.A.RFLAVATEF......IDETW................E......-......-..........T.......H.......M....K....QS...........N...A.........A.....N...D...D....I.E...........PNT..........EFAC.FSYGLILIINITRLYNI...P..L.VE...S...MPS...........S-....FKL....SSKSFTVK..LL.S.SLGN..ITP---.----..-QLDLYSTANSKE..TLENWV.RDLF........VN..G.....SLSDSLI......K.YADARDI..TKLIPFIFKQSIL.....SV...E...A...........G......AIR....D..........IST.LTGGFE............Y................F....LQPFLIGG.LLGIVFWSENY......LT.SLK.T.K..N....L.S.....R..EL.LD....SI.F.EMF..SS.V.L.....N..P.S..T.L...N..EE...........SRPLHT..LIL....RLNAVPILKAARTFLN-Q..SA....SNYGIYSSD.SIGG..PKLES.L...ISHL.....E......RI.....CS.TA.N.LY.SVEP.GT...L.G.S...............-.E............N...GY.LR..KE..L.PWC.......SF.S.LT...A..........E...N..S....INGILNNQINSF......WN.MHSS.................TYYN..LD..Y.LFAFI..DIMT...PANF...FEASLSSL.RSKAFGSL....RSN.GRF..RKT...D.....KETSASLDYF.FHFLVTHD.LR.R...A..S...D.KV.E...L.LNFMTSLEEV.........D......TN-GL..KLVVESNSQ.....................................AKVEQPS----.DEDFDILFGE-.............................DTSIPGNETDIA..................INDTK......T..-.....GDKSELKASIF..LGSSF.SIVLC......DLLL.DKKA.L.L..EL.SYIAQEEYEELKFLHDKYVEIL........................................................................................................................................................................................................................................................
A0A4Q4X943_9PEZI/302-839               .......................................................................................................................................................................................................................................................................................................................ldn--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------FVVPELPITNTRag............lyIY.LNAA.........................FCITEALS.....QV.DT-.--..NA..F..P..TLS.GM..F....D..ES....-NNN.NS..F--.-.....-...---.-...TDtVRQDFCFACCLHGLIP.ESSIEGLLGE.ITY--.--..--.-.--QSLP.S.A..GK..Y.V.K.EALVEECMADper..................................iqgLIG......ELDNMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALTEVIA....RLCN..N.K..EAMTLKLLCSQ..L.-AK...K...PL.....SLDVM.LLFEK...P.I.TILHPLCEL......LD-NW................K......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.FGSVMLLLLAFVYRYNL...S..P.LD...L...GIR...........SP....---....--DSFVAK..LL.H.NGQL..------.----..GRSLDELTDQERG..HLDGWI.HGLFd......tGA..G.....GLGDELM......S.SCPPQDF..YLLVATLFQNIVL.....AF...G...T...........G......YL-....S..........EES.LKTGLE............Y................L....VDTFLLPS.LVLAISYMANQ......LW.---.S.D..I....S.Q.....E..--.KK....AV.I.RVL..QL.I.L.....L..T.K..Q.G...S..NE...........AQSMLT..AVV....NIVAKPLEHALRLSQRQN..PK....S--------.----..-----.-...----.....-......--.....QD.IE.P.LL.RAIK.DN...T.R.F...............S.R............R...TA.GA..GH..N.ELE.......AW.T.ST...A..........N...G..G....LVASVRHTIQGFv....qWS.LHPGin............impTAYT..HR..Q.ILAAL..RILG...AKRL...LYVILDEV.KQQTEA--....---.---..---...-.....GSGSVVYDVA.TALVCAPD.VT.N...M..P...P.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ppemlapalhhhahnhghhappp.................................................................................................................................................................................................................................
A0A094AF75_9PEZI/18-688                .................................................................................................................................................................................................................................................................................tdkleqfakvlstksplatpliaelllrpsesrhyeldpqv--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...--S..LYA....EALLQIGILD.....VPSVLRALLRH.STSRpveaakdeqe.............................................................ganssqarwtKSYG.HEER.LVYG.LS.K.I.VA..AG.D.RPKS.......................................................--..-..-......-A.QE.AL...GT..V..N..ALTEWMRL..L..V.MTNAAD...dMmreig...........................agndahNQETT.AV.R.V.AV....GA.......L....LVA.LA...E..N.T.TVNEalknr...................cpkdtlKGFSQ.S.LSNFT.P.LL.IN.G.SSM............FAERL..ELY...TKTL.Valepvd.........................kkaqkagA---...-..---Eid..........qiIDS.A.-----......---.--Malgmd..........nipvvEIPT..M..NS..R..A-GL...YVYLNS..LLT.GRPMV.DDNQLLNFLH---NRYQ.GDI..........------QTTCIDLIVSSF----.DIL.ANA.IFR.S..E.NT..ETTFLLRS---FLINKVPLLIS-................-I.ISAPmfpp.................lspeLCITEALT.....HV.DT-.--..NA..F..P..TFS.SM..F....D..DT....--SA.GD..MFS.D.....S...---.-...--.VRQDFCFSCCLHGLIP.EESIERLLGE.IPM--.--..--.-.--QTLP.A.G..GR..Y.S.K.DDVLEQCLSDsek..................................ieaFTD......ELEHMDGNVGA......-------................---..-----.---.--....-------.VSQ...AIAELLR....RLCE..N.K..DTMALKSLCVH..L.-AR...K...PS.....SLDVL.LIFDK...P.L.TFLPPICQL......LD-TW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...D...Q....G.E...........YQP..........VYEE.FGSILLLVLAFVYRYDL...S..A.TE...L...GVQ...........TP....---....--DSFIAK..LL.I.RGST..------.----..ARHMDDLSSLETS..QLDGWI.KGLFn......aEG..G.....GLGDEPM......A.LCPPQDF..YLLVPTLFNQIVL.....AS...Q...H...........G......HL-....T..........NDV.LHGGLE............Y................L....LDPSLLPS.LIPALL-----......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------slasniltt...............................................................................................................................................................................................................................................
A0A010R6G8_9PEZI/14-983                .....................................................................................................................................................................................................................................................................leqwtefiakslahridpekfesyvpflqakhplppvavadlflrpqphnhes--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......--L...DPR..VPRy..lQVLSSLNYID.....TPSILKALYKY.STSRghsreagqlpd..........................................................aedqtsnfprweSSYA.AEEV.MFYR.LT.K.S.VA..QG.T.AIQNtg...................................................tgLE..I.aN......VM.AK.WI...AL..FtdA..ATAFTVDV..M..G.QLHNSQ....V......................................REEME.SA.R.A.AF....VA.......L....LLG.VC...E..N.Q.VVLKslskp...................eaqeirKALSE.S.LANFV.P.TI.MQ.S.AGP............IATRL..DMF...RTST.Lagf...............................epvdE---...Q..KNKSna.........eieDLF.D.STVAL......ENF.VVS....................ELPI..V..-N..S..RAGL...YIYLNA..ALV.GRPLI.DDLAIFNYLN---NRYQ.GDV..........------QSTTVDLILVSF----.DIL.ANA.ASR.N..E.GH..QAAHLLRS---FLMNKLPILIES................-L.SKHMygp..................vnaeYCITEALS.....RV.DT-.--..TT..F..P..TLS.SM..F....D..ET....RSNN.-P..F-T.D.....-...---.-...-S.VREDFCWACCLHGLLR.ESSIETLLGE.TPY--.-S..SL.P.ASGRYV.K.E..NL..-.-.V.AECLADPERMq......................................aLIG......ELDSKEGNAGA......-------................---..-----.---.--....-------.VCQ...ALTEVMG....QLCR..N.K..ETMSLKLLCSQ..L.-AQ...K...PL.....SLDVM.LMFEK...P.A.TILHPLCDL......LD-NW................K......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLVMAFAYRYGL...S..A.SD...M...GII...........SS....---....--DSFVAR..LL.G.HGHQ..------.----..SRTLEELSDQEKG..HLDGWI.HGLFd......sEA..G.....GLGDELM......S.SCPPQDF..YLLVSTLFHNIVL.....AF...S...T...........G......HL-....T..........EES.LRGGIE............Y................L....VDTFLLPS.LVIAITSLANS......LW.VER.P.D..-....-.-.....-..-C.QK....AI.V.RVL..NS.V.L.....A..P.T..S.I...S..NE...........AQAMLS..SVM....NIVAKPLEHSLRAYQRSD..PK....S--------.----..QEVEP.L...----.....-......--.....--.LK.A.IK.DSIP.LS...R.R.T...............-.-............G...AA.DH..QE..L.--D.......--.-.AW...S..........M...G..G....FSNSIRQTLQQLv....qWS.IHPTmd............rmpPAYT..HR..Q.MLVAM..KLLG...AKRL...LQLLYEDI.RQQTET--....---.---..---...-.....GSGSIIYDVA.TALVCAPD.VV.N...-..-...T.PS.N...P.INFID----N.........S......GNVPA..PVQRKLTLR.....................................EVLKSDAEECKkLQKVDMNLAEIvvrl.....................yrkvETQMAVSQAEVI..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------qadtmlqtdlglsldagagslddamaaaaanvaqgdgmsvdn..............................................................................................................................................................................................................
A0A179IHU5_CORDF/303-486               ............................................................................................................................................................................................................................................................................................................isnsraalyvylna--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........--AGNQQSSAIDLIIASF----.DLL.ANA.VFR.N..E.GP..KDASLLRS---FVVNKLPLLLCQlch..........pefSA.TSAE.........................FCITEALS.....RI.DT-.--..SV..F..P..TAS.LM..F....D..ES....RNNN.PY..M--.-.....-...---.-...DS.VREEFCAACALHGLIE.RDHVDRILGE.TSMSY.DP..SLeK.V-----.-.-..--..-.N.R.DRLVSDCLSDsgk..................................iqnIIS......QLDKVDGNVGA......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------vahai...................................................................................................................................................................................................................................................
A0A094HYF8_9PEZI/22-757                .....................................................................................................................................................................................................eqfakvlstksplatpliaelllrpsesrnydldpqvslyaqallradildvpsvlrallrhstsrpveaakdeqegasgsqtrwtksygheerlvyglskivaagdrpksaqeglg--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...-T..V..N..ALTEWMRL..L..V.MANAAD...dMmreig...........................agndthNQETM.AV.R.V.AV....GA.......L....LVA.LA...E..N.A.TVNEalrnr...................cpkdtlKGFSQ.T.LANFT.P.LL.IN.G.SSM............FAERL..ELY...TKTL.Valepid.........................kkaqkagA---...-..---Eid..........qiIDS.A.-----......---.--Malgmd..........nipvvEIPT..M..NS..R..A-GL...YVYLNS..LLT.GRPMV.DDNQLLNFLH---NRYQ.GDI..........------QTTCIDLIVSSF----.DIL.ANA.IFR.S..E.DA..QTTFLLRS---FLINKVPLLIS-................-M.ISAPmfpp.................lspeLCITEALS.....HV.DT-.--..NA..F..P..TFS.SM..F....D..DT....--SA.GD..MFS.D.....S...---.-...--.VRQDFCFSCCLHGLIP.EESIERLLGE.IPM--.--..--.-.--QTLP.A.G..GR..Y.T.K.DEVLEQCLSDsek..................................ieaFTD......ELEHMDGNVGA......-------................---..-----.---.--....-------.VSQ...AITELLR....RLCE..S.K..DTMALKSLCVH..L.-AR...K...PS.....SLDVL.LIFDK...P.L.TILPPICQL......LD-AW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...D...Q....G.E...........YQP..........VYEE.FGSILLFVLAFVYRYDL...S..A.TE...L...GVQ...........TP....---....--DSFIAK..LL.V.RGST..------.----..TRLLDDLSSLESS..QLDGWI.KGLFn......aEG..G.....GLGDEPM......A.LCPPQDF..YLLVPTLFSQIVL.....AS...Q...H...........G......HLT....D..........-DV.LRGGLE............Y................L....LDPSLLPS.LIPALLSL---......TS.NIL.T.N..P....P.P.....S..--.--....--.-.SLL..HA.L.I.....L..P.Q..S.I...S..AE...........ASLLHN..AIL....PIPAPHLSRALRALQRSA.pTR....T--------.----..-DLD-.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------pliaalrphlrfsrta........................................................................................................................................................................................................................................
C6H7Y9_AJECH/9-480                     ...................................................................................................................................................................................................................................................................................sssgqwktflrrclsersdaaefgrfatvmlnrhsipgr--------------------------------------....................----...........................----------...........--------------.....---...-.....--...RLID..IILAARVv....tnVPW...DPL..IPLy..vDTLHRLGSIK.....LEDILESLLAH.STVSqkqasvqn.................................................................gsatktplSTLM.TDYC.VIHN.AT.I.A.AT..SG.H.APKT.......................................................--..-..-......-I.TE.AG...NT..F..S..ALAQWILS..L..L.SSNSSR....Epegdp...........................assltsSPDAL.AV.F.E.SL....GI.......L....FAA.LV...S..T.E.RSANalsaa...................gtkewrNKLGQ.A.LSEYI.P.LC.AG.-.---............VSIPL..RDR...LEAL.Qkdfn..............................lyghDGEK...S..LEDT..............MME.N.VNISA.....lEFE.SNV....................LDGV..I..IN..S..RAGP...YIYVNA..LLV.GRPLV.DDNMVVNYLN---NRYG.GDR..........------MALIEDLITAAF----.DVL.SNG.MYR.N..E.PN..RTMFIFRS---FLVNKLPPFFAEm..............cTS.AINPip.....................meLCITRALS.....RI.DP-.--..NA..F..P..SFS.EM..F....A..--....MQGN.SI..L--.-.....-...---.-...SD.VRQEFLFACALHKLIP.EASIERLLGE.NPM--.--..--.-.--QTLP.V.G..GQ..F.R.R.EDLVSQINSNper..................................aeqLIN......ELESMEGNAGA......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------iaaa....................................................................................................................................................................................................................................................
A0A5B0R0V3_PUCGR/428-728               ................................................................................................................................................................................................................................................................................................................phpnlvlghh--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......---SDLD................LGI..HPLLD.SLG.KS...sKETPISE.LAV...KLHQSIV....TATK..S.F..DLSTCITLTEA..L.-SS...L...-D.....SLSTL.FLWIE...P.R.KLLGPVRDL......LD-HW................N......D......I..........R.......N.......N....V....NQ...........LvnnS.........D.....N...D...E....S.S...........SGS..........EFEK.FGRLLGWLQGVVGRFSL...M..S.-N...L...SY-...........--....HLG....ATTGFTIH..HL.S.NPST..---SYP.IS--..-----SLPASHQS..TLSSWI.EALY........GS..S.....GIPDDLL......G.HTDPRIF..FSISASLFKQSFD.....AL...T...I...........G......LI-....D..........LQT.FRDGLS............Y................F....EHKLLVGGcAVGVVGWLLNE......LT.RVG.R.I..-....S.A.....S..SY.PT....AL.L.EIL..QS.I.L.....L..S.D..A.I...T..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ptalhlvsarslaviraf......................................................................................................................................................................................................................................
A0A2P7YES6_9PEZI/109-851               ....................................................................................................................................................skariskaaqesifalisspyasgeyprsadestrtfrallsyvqtynafetvqqidnpgaqapdvamvaayehlgaflvilltnlkvrkhlihaipkgvkanitsslnhfattlsqwsqspiyqklqmimkvpplvdqnpdgslnfttteiamevadiprinsrc--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..--GL...YTYFNA..ALC.HRPLI.DDIHILSFLQ---TRYG.DDH..........------QSMINDLIIGAF----.DAF.MNV.LHR.H..E.SP..QVIFCHRS---FITNKLHTLISN................-L.AMNQlypp.................gvmeQCIQMALA.....RI.DT-.--..HP..F..P..PLS.SD..S....A..GI....---N.ET..I--.-.....-...---.-...RD.VRQEFVVACHLHQLLS.ESTASAILGG.AAL--.P-..--.K.PANATR.P.G..KQ..N.L.L.QQLIGNPQKTd......................................dLVN......ELEKMLGDAGA......-------................---..-----.---.--....-------.IAA...ALVEALR....HFAA..S.K..ETMSLKTMCTA..I.CRK...L...-P.....SVDIV.LQYAR...L.N.DFLLPLCAY......LN-DW................T......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....S.E...........LQP..........AYED.FATILLTTFAIIHRYDV...S..I.AE...L...DGF...........DR....---....--ESFIVK..YL.T.RMSQ..------.----..SKQKTDISQDERN..ILGKWV.KGLFavd..ekgES..S.....GITDETM......S.GCSPQAF..YLLVPTLFEQIVL.....AC...R...A...........K......AL-....A..........PNT.LKGGLE............F................L....LEPFLLPS.LIGGCSWLADH.....aLI.NGK.D.A..-....-.-.....-..--.-D....II.L.QML..HK.L.L.....K..P.T..S.I...S..GD...........AHTMHT..LIL....GSLYQKLRPCLTELDKRH..--....---------.----..-----.-...----.....-......--.....AN.RK.D.IP.QLIA.TL...K.P.Y...............A.D............S...QY.SA..QA..V.RSE.......EReW.VS...S..........S...G..T....LKGALSDLITQLt....tWS.NNSDmi............sipTKYC..HR..M.VEAII..EKYG...ADEV...LKLIVDDV.ATQTA---....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------igfgswaldvatslicvpnlynt.................................................................................................................................................................................................................................
C5DPE0_ZYGRC/1-1081                    ..........................................................................................................................................................................................................................................................................................................................MENENFYKLALRCADRQIASGDFLNFYKEFYNEKFSAK....................MENE...........................DTPNES-KVL...........EVSNLLASECIRLL.....SFE...K.....SL...ILAN..YVVEMVF.......VNY...NSD..LVH....AFLPQLYYIT.....NSNMLIHFFAQ.SSAF.................................................................................FSKL.SDKL.VMDQ.LN.K.D.LS..TY.V.IPSI.......................................................LN..V..D......VT.TI.GN...DL..V..V..AICKFLLL..M..M.NFINGN....V......................................VLSSD.RS.R.D.NL....NA.......L....LNR.LS...K..V.N.KLLH..............................KKVQQ.Q.ADAKL.I.FK.NA.K.NNVf..........pLESAV..QEF...VSSP.S......................................ITSP...Q..FEPS..............PIS.N.AKAQAs...ggATV.SGA....................KYQD..I..KL..V..RYYK...NIWLNN..KII.NWGPI.DSDFLSRYASIATSAFQ.GVT..........YSPQSTDSILQDLIETSFTCFA.QFV.NNK.QYH.Q..L.NS..NFNLLERQWMVFICKHLPLLILE................NG.SGNS.........................HTVPQALE.....SI.DDK.VV..KA..I..R..TYY.SE..K....D..DM....KGRN.ED..LFD.D.....Y...PSN.N...LD.IRHEFIKNLVSLGLQS.PTLLNDYLRE.DQMID.TR..TL.L.TTDDLI.V.T..NS..Q.G.V.QELVKDFKHF........................................LTN......SLDSLEPEVLI......NDSNDNA................DGL..QQIFH.NFE.NI....PPTKQRE.ISN...ILIDILQ....HALE..N.L..EFDRIAKICSV..L.SFN...F...SH.....SLTTI.LSFSS...P.T.KICEMLIKF......VDVSW................D......K......F..........V.......E.......P....R....CK...........E...L.........V.....E...S...E....Y.D...........TMN..........FFLS.FSCSILLLIVIWQTYDF...S..L.VD...V...VLQ...........SS....ESN....TENSFVIS..YI.S.KLPE..IPDVFL.LDPK..NSLDQEMRTKSHQ..VVQNWL.RDLF........VN..G.....SISDDLL......Q.SVDLKQL..AVLVPFIFKQVLL.....TL...E...V...........G......AIE....D..........VSN.LVGGLE............Y................F....LQPFMLIG.LVKIVYWLEQY......LY.SLK.S.E..N....L.D.....E..GL.LE....KL.L.TLL..NS.I.F.....N..P.Q..A.L...N..ED...........SKLFHS..SLL....RLNAVRLLRVLRQFRS-Q..SQ....SNYGIYSTE.SSGH..PKLEL.L...IERL.....L......SA.....LN.VS.P.TY.NLDP.RV...I.T.T...............-.E............N...IY.SQ..KQ..V.GYG.......RF.L.IL...N..........E...N..P....INKIMTNQINSF......WN.LHSS.................TYYN..LD..Y.LKEVI..NLVS...PRVF...LQDVLATL.EYKLDTYG....VAG.TRN..KIA...A.....VESEHVMDYL.FYFLVLYD.VR.S...Q..V...D.AV.S...L.LQVMDGNSES.........P......IVKEE..MQMKTTEVA.....................................PKAEVSQ----.DDDFDMLFGEP.............................ETNVTGVDKE--..................NQSTN......V.eSk...pTESKYNLTATL..ERHSF.GLIIH......EMKQ.ECNE.A.L..ST.GDISKDVCDKITKYHEKYVYL-l.......................................................................................................................................................................................................................................................
A0A316VJT3_9BASI/197-519               ....................................................................................................................................................................................................................................................iqamlvqslvdrdavrldrwqtgkhslaeaemllrpsqitmdakhmsmtvseytsqrllsgealddpnfv--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.--E.AIe..sDYSTQDQ.LCR...ALMESML....NWAN..N.N..ELEPLSRACSM..L.-LE...S...SS.....ALQIW.LFFVS...P.A.QALQPICVI......LD---................-......-......-..........-.......-.......-....N....PD...........-...L.........L.....Q...S...G....-.E...........DPS..........VLAP.IVLFGQFVIQIGLGSGA...S..L.ED...L...CPS...........SR....---....--SRFLPS..VM.R.SLTA..T-----.----..-RPLDRLSKMEQE..TVANWI.TALF........GS..D.....GISDDLI......R.ASSPQLL..MRIAPTIFSQAII.....AT...S...T...........N......VI-....D..........MDT.LRGGLT............Y................F....LQDLLSYT.L----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------pgalrsvanqiqrgqsgenadaenskkyrevcievlrcvlldescsv.........................................................................................................................................................................................................
R9P832_PSEHS/561-854                   .......................................................................................................................................................................................................................................................................................................dghklasevqsltqslrmd--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................--A......QLEGLALDTLF......-ETRVST................DDP..VELLQ.RVA.SD....PGT-QFI.FAR...QLVLQMQ....DWLE..Q.H..DLESIARWSKA..L.TEE...A...CQg..gaMLDTV.MIYIE...P.V.QLLDPLASI......LD-HQ................D......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...L....G.Q...........TSD..........EPST.LSNILLFVQLLCYRYTI...A..P.SD...I...SRY...........TSp.nsDMN....MDDTYAPS..D-.K.SGSP.fLATHLA.TSSV..SYPLTALSEEDRG..LVSRWV.HALF........GN..E.....GISDDLI......S.ASPPTTL..LRLSPLLFSQSIS.....AC...Q...H...........G......II-....D..........LET.LRGGLS............Y................F....LQDLLSFA.LPGALIWL---......LS.EIT.R.T..P....L.Q.....P..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ildflsd.................................................................................................................................................................................................................................................
A0A420ILB0_9PEZI/57-972                .............................................................................................................................................................................................................................................................................................................nycldtkasryvi--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....-CLLELGYVD.....LPNLLDTLWHY.STCSviatatsp.................................................................erklekwvNSFA.AEET.MFYR.LV.R.A.IS..SG.S.TPTM.......................................................--..-..-......-V.KE.AV...ET..V..R..ACTQWIEG..I..I.SATRSQ....Nelptis.........................psqvselNAQSM.--.-.-.AL....GT.......L....VVS.VV...E..S.-.AIVQsaivrg.................hlgtrlrKRFGE.A.LSGII.P.LM.VL.Q.NST............QGAAR..LEV...FRTE.Kllvieptqkl.................mkrtvdkeiddI---...-..----..............---.-.-----......---.--Veegledam....avenmivsEIAQ..V..NT..K..A-GL...YVYLNS..LLV.GRPLI.DDNAIFSFLQ---NRYG.GDI..........------QSTIIDLILASF----.DIL.ANA.TIR.N..E.KD..QTKNLLRT---FLINKLPLLLTS................LC.SQLFppl...................tseYCITQALS.....DV.DT-.--..TI..F..P..TLS.TM..F....D..ET....--SG.GN..LFP.D.....S...---.-...--.VRQDFCFACCLHGLVE.ESSIEELLGD.VPI--.--..--.-.--QSLP.A.E..GR..Y.V.K.RDLVENCLSDler..................................aekMID......ELENMDGNVGA......-------................---..-----.---.--....-------.VSN...AIVEVIS....RLCN..N.K..ETMALKALCRQ..L.-VR...K...PS.....SLDVL.LLFDK...P.C.TILQPICDL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLLLSFVNRYNL...T..P.IC...L...GPR...........QP....---....--GSFVLK..IL.Q.TPHT..LLA---.-HPP..-------SPKTQS..HLNNWL.LSLFs......pEN..S.....GLTDDLM......S.SCPPQEF..YLLIPALFHNIVL.....AY...A...T...........Q......NL-....T..........TSM.LCSGLE............Y................L....VDAFLIPS.LVTGISFLSAY......LW.ENY.G.D..-....-.K.....D..AI.IQ....ILtA.LIL..NP.R.S.....K..K.K..N.T...N..TD...........ASQIME..VVL....DITAKELEQSLRWLQRVE.pQR....Q--------.----..-----.-...----.....-......--.....-D.IE.P.LS.KAIR.SN...L.G.W...............E.R............S...AA.CE.hTE..L.--E.......NW.T.ST...P..........G...G..G....LSIVIKQTLNNLl....qWH.LQPNe..............npPNYT..HR..Q.ILVGI..KMLG...AKRV...IDIILKEF.RAGIDA--....---.---..---...-.....GHTGAALDVA.SAVVCAID.SV.T...W..D...S.TY.C...R.IG--A--GTN.........N......DGELR..IPQRRLNLR.....................................EALKIEVENAPkLHKIDPFVAEAtlr......................lyrkV-----------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------esllatngigtnnvlsaeaeldaacdmanmtqsdgggingnisslddm........................................................................................................................................................................................................
M1VVS5_CLAP2/320-939                   ............................................................................................................................................................................................................................................................................................................isntraalyiylna--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........--SGQTQSGVIDLILASF----.DVL.ANA.VFR.S..E.AS..KDAHLLKT---FLISKLPLIVCQlc...........tgfDI.NSTE.........................FCITEALN.....RV.DT-.--..TI..F..P..TTS.LM..F....D..ET....RSNN.PY..T--.-.....-...---.-...DS.VREEFCTACALHGLVQ.RDHVERILGE.TSMSY.ES..SL.E.K-----.H.S..KD..R.L.V.QDCFADAEKMq......................................gLIR......DVEKIDGNVGA......-------................---..-----.---.--....-------.VAH...ALVDIMR....QLCH..N.K..DTVSLHLLCSQ..L.-AQ...K...PH.....TLDIL.LLFEK...V.S.AILQPLCQL......LD-NW................H......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........IYEE.FGSILLLILAFSYRYNL...T..A.VD...M...GIM...........SP....---....--DSSVAK..IL.T.SAHV..------.----..SRERDDLSDQEKG..HVTGWI.KGLFs......sDS..G.....GLGDDLM......S.SCTPHDF..HSLVATIFQNIVV.....AY...A...H...........G......YLK....-..........DEA.LKGGIE............Y................L....VDTFLLPS.LVPALRFLADY......LW.VEQ.K.E..-....-.-.....-..--.QK....AI.I.RIL..QL.I.L.....L..P.S..S.I...S..GE...........ASAMLS..SVR....NLVAAPLDHSLRTYQRQD..PK....N--------.----..-----.-...----.....-......--.....QN.IE.P.LL.MALR.DN...L.P.L...............S.R............R...TG.GA..DH..C.ELD.......SW.T.IS...S..........S...T..G....MAGALRHTVQGLv....qWA.IHPAan............tiaAPYT..HR..Q.LMAMT..RVAG...AKRT...LCLLVDEV.RTQSEA--....---.---..---...-.....GSASIVYDVV.GAMICAPD.VT.N...E..P...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ppakgmlgasghapvttgrpltlrqmlalwaeqartlqkkdatfadivvrlhrrveah..............................................................................................................................................................................................
N1PN55_DOTSN/270-821                   ......................................................................................................................................................................................................................................................................................................................ragl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...FIWLNA..ALV.ARPLT.DDATIQSHLF---NRYS.GDS..........------QSLVSDLLVATF----.DVL.TNA.MLR.K..E.SR..QNVKVIRS---FLVNKVPVIIST...............lSG.ISAE.........................SCIQMALI.....PG.GMI.SM..NP..L..P..PIT.NG..A....T..ET....---R.EH..L--.-.....-...---.-...TA.ARLDLLQACHLHGLIS.EATVAAILQS.SVA--.--..--.-.----LP.R.V..QK..L.N.K.DSLISQCANNvsr..................................lesLVE......DLDGMQGNAGA......-------................---..-----.---.--....-------.ISG...CIVETVH....NLCV..N.K..DTMSLKTVCNA..L.IKK...I...-P.....RMDIV.MQYAQ...P.S.MILFPLCNI......LN-GW................T......-......-..........-.......-.......-....-....--...........-...H.........D.....Q...D...Q....S.E...........FTP..........QYEE.FASILLLTLAVIQRYEL...H..W.SD...I...GPI...........E-....---....--ETFVSR..LL.D.NMST.sLPE---.----..----SELTEQQKA..QLSKWImEGLFavd..ehgET..S.....GIGDEVM......R.QCPPQDF..YRLVPTLFEQSVL.....AS...R...A...........G......AL-....S..........MRT.FKGGLE............L................L....LEPFLLPS.LIMGLGWLASH......SW.EDQ.N.D..A....E.I.....L..--.--....--.L.QIL..DK.L.L.....K..P.S..S.S...S..HE...........TQAMHK..TIL....AMVATPLYQSLQALLTRQ..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------pdkkkatelskilepylnqqrilscrkgeldewlqtesglashvqrgirdlttwaatsssppnppprytfkefavacqvlegdalldamveevaqsln......................................................................................................................................................
A0A2N1JEG5_9BASI/325-450               .....................................................................................................................................................................................................................................................................................................................galcd--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..---------SSGA..LLERWC.AALV........GS..D.....GVSDELL......Q.ASSPKTM..YQLAPAITYLLIE.....AH...A...L...........K......LI-....D..........KSA.LHSALS............Y................F....LQAPLRYT.LPCILFWLMQQ......VR.RSL.A.T..A....V.Y.....L..QL.AD....VH.L.EML..LA.L.F.....R..A.A..S.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------fpdtvrtil...............................................................................................................................................................................................................................................
A0A1C1CDD1_9EURO/464-725               .......................................................................................................................................................................................................................................................................................................................agf--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.ISQ...AIVEIMH....NSCQ..S.K..ETQYLKDLANA..I.-LR...K...PA.....AINCI.ALFIR...P.S.FFLSPLCSL......LD-EW................R......-......-..........-.......-.......-....-....--...........-...W.........D.....E...I...H....G.E...........AQP..........VYDD.FGAIFLLILVTKARLDL...P..N.SE...L...GIR...........KK....---....--GGFLSE..YL.R.HENY..------.----..EHSLVDLSEEKRA..HLGNWI.NALY........LA..E.....GLSDELF......T.SCSPHDF..YLLIPTLLRQSVT.....AY...Q...Q...........G......KL-....T..........HDA.LKAGLD............Y................L....LEPFLLPS.LISALGWAGEV......--.-FH.Q.D..-....-.-.....S..AV.VG....KV.L.DVL..T-.-.-.....-..K.A..P.G...T..TE...........SRDIHH..TIL....AMCAPRLK----------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------lrltasaskdsnig..........................................................................................................................................................................................................................................
G8BG32_CANPC/629-805                   ..............................................................................................................................................................................................................................................................................................................qfdlllhnkrdt--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...----IHYL.IRESYTF-....---.--Q..ETK...D.....ENSKLFINLL.VSMSILDS.IE.T...K..D...D.VE.Y...W.KQELNKTSQT.........Q......T----..-EGGNGNG-.....................................NGNGEEYFSCTlDYHFSSIFNDDvdk......................dndsDELLNSNNDND-..................NDQVD......I..E....mKAPSSEEMRTA..QRQL-.--VLR......DSLL.SHFR.A.I..KDkTNHTNLFYKTVKILTDKILEEL........................................................................................................................................................................................................................................................
C5DMR8_LACTC/3-1070                    ........................................................................................................................................................................................................................................................................................................................en--QDPIYSLALNCSRRRLPSNLFVNFYNELVNEKYGSM....................INSG...........................EETDADIKQT...........NVCEKISSSLLRLL.....DAE...K.....HF...LIVD..YVVEVLF.......INY...NKE..LVK....ELLPQLYSIK.....DSSQLVLFLSK.ASAF.................................................................................FLRL.TDKL.VIDQ.IC.G.D.LG..NV.I.VPSI.......................................................LS..S..S......FN.TQ.GE...EL..I..V..AIAKFLRN..V..L.SLSSNP....I......................................AISDP.KV.G.D.RV....RE.......L....LNC.LS...K..I.N.RLLY..............................KKVAG.D.FDSLL.R.LG.GS.A.PP-............TAREE..RHG...VSSP.S......................................IISP...R..YLES..............PIN.V.TKQPQ.....sLIP.SSV....................NHQT..V..KL..A..RYCK...NLWLNS..RIM.GWRTN.DVAFVTKYSKIEAEIMK.KTS..........PSQLNVEAAMKDLIETAFTSFA.QFV.SNK.QYH.Q..A.NS..AFNLLERQWNIFITKQLPLHIME................NA.SDMP.........................HIVINALE.....NI.DHK.VV..KA..L..K..SYA.SD..K....D..DA....KNRG.ED..LFD.D.....L...PNK.N...TD.IRHDFLKSLIMIGLQP.AAVLNDFLRE.DQVVD.TK..SL.P.TNDTVV.I.K..NA..Q.G.V.KETVDNFSQF........................................IKD......TIEDLDAESMF......EATDGSLgn............adNGI..MQILR.KFE.TL....AATKQKD.LAN...VFYDLFR....ESVS..S.F..DCKTFSKTCCL..M.CFN...M...SH.....SLTTM.FAFVN...P.Q.KFLAVAIEF......VDQIW................E......S......S..........V.......R.......K....A....SA...........G..lN.........D.....E...S...D....F.E...........PNT..........EFVC.FTYALIFIVQVVGTYNV...S..L.IE...A...LST...........SS....-SD....PQSSFIVN..YI.T.KLGD..IAPALK.LNST..--------LDSSE..VLKSWV.RDLF........IN..G.....SISDSLM......K.SANVKDL..AVLIPFIFKESLS.....AV...E...S...........G......SIR....D..........ISA.LVGGFE............Y................F....LQPFLIVG.LIGIVFWTEQY......LT.TLR.S.K..D....L.A.....K..DL.LE....SI.F.DML..NS.V.L.....N..P.S..T.L...N..DE...........SRPLHT..LIL....RLNTVQLLKATRAFQT-Q..TQ....SSYGTYSSD.SEGS..TKVDS.L...ISHL.....E......QV.....AR.SS.I.LY.NVDS.SV...I.N.S...............-.E............I...GY.QR..KD..I.NYT.......PF.A.IT...A..........D...N..S....INSILTNQVNSF......WN.LHSS.................TYYN..ID..Y.LFALI..DIIT...PQRF...LEDMLVVL.QHKTTDAA....LPN.SRT..KGS...D.....GENLFYLDYF.FYFLVSHD.VM.K...A..E...N.KT.D...I.LQYMSSTAES.........D......LIFRK..PAHEFQPS-.....................................AKVEQPS----.DEDFDMLFGE-.............................DTSIPGNESE--..................ANINE......I..K.....ADEISPINPEF..LRCSF.AAVLH......CSLL.ANKA.A.L..ES.GHTSEVAVDQLTQLHDKYIEIL........................................................................................................................................................................................................................................................
A0A1V6T5D0_9EURO/6-972                 ........................................................................................................................................................................................................................................................................................................................an--SDRWRTFLHRCLSQRVDVDEFKGLSKLMLNRSPVK-....................-E--...........................----------...........--------------.....---...-.....-D...ELLD..LLLGARAt....ssVSW...DPL..LPVy..vDGLCKVGQVK.....PSAALTSLLKH.SSIRgtte........................................................................sksktSTLM.TDIK.VIQD.VM.M.A.VS..TG.A.IPRT.......................................................--..-..-......-I.AE.AA...DL..F..F..AAAGWIEA..V..V.SWHNEN....Ldimqq...........................asglmsNPDAV.SL.F.E.SV....GI.......L....LAA.LF...N..T.T.KGIDaltstwi...............drahqglkVKLGQ.S.ITSYL.P.IC.VD.-.---............VSLPL..RHR...LDAL.Qkefnlygqqps...............knlenseieglnVNSL...H..FETSvi..........dgPII.N.TRAGL......---.---....................----..-..--..-..----...YVYLNS..MLV.GRPLV.DDSILINFLT---NRYE.DHQ..........------EILISEMITAAF----.DVL.SNG.VNR.N..E.SG..RTMFLFRS---FLVNKLPALFSA................MT.TASMvpi...................pieMCITQALS.....RL.DP-.--..NA..F..P..SFS.QM..F....S..--....MQGS.SI..L--.-.....-...---.-...SD.ARQEFLFACANHRLIP.ESSIERLLGE.NPM--.--..--.-.--QTLP.V.G..GP..Y.Q.K.DDLVPQITTNler..................................adqLIG......EIESMEGNAGA......-------................---..-----.---.--....-------.IVR...AVTEVMY....GLCH..Q.K..ETVTLKGICNS..L.-SR...R...PE.....ALDVI.LLFRT...A.K.QVLQPLCAL......LD-SW................R......-......-..........-.......-.......-....-....--...........-...W.........D.....E...E...Q....G.E...........NQL..........VYDE.FGSILLLVLAFKYRYEL...S..P.SD...I...GIS...........SN....---....--SSFLVK..LF.D.RGAR..------.----..SQKLSDLSEKQNK..DLGSWI.TALF........IA..E.....GINEETM......S.SCSPQEF..YLLVATLFDQSLG.....AC...E...S...........G......KL-....D..........FDT.VKGGFE............Y................L....LEPFLLPA.LVVGLGWLGNH......LW.ESE.T.D..P....A.I.....P..--.--....--.L.KTL..LS.L.V.....K..P.S..S.I...S..GE...........AQAIHK..TVL....NITARPLEEQLKDVRTRH.qSR....T--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DALD.PY...L.S.F...............R.R............V...GS.SH.rSE..L.--D.......NW.A.AQ...P..........V...G..G....LPGSIRNTLQALv....lWS.TNSEma............mqpQSYT..HR..Q.MLAGI..RILG...SARV...LAALLDEL.KHQAET--....---.---..---...-.....GHVDIALDIA.ATIVCAPM.AE.S...-..-...-.--.F...A.VDQNSCQPVD.........S......TKEAL..PRCSILTLR.....................................DALALQHDNVPkISEKDPVRAEIivr......................lwrrVSVLAAPPSQVS..................-----......-..-.....NIDVSNIIHNM..HLGGV.D-GQD......RMDL.EPSAgD.V..GG.DGVGEDNSDNINDMLDK-----aaaa....................................................................................................................................................................................................................................................
C1GBZ9_PARBD/11-963                    ........................................................................................................................................................................................................................................................................................................................wl----QWKKFLHQCLSQRTDASEFRGFAKLMLNRYPMP-....................----...........................----------...........--------------.....---...-.....GE...KLVD..AILESRSv....tnVPW...DPL..IPLy..vDSLHRIGRVK.....IEEILKSLLVH.STVSqkqesvqs.................................................................isrpktsvSTLM.SDYC.IIHN.AT.I.A.AT..SG.H.APNT.......................................................--..-..-......-T.TD.AA...NI..F..A..MLAHWIIA..L..L.SWMSSN....Eagrep...........................adllanSPDTL.AV.F.E.SL....GI.......L....LAA.LV...G..T.E.KSVNalsss...................eskgwrDKLSR.A.LSAYI.P.LC.SG.-.---............VSIPL..RDR...LEVL.Rkdfn..............................lyvhDGQK...S..LEDT..............MME.N.VNISA.....lEFE.SNV....................LDGS..I..MN..S..RAGP...YIYINA..LLF.GRPLI.DDNMFINYLN---NRYG.HDR..........------MTLIEDLITATF----.DVL.SNG.MYR.N..E.PN..RTMFIFRS---FLVNKLPPFFAE................MC.AS-Sidp..................ipmeLCITRALS.....RI.DP-.--..NA..F..P..SFS.EM..F....T..--....MQGN.TI..L--.-.....-...---.-...SD.VRQEFLFACALHKLIP.EASIERLLGE.NPM--.--..--.-.--QTLP.V.G..GQ..L.R.R.EYLVSQINNNper..................................aeqLIN......ELESMEGNAGA......-------................---..-----.---.--....-------.IAA...AITEVMH....SLCS..R.K..DTMTLKNICNA..L.-SR...R...PQ.....SLDVM.LLFIS...S.S.TILQPLCSL......LD-AW................K......-......-..........-.......-.......-....-....--...........-...W.........D.....E...E...Q....G.E...........NQP..........VYDE.FGGILLLVLAFKHKYGL...S..H.QD...L...GIS...........NP....---....--DSFVLR..LL.Q.HGSS..------.----..SQRLEDLDEKQKN..NLGAWI.TALF........IA..E.....GISDESM......S.SCSPQEF..YNLVATLFSQSLA.....AC...E...A...........G......KL-....E..........FET.LKGGFE............F................M....--------.---ALTWLGHH......IL.ESE.S.D..L....S.A.....S..--.--....--.L.KIL..LA.L.V.....K..P.S..S.I...S..GE...........GQEIHR..TVL....FITAKSLEDQLKGIRTRH.pSR....N--------.----..-----.-...----.....-......--.....-D.IK.T.IL.EALE.PY...H.S.F...............Q.R............R...GT.AR.cGE..V.--E.......GW.A.AN...P..........A..gG..G....IVASIRNAFSSLv....lWS.TDPDis............mtpPSYT..HR..Q.LVAGI..KLVG...AVRV...LRGIVDEL.RLQAET--....---.---..---...-.....GSGDIALDIA.ATLICAPL.SE.S...-..-...F.AA.E...Q.AEFHP---LN.........S......SKDAI..SRRSILTLR.....................................DALAFERDSISkMIDTDTLRAELivr......................lnrrVDSLTAIPQIT-..................QE---......V..S.....NIDVSNIMQDI..N----.-----......----.----.-.-..--.----------------------ldeehmgiggqgqahdtdqggkqtgqpdqrgeda......................................................................................................................................................................................................................
I1CL94_RHIO9/544-822                   ..................................................................................................................................................................................................................................................................aellgnknqslmdidqdneersspavvvdqnldqrmeslranlsiveltellhigl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.-V....SSIHLRR.VLD...FILEILQ....EKTL..E.N..NFHSVSKICDA..L.-IE...C...PC.....SVDLI.LQLYT...P.S.HLLTPLENF......CN-HW................T......P......E..........S.......T.......S....I....DF...........D...M.........D.....E...G...E....Q.K...........TTPeqgl.dgiqlLYNK.FGKVWHLIFSVMNRFKL...Y..KdMD...S...VFK...........EP....---....--KGFTFQ..FF.K.RGTI..IYG---.----..-EDIDD--INMDQ..LVNSWL.STLA........GR..G.....RDINNLL......E.STKPQHL..LMIAPTIVHRSML.....LY...S...Q...........N......QI-....Q..........QET.FTSMMS............Y................F....QTAYL---.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------dftqa...................................................................................................................................................................................................................................................
A0A0L0VFJ0_9BASI/335-461               ....................................................................................................................................................................................................................................................................................................sdsvgtdesvpvyykyahhscl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......------E................LGL..HSLAN.SLSvDI....SSTTISE.LIN...KLVQSLR....LACE..S.F..DLSRCISITKS..I.--T...K...SE.....SLSVL.FIWAK...P.V.QILAPIREL......LD-DW................N......S......I..........R.......N.......R....T....SN...........N..hH.........L.....K...N...D....L.E...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------dhrtvhsn................................................................................................................................................................................................................................................
A0A1L9PQD1_ASPVE/12-1025               ........................................................................................................................................................................................................................................................................................................................qa--QAQWKTFFHRCLLHHIDAAEFRELSKLLFQRYPIND....................--AP...........................----------...........--------------.....--L...M.....DA...LLAT..RAVASA-.......VKW...DPL..LPLy..iDSLCKMGYVK.....ISTVLTCLLKC.SSVRdksvsgaeaasdgdada...............................................tsasakqkedsaskekcYTLM.TDNR.VVQD.VM.L.A.IS..TG.A.TAKM.......................................................--..-..-......PL.LE.VI...HA..F..S..AVADWVLA..I..V.GWHNGL....Lgagqp............................vgmmgTPDGV.LL.F.E.SV....GI.......L....FAA.LA...G..T.A.KGLEvlsad...................shealkVRLGQ.A.LSACL.P.LC.ED.-.---............VSPPL..RNR...LDAL.Qkefnlygqpps................kldvsmmdnvnVNAL...N..FEASvm..........dgPTI.N.SRAGL......---.---....................----..-..--..-..----...YVYINA..MLV.GRPLV.DDAILLNYLL---NRYA.GHY..........------ETLIEEIITASF----.DVL.SNA.MYR.T..E.SS..RTMLLLRS---FLVDKLPPFFSA................-M.LSVSmvt..................lpmeVCISHALG.....RI.DP-.--..NT..F..P..SFS.QM..F....S..--....MQGN.TP..L--.-.....-...---.-...SD.VRQEFLFSCASHKLIP.EASIERLLGE.NPM--.--..--.-.--QTLP.V.G..GS..F.V.K.DELVAQINANher..................................aeqLIG......DIESTEGNAGA......-------................---..-----.---.--....-------.IVG...AITDVMH....NLCI..Q.K..ETMTLKNICNS..L.-SR...R...PQ.....SLDIM.LLFRS...P.K.QILQPLCAL......LD-AW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQP..........VYDE.FGSILLLVLTFKYRYDL...R..P.FD...L...GIT...........SN....---....--NSFILK..LI.E.RGSS..------.----..SLKLDELNEKQNK..NLGEWI.AALF........IA..E.....GISEETM......S.ACSPQEF..YMLVSTLFRQSLG.....AC...E...A...........G......KL-....E..........FDT.LKGGFE............Y................L....LEPFLLPS.LVVALIWLGNH......IW.ESE.Q.D..P....T.I.....P..--.--....--.L.KTL..QS.L.V.....T..P.S..S.I...S..GE...........AREIHL..TVL....NITARSLEEKLKDVRTRH.sNR....T--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DALE.PC...L.S.F...............Q.R............T...GS.CH.kSE..L.--D.......PW.T.TH...T..........P...G..G....LLGSIRNTFQSLv....lWS.TSPGvs............mapPSYT..HR..Q.ITTAI..RTLG...ATRV...LTALLDELlKLQTES--....---.--T..NTN...A.....NTSDLALDIA.ATLISAPL.AE.S...Y..T...V.DQ.S...T.----HHPPSA.........S......SKEPT..PRCAPLTLR.....................................DALNLVHENIPkLSEKDPLRAEVavr......................lyrrVNTLLALPAHHDpnldm........nmgvnMNMNN......I.iD.....NMNLDVGDVNV..DTDNT.GQNMN.....mDMNL.NEQG.Q.G..QG.QNVTDPEHANLNQIM-------gdaaaa..................................................................................................................................................................................................................................................
A0A177UI33_9BASI/130-250               ...........................................................................................................................................................................................................................................................................................................esptpipmleeylrv--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.-RSL..SYQLNQLNENERD..LIGRWV.TALF........DS..E.....GISDELS......R.DSPPRTM..LKLAPTLFSQSIA.....AC...A...T...........G......IV-....D..........LDT.LRGALT............Y................F....LQDLLSYT.LPGPIIWL---......LR.QLT.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------hypppspes...............................................................................................................................................................................................................................................
A0A1E4TNV0_PACTA/2-266                 .....................................................................................................................................................................................................................................................................................................................vdeee--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........E.....D...L...G....L.N...........YQD..........IYID.SSSILLTITLIFRRYKV...P..F.SE...L...ANI...........SP....---....NSSSFVLN..FI.K.NVNN..FPCVYP.--KS..D----E--LEYQK..LMQEWI.HSLFdd...sneNS..G.....CISDELI......K.KTSIQAC..FSIIPNVFQQSLI.....AY...S...K...........G......IL-....K..........YDN.LINAFE............Y................F....IQPFLMFN.LLSIYKCLEKI......LWlKYE.N.R..NvdqlN.N.....D..KS.LQ....LI.F.KIS.rNL.I.I.....L..N.S..S.M...N..GNntv.....sgeSKYLHQ..LIL....EISGCSLYRSFAKYKD--..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------skyyiinedfkelihflkkfskndkdyisiehnnyr....................................................................................................................................................................................................................
B6Q263_TALMQ/2-967                     .......................................................................................................................................................................................................................................................................................................................kpi---QQWRKLLHECVARRIEVDVFCKLVKILARRAPLQQ....................AY--...........................----------...........--------------.....--L...V.....GV...LLES..RAVTADI.......FPY...DPL..IPRy..aTALRKLGLIR.....TATLLDGLRKQ.P--Fiesqstada...............................................................eqsqktvnsSILM.TDTR.IVQD.LI.A.P.LS..SS.S.-PSL.......................................................--..-..D......TQ.D-.IQ...SI..F..A..ITAEWILD..V..A.RWHTSN....Indenq...........................mgglmsSPDAL.AL.F.E.SL....GI.......L....LVA.LS...A..T.A.KGHDalase...................stsdfkIPLGQ.A.LTAYL.S.TS.AS.-.---............ISLNL..RNR...LDSL.Qkgyqlygepps...............kdldvqmmdgmsTNAL...Q..FEASvl..........dgPVI.N.SRAGL......---.---....................----..-..--..-..----...YIYINA..LLI.GRPLI.DDEMLLSYLS---NRYG.GQQ..........------EVLIQELITATF----.DVL.SNA.MYR.N..E.ST..RNMFVFRS---FLVNKLPPFLAGm.............aaT-.---Sieq..................ipmeMCISHALN.....RV.DP-.--..NA..F..P..SFS.QM..F....E..--....MQGN.TV..L--.-.....-...---.-...SD.VRQEFLFACALHRLIP.ESSIERLLGE.NPM--.--..--.-.--QTLP.V.G..GR..Y.V.K.NDIVAQILSNqga..................................adrLIS......EIELMEGNAGA......-------................---..-----.---.--....-------.VVA...AVTDVIN....SLCE..Q.K..ETVTLKSICDS..L.-SR...R...PQ.....VLDVM.LLFCS...P.K.SILQPLCTL......LD-SW................K......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQP..........VYDE.FGSILLLVMAFKYRYDL...S..Q.YD...L...GVT...........AS....---....--SSFVLK..LF.E.RGST..------.----..SMKLASLDAKQNK..SVGDWI.SALF........MS..E.....GISEETW......S.SCSPQEF..YLLVATLFSQTLG.....AC...E...M...........G......ML-....E..........LDT.IKGGFE............Y................L....LQPFLLPS.LVFALKWLGNF......IW.ESP.E.A..D....L.L.....L..--.--....-L.L.KVL..RA.L.V.....K..P.N..S.I...S..GE...........AEACHQ..TVL....NIAAQSLEEQLKDVRTRLpgGR....S-----DHQ.SDIQ..PNPNQ.D...IQQ-.....-......--.....-E.IQ.S.LL.DILE.PY...L.S.F...............Q.C............N...GN.SR.rSE..L.--D.......SW.T.TH...T..........D...-..G....ICGVIRVTFQGLi....lWS.ASAEms............mspHAYT..HR..L.ILVGI..RLST...ASNV...LSALLDEL.RAQAEE--....---.---..--A...S.....GSLDLAIDIA.ATLICAPI.PE.S...F..A...Q.EQ.T...I.YHP-----ID.........S......TKEAF..PRCLLLTLR.....................................QALMIQHQNVPrLSEKDPTRAEVivr......................ltrrVNALLTPPAHVG..................-----......-..-.....TIDVTNIIDN-..-----.-----......----.----.-.-..--.----------------------mnleaaaaaaghdvidlnn.....................................................................................................................................................................................................................................
A0A179H741_PURLI/19-957                .......................................................................................................................................................................................................................................................................................ywsdfiarcifkridvpkfkefiplihskhplppv--------------------------------------....................----...........................----------...........--------------.....---...-.....--...VVAD..LFLRPQPt....ddVSL...DPR..FPPf..iQILTQLGYVD.....APSLLLALYKY.SALHkhvkpahnaeqtdae...................................................gneasqksqeplrwrISAW.SEEL.IFFH.VI.K.M.VV..DG.T.AIRE.......................................................--..-..-......-P.RA.AL...VL..V..K..VLCKWMDL..F..T.STSTAL....Tadvlge..........................iqnpqhRDDLE.TS.R.A.AF....VP.......L....LLR.MI...E..S.T.EFLSviskp...................lakgsrKELSQ.S.LSGFI.H.TL.EG.A.PGF............AERLE..MFR...SETL.Ak...................................fdPADK...K..KQAA..............ANA.A.MDELL......ENA.AGLdd...............fvvADIP..I..SN..T..RAGL...YVHLNA..SLA.GRPLI.DDNALLSYIH---NRYQ.GET..........------QSGAIDLILASF----.DVL.ANA.VFR.N..E.AQ..RDAHVLKS---FLVNKVPLLLCQlfs..........pqfST.TSSE.........................FCITEALN.....RV.DT-.--..SV..F..P..TAS.LM..F....D..ES....RSNN.PY..T--.-.....-...---.-...ES.VREEFCTACALHGLVQ.REHVERILGE.TSMS-.--..YE.P.SLEKLS.-.-..KD..K.L.V.QDCLSDSEKIq......................................gLVR......DLDKMDGNVGA......-------................---..-----.---.--....-------.MCQ...ALVEIIR....QLCN..T.K..ETVFLRVLCSE..L.-AQ...K...PQ.....SLDIL.LLFEK...I.T.SVLEPLCQL......LD-TW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...P...E....G.E...........YQP..........IYEE.FGGIMLLVLAFVYRYNL...T..P.PD...I...GIT...........SP....---....--ESGVAK..IL.T.RAHI..-AR---.----..--DNDELVGRENA..HMNGWI.HGLFd......tES..G.....GLGDELM......S.SCPPQEF..YLLVASIFQSTVV.....AY...T...F...........G......YI-....N..........DEQ.LKSD--............-................V....GDTFLLPS.LVPAIQYLSDA......LW.VEQ.K.G..-....-.-.....-..--.QK....TI.I.KIL..HL.I.L.....L..P.N..L.A...S..SE...........AGAMLS..SVK....YLIAKPLENSLRTYQKQD..PK....N--------.----..QDIEP.L...----.....-......--.....--.--.-.-L.RALK.DS...L.P.L...............S.R............R...TG.AAdhNE..M.--S.......SW.A.SS...S..........S...S..G....LAGAVKHTIQGLv....qWS.LHHGin............atpASYT..HR..Q.LMASC..RIGG...TRRM...LQVMLDEI.RHQSEA--....---.---..---...-.....GSASIVYDVV.AAMICAPD.VT.N...E..P...P.PA.A...S.ILDVS-----.........G......NM-PP..PVQRPLTLR.....................................EVLRAEAEDCRkLQKKDPVLAEI.............................VV----------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------rlhrrvethmvlpqpqallqgqdmp...............................................................................................................................................................................................................................
T0LKA6_COLGC/49-980                    .......................................................................................................................................................................................................................................................................................................psvvadlflrpqphnhesl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...DPR..VPRf..lQVLSDLNYID.....TPSILEALYKY.STSRahsreaaqasn..........................................................ggnpasktlrwaSSYS.AEEV.MFYR.LT.K.S.VA..QG.T.AITN.......................................................--..T..E......TG.LA.IA...KI..M..A..SWIALFTD..A..-.------....Ataftvdvm......................gqlqnsqaREEME.SA.R.A.AF....VA.......L....LLG.VC...E..N.H.TVMKafgsp...................eakntrKALSE.S.LANFV.P.TI.MQ.N.AGP...........iATRLD..MFR...TSTL.A......................................AFEP...D..DEQK..............NTS.N.VEIEDl....fDSS.VALen...............fviSELP..I..VN..S..RAGL...YIYLNA..ALV.GRPLI.DDMSIFNYLN---NRYQ.GDV..........------QTTTIDLILASFDVLA.NAV.SRN.---.E..G.NS..AAPLL-RS---FLMNKLPLLIE-................NL.SKHMypp..................ltaeFCITEALG.....RV.DT-.--..NT..F..P..TLS.SM..F....D..ES....RSNN.-P..F-T.D.....-...---.-...-S.VREEFCWACCLHGLVR.ESSIEGLLGE.TPY--.--..--.-.--QNLP.A.G..GR..Y.V.K.DNLVAECLADper..................................mqaLIG......ELDGKDGNAGA......-------................---..-----.---.--....-------.VCQ...ALTEVLG....QLCR..N.K..ETMSLKLLCSQ..L.-AQ...R...PL.....SLDVM.LLFEK...P.A.TILHPLCDL......LE-NW................K......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLVMAFAYRYNL...S..V.SD...L...GIV...........SP....---....--DSFVSK..LL.G.QGHQ..------.----..SQVFDELSEQQKG..HLDGWI.HGLFd......sEA..G.....GLGDELM......S.SCPPQDF..YLLVSTLFQNIVL.....AF...S...T...........G......HL-....S..........EES.LRGGVE............Y................L....VDTFLLPS.LVVAITYLSNS......LL.IE-.-.-..-....-.R.....P..EC.QK....AI.V.RVL..KS.V.L.....E..P.T..S.I...S..KE...........ASDMLS..SVM....NIVAKPLEHSLRTYQRSD..PK....---------.---S..QEIEP.L...LRSI.....K......DS.....IP.MS.R.RT.GAAD.HV...E.L.E...............A.W............S...GV.QQ..HQ..-.---.......--.H.NH...Q..........N...V..G....FANTLRQTLQSLv....qWS.IHPAid............rppPTYT..HR..Q.ILVAL..NILG...AKRL...LQLIYEDI.RQHSEA--....---.---..---...-.....GSGSIVYDVA.ANLVCAPD.AN.D...S..P...W.A-.N...A.LNFMD----N.........S......GNMRA..PIQKKLTMR.....................................EVLKSDAENCKrLQKIDMNLTEI.............................VVRLHRKVESQ-..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------mvvaqaaaiqadtmlqndlglgldggtgslddamaaa...................................................................................................................................................................................................................
A0A5M9JSC7_MONFR/266-750               ............................................................................................................................................................................................................................................................................................................vkegskrwknsyaa--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.-EEM.MLYR.LA.K.T.VA..TG.V.RPKN.......................................................--..-..-......-V.QE.AV...DL..L..V..VCIQWMNM..V.sL.GMGQGA....Heil...............................dmgaHVEEIgMV.G.M.AL....GT.......L....MVA.VV...G..N.S.KILEvlqkgr..................cpkgtgIDLGK.A.MAGFV.P.LL.IQ.S.SPQ............----N..AQR...LDVF.Rtqtlit.........................ilpvdkkE---...-..--RAtna........einDIL.D.STIGM......NID.SIV...................vADLP..V..VN..S..RAGL...YIYLNA..LLV.GRPLI.DDNAIFAYLH---NRYQ.GDV..........------RSTTVDLILASF----.DVL.ANA.TFR.N..E.GQ..QTTTILRS---FLVNKIPLLVSTi..............aE-.---Sffpp.................ltseFCITEALS.....RV.DT-.--..NA..F..P..TLS.TL..F....A..ES....--SN.ND..MFS.D.....S...---.-...--.VRQDFCFACCLHGLIP.ESSIETLLGD.IPM--.--..--.-.--QSLP.A.G..GR..Y.S.K.QDLVQQCLSDser..................................segLIS......ELENMDGNAGA......-------................---..-----.---.--....-------.VSQ...AIAEVIK....HMCN..N.K..ETMTLKTLCSQ..L.-AR...N...PS.....SLDIM.LLFNK...P.T.SFLQPICEL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLVVSFTHRYNL...S..T.VD...L...GIK...........NP....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------egyfepe.................................................................................................................................................................................................................................................
A0A4Q1B9Z1_TREME/579-721               ........................................................................................................................................................................................................................................................................................................nlphpallqdartaldwa--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-----DLSSEERG..LVSGWV.KALF........GS..D.....GIDDQVL......V.ATSPVNF..CRLACCLIQQAIR.....AV...I...L...........G......QI-....E..........LET.LHNGLS............Y................F....SQNLLSWC.LGGIVAWL---......CE.EIA.R.Q..G....K.L.....S..-A.IH....--.F.VVL..GS.L.V.....L..S.D..S.F...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------pesllranapaila..........................................................................................................................................................................................................................................
A0A093ZY63_9PEZI/22-773                ............................eqfakvlstksplatpliaelllrpnesrhydldpqvslyaqallqadildapsvlrallrhstsrpveaakdeqedasgsksrwtksygheerlvyglskivaagdrpkstqealgtvnaltewmrllvmanaaddmmrqigagnathnqetmavrvavgallvalaenatvnealrnrcpkdtlkgftqslanftpllingssmfaerlelytktlvalepidkkaqkagaeidqiidsamalgmdnipvvevptmnsraglyvylnslvgipvyidvtmltkl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..QLA.GRPMV.DDNQLLNFLH---NRYQ.GDI..........------QTTCIDLIVSSF----.DIL.ANA.IFR.S..E.NP..QTTFLLRS---FLINKVPLLIC-................-M.ISAPmfpp.................lspeLCITEALS.....HV.DT-.--..NA..F..P..TFS.SM..F....D..DT....--SA.GD..MFS.D.....S...---.-...--.VRQDFCFSCCLHGLIP.EESIERLLGE.IPM--.--..--.-.--QTLP.A.G..GR..Y.T.K.DEVLDQCLSDsek..................................ieaFTD......ELEHMDGNVGA......-------................---..-----.---.--....-------.VSQ...AIAELLR....RLCE..S.K..DTMALKSLCVH..L.-AR...K...PS.....SLDVL.LIFDK...P.L.TILPPICQL......LD-AW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...D...Q....G.E...........YQP..........VYEE.FGSILLLVLAFVHRYDL...S..A.TE...L...GVQ...........AS....---....--DSFIAK..LL.I.RGST..ARP---.----..---MDDLSSLESS..RLDGWI.KGLFn......aEG..G.....GLGDEPM......A.LCPPQDF..YLLVPTLFSQVVL.....AS...Q...H...........G......HLT....D..........-DV.LRGGLE............Y................L....LDPSLLPS.LIPALLSL---......TS.NIL.T.A..P....P.P.....-..--.--....--.S.SLL..HA.L.I.....L..P.Q..S.I...S..AE...........ASLLHN..AIL....PIPAPHLSRSLRALQRSA.pTR....T--------.----..-DL--.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------dpliaalrphlhfsrta.......................................................................................................................................................................................................................................
A0A5N6EJ54_9EURO/2-967                 .........................................................................................................................................................................................................................................................................................................................t-SSEQWRAFLHQCLMRRIDAAEFKNLSKILSRRCPIA-....................----...........................----------...........--------------.....---...-.....EG...TLLD..VLLEIRLa....tgIKW...DPL..LPLy..iDCLCKMGKVQ.....TSTVLTSLLKY.SSIHdkqqcpgse..............................................................tvqskkalkcYTLM.TDIR.VIQD.AM.L.S.VS..TG.S.TPKS.......................................................--..-..-......-L.AE.AV...GI..F..S..AIIDWIQA..V..V.AWHNNH....Idpsqq...........................tgglmsSPDAV.SL.F.E.SL....GI.......L....LTA.LS...G..T.G.KGIEvlssd...................shealkVKLGQ.A.LSAYL.P.LC.VE.-.---............VSLPL..RNR...LDSL.Qkgfnlygeppn................kslqsmmdnvnVNAL...Q..FEASvm..........dgPVI.N.SRAGL......---.---....................----..-..--..-..----...YIYINA..MLV.GRPLV.DDSMLLNYLT---NRYG.GHY..........------DVLVEEVITATF----.DVL.SNA.LYR.N..E.SS..RTMFLFRS---FLVNKLPSFFAA................-M.LAASmvs..................lpmeMCISHALS.....RL.DP-.--..NT..F..P..SFS.QM..F....A..--....MQGS.TV..L--.-.....-...---.-...SE.VRPEFLFACASHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTPP.V.G..--..Y.N.K.DDLMSQINTNqer..................................aeqLVS......ELESTEGNAGA......-------................---..-----.---.--....-------.IVA...AITEVMH....NLCN..Q.K..ETMTLKSICNS..L.-SR...R...PQ.....ALDVI.LLFRS...A.K.QVLQPLCTL......LD-SW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQP..........VYDE.FGSILLLVLTFKYRYDL...R..P.YD...L...GIT...........SN....---....--DSFVLK..LL.D.CGPS..------.----..SQKLDDLSEKQNK..NLGAWI.TALF........IA..E.....GISEETM......S.SCSPQEF..YLLVTTLFNQSLT.....AC...E...A...........G......KL-....E..........FDT.LKGGFE............Y................L....LEPFLLPS.LVVALTWLGNH......IW.ETE.S.D..P....T.I.....P..--.--....--.L.KTL..QS.L.V.....N..P.S..S.I...S..GD...........AREIHK..TVL....NITARSLDEQLKDIRSRH.pNR....T--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DVLE.PC...L.S.F...............Q.R............T...GS.CH.rSE..L.--D.......SW.T.TH...S..........P...G..G....LLGSIRSTFQGLv....lWS.TSPGvs............mapHSYT..HR..Q.LVAGI..RMLG...SARV...LTAIVDEL.KMQTET--....---.---..---...-.....GNADLALDIA.VTMICAPL.AE.S...-..-...F.AI.E...Q.SNYHP---VD.........P......NKEPL..PRCPVLTLR.....................................DALNLQHENVPkLSEKDPLRAEVivr......................lyrrVNALMTPTSQMP..................-----......-..-.....NLDMSNIIQNM..QLGV-.-----......----.----.-.-..--.----------------------edhgqmdlepagaghgvgdddaanlnrmldnaaaa.....................................................................................................................................................................................................................
A0A162NKV9_PHYB8/668-977               ....................................................................................................................................................................................................................................................................................ttdlmdtdildmdsplgnnnsnskthrnlmedpedcsm--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.-DSIEIIRQN........................................IEA......RMESILIECSM......-------................TAV..RELL-.EIS.IV....SLVHLRR.IID...FLIDLLQ....QKAS..L.G..DIETIAQICSA..M.-NA...Y...PC.....IVDLI.IQLYS...P.L.AFMGPFEEL......CN-GW................S......P......S..........D.......S.......G....M....--...........F...I.........D.....E...E...Ee..vK.S...........AKS..........LYNE.FGTIWIFVSFVVDRFNL...-..I.RD...L...DRV...........FR....---....VREGFCYQ..FF.S.QGPV..---VYG.IDAS..VP-------DMEV..WVSKWQ.NALF........EN..D.....-VTGELL......R.EMTPQRL..LAIGPTIIKRVMM.....SF...E...E...........D......EM-....G..........VSL.LPSVLD............Y................L....QEPYLHFT.LGPILMLL---......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------cdelmstqyrtalmcldrl.....................................................................................................................................................................................................................................
A0A1B8DZE0_9PEZI/64-759                ..............................................................................................allranildvpsvlrallrhstsrpveaakdgqegaggsqtrwtksygheerlvyglskivaagerpksaqevlgtvsaltewmrllvmanaaddmmreigagnnthnqetmavrvavgallvalaenatvnealrnrcpkdtlkgfsqslanftpllingssmfaerlelytktlvalepidkkaqkagaeideiidsamalgmdnipvveiptmnsra--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..--GL...YVYLNS..LLT.GRPMV.DDNQLLNFLH---NRYQ.GDI..........------QTTCIDLIVSSF----.DIL.ANA.IFR.S..E.NP..QTTFLLRS---FLINKVPLLIG-................-M.ISAPmfpp.................lspeLCITEALS.....HV.DT-.--..NA..F..P..TFS.SM..F....D..DT....--SA.GD..MFS.D.....S...---.-...--.VRQDFCFSCCLHGLIP.EDSIERLLGE.IPM--.--..--.-.--QTLP.A.G..GR..Y.T.K.DEVLEQCLSDsek..................................ieaFTD......ELEHMDGNVGA......-------................---..-----.---.--....-------.VSQ...AITELLR....RLCD..S.K..DTMALKSLCAH..L.-AR...K...PS.....SLDVL.LIFDK...P.L.TILPPICQL......LD-AW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...D...Q....G.E...........YQP..........VYEE.FGSILLLVLAFVYRYDL...S..A.TE...L...GVQ...........TP....---....--DSFIAK..LL.V.RGST..------.----..ARHLDDLSSVESS..QLDGWI.KGLFn......aEG..G.....GLGDEPM......A.LCPPQDF..YLLVPTLFSQIVL.....AS...Q...H...........G......HLT....D..........-DV.LRGGLE............Y................L....LDPSLLPS.LIPALLSL---......TS.NIL.T.T..P....P.P.....-..--.--....--.S.SLL..HA.L.I.....L..P.Q..S.I...S..AE...........ASLLHN..AIL....PIPAPHLSRSLRALQRSV.pTR....T--------.----..-DLEP.L...ISAL.....R......PH.....L-.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------hfsrtaid................................................................................................................................................................................................................................................
A0A165NE65_EXIGL/545-721               ...................................................................................................................................................................................................................................................................................................................tavsqfg--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.----------------V...V..V.QF...M...QLT...........LT....R-L....QLASFSYS..LA.G.KS--..LRSDFL.LSHR..TYTMSELSREELV..AFQNWH.KALFg......rDS..D.....GIDDNIL......R.STNPLTL..LRITPTLLSEAAA.....QA...V...V...........K......VV-....D..........AEC.LRNGVQ............F................F....VGPLLNWT.LVGVVK-----......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------afvaeidrlgycatmqidvlktlaasakdmpvvfrlcannllrmv...........................................................................................................................................................................................................
A0A168CMY0_CORFA/31-903                .....................................................................................................................................................................................................................................................................................................vaqrlsgdrfrefvrlvyary--------------------------------------....................----...........................----------...........--------------.....-QL...H.....PL...LIAE..LFLRPQLs....ncVSL...DPR..IPPy..iCVLTELGYVD.....APSILNRLYRY.SALHaytkpladagqdan....................................................andsnkegdkaqektPVRW.KDST.WAEE.VMfY.H.VI..KT.M.AEGT.......................................................-A..F..T......DT.KT.GL...EL..I..I..IACKWMNL..L..A.QVSSRF....Aadilvsdhdr.................lareglatvrlALIPL.VL.R.L.DN....AA.......L....LRI.LV...R.pR.A.KVIR..............................RFLSD.S.LGDFI.P.TC.QP.S.PFV............DRLEI..FRT...QTLV.Ql....................................ePIDG...K..KKATne.........amdELL.D.STVGM......DSF.VIAd..................iPIAN..S..RA..A..---L...YVHLNAaaSFV.GRPVL.DDAMLYAFLN---NKYQ.ENQ..........------QASAIDLIVAAF----.DVL.ANA.VFR.N..E.GP..KDAHLLRS---FVVNKLPLLLCQlch..........pefSA.ASAE.........................FCITEALN.....RI.DT-.--..SI..F..P..TAS.LM..F....D..ET....RNNN.PY..M--.-.....-...---.-...DS.VREEFCAACALHGLIE.RDHVDRILGE.TSMS-.--..--.-.-YD--P.S.L..ER..A.N.R.DRLVSDCLSDsgk..................................iqnIIS......QLDRVDGNVGA......-------................---..-----.---.--....-------.VAH...AIVELIR....QLCM..N.K..DTMSLKLLCTQ..L.-AQ...K...PQ.....SLDII.LLFDK...V.T.SILEPVCTL......LD-NW................S......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.YGAILLLVFAFTYRYNL...S..P.LD...I...GIQ...........SA....---....--DSHVAK..IV.N.KSHI..LRP---.----..---LDELSEQEMG..HVTGWI.NGLFd......nET..G.....GLGDDLM......S.SCPPHEF..YLLVAPIFQSIVT.....AY...T...Y...........G......YI-....N..........EES.LKGGVE............Y................L....VDTFLLPS.LVPAIRFLSDY......IW.VDQ.R.E..-....-.-.....-..--.QK....SI.V.KAL..QL.L.L.....T..P.I..S.I...S..GE...........ASAVLS..AVK....NLVAQPLEHALRTYQRQD..PR....N--------.----..QEIEP.L...LRSL.....R......ES.....IP.LS.-.--.----.--...R.-.-...............-.R............T...GG.AE.hHE..M.--E.......SW.A.GS...S..........S...S..G....LSGAIRHTFQGLv....qWS.AQSPgaggvggvvavvpnampASYT..HR..Q.LIAGQ..RIVG...VSRL...LRLLMEEI.RQQSEL--....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------gnasvaydvaaaviaaadstne..................................................................................................................................................................................................................................
A0A0L0VFJ0_9BASI/463-678               .............................................................................................................................................................................................................................................................................................................ndggehhhhqnsv--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...I.........D.....E...S...S....-.-...........SGS..........EFEK.FGALLGWIQGVIGRFNL...M..A.NL...G...AHL...........GS....---....-TKGFTIN..YT.S.NPSQ..---SY-.----..--SLTDLGPIQMT..TLSTWI.ESLY........GS..T.....GIPDDLL......I.KTDPRIF..FMISTSLFKQSFD.....AL...K...A...........G......LI-....D..........LQT.FRDGLS............Y................F....EHKLLVEGcAIGVIGWLLDE......LS.RLG.P.I..S....P.S.....-..SF.PT....AL.I.EIL..QS.I.L.....L..S.E..S.I...S..ST...........A-----..--L....FLVSARSLKVLRQ-----..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------fdklftdrkt..............................................................................................................................................................................................................................................
A0A135U3T8_9PEZI/121-1054              ........................................................................................................................................................................................................................................................................................................pvavadlflrpqphnhes--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......--L...DPR..VPRy..lQVLSSLNYID.....TPSILKALYKY.STSRghsreaaqlpn..........................................................aenqtsnsprweSSYA.AEEV.MFYR.LT.K.S.VA..QG.T.AIQNtg...................................................tgLE..I.aN......VM.AK.WI...AL..FtdA..ATAFTVDV..M..G.QLHNSQ....V......................................REEME.SA.R.A.AF....VA.......L....LLG.VC...E..N.Q.VVLKalskp...................eaqeirKALSE.S.LANFV.P.TI.MQ.S.AGP............IATRL..DMF...RTST.Lagf...............................epvdE---...Q..KNKSna.........eieDLF.D.STVAL......ENF.VVS....................ELPI..V..-N..S..RAGL...YIYLNA..ALV.GRPLI.DDLAIFNYLN---NRYQ.GDV..........------QSTTVDLILVSF----.DIL.ANA.ASR.N..E.GN..QAAHLLRS---FLMNKLPILIES................-L.SKHMygp..................vnaeYCITEALS.....RV.DT-.--..TT..F..P..TLS.SM..F....D..ET....RSNN.-P..F-T.D.....-...---.-...-S.VREDFCWACCLHGLLR.ESSIETLLGE.TPY--.-S..SL.P.AGGRYV.K.E..NL..-.-.V.AECLA----Dper..................................mqaLIG......ELDSKEGNAGA......-------................---..-----.---.--....-------.VCQ...ALTEVMG....QLCR..N.K..ETMSLKLLCSQ..L.-AQ...K...PL.....SLDVM.LMFEK...P.A.TILHPLCDL......LD-NW................K......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLVMAFAYRYGL...S..A.SD...M...GII...........SS....---....--DSFVAR..LL.G.HGHQ..------.----..SRSLEELSDQEKG..HLDGWI.HGLFd......sEA..G.....GLGDELM......S.SCPPQDF..YLLVSTLFHNIVL.....AF...S...T...........G......HL-....T..........EES.LRGGIE............Y................L....VDTFLLPS.LVVAITSLANS......LW.VER.S.D..-....-.-.....-..-C.QK....AI.V.RVL..NS.V.L.....A..P.T..S.I...S..NE...........AQAMLS..SVM....NIVAKPLEHSLRAYQRSD..PK....S--------.----..QEVEP.L...----.....-......--.....--.LK.A.IK.DSIP.LS...R.R.T...............-.-............G...AA.DH..QE..L.--D.......--.-.AW...S..........M...G..G....FSNSIRQTLQQLv....qWS.IHPTmd............rmpPAYT..HR..Q.MLVAM..KLLG...AKRL...LQLLYEEI.RQQTET--....---.---..---...-.....GSGSIIYDVA.TALVCAPD.VV.N...-..-...T.PS.N...P.INFID----N.........S......GNVPA..PVQRKLTLR.....................................EVLKSDAEECKkLQKVDMNLAEIvvrl.....................yrkvETQMAVSQAEVI..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------qadtmlqtdlglsldagagslddamaaaaanvaqgdgmsvd...............................................................................................................................................................................................................
A0A5N5N8U1_9PEZI/43-997                ..........................................................................................................................................................................................................................................................................................splspilvadillrpdarnsyapdplatpfld--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....-VLLRRRSVT.....PAAVLFALARY.SSLRqpqarqdeeehadgg..................................................adgkkassekpsmrwaNSFV.VEQV.IFMR.LA.K.A.VK..DE.D.AVKN.......................................................--..M..K......DA.VD.VI...KI..L..V..QWMALFTD..M..A.AAFAED....Vmgav.............................hgnnvKIEVE.CS.R.S.AF....VL.......L....LST.IC...E..N.P.AVLSalsgm...................saqggrKQLSD.G.LAKFI.S.TL.QP.T.EITp..........qLEMFR..TQT...LPSL.E......................................PVDK...Q..KEAAea.........qvyEVF.D.QTVGL......--D.SFQ...................vRELP..V..EN..T..RAGL...YIYLNA..ALV.GRPLI.EDTALFTYLH---NRYQ.GDL..........------QTTAVHLILASF----.DVL.ANA.VFR.N..E.GV..KSGPLLRS---YLVNKVPLVLAS................FA.ANTNsiyp.................fnseFCISQALS.....QV.DM-.--..NV..F..P..NVS.DM..F....D..-I....SSAH.NT..F--.-.....-...---.T...EN.VRQDFFYACLLHGLVS.ESSREKILGD.ITF--.--..--.-.--QSLP.G.G..GR..Y.Q.K.DVLVQECLQNper..................................mkeLIG......EIDAMEGNAGA......-------................---..-----.---.--....-------.VCQ...ALAEVLV....QLCH..N.K..ETMSLKQWCGQ..L.-AR...K...PQ.....SLDIL.LLFNK...P.E.LIFRPLCEL......LD-NW................T......-......-..........-.......-.......-....-....HD...........E...D.........R.....E...D...Q....G.E...........YQL..........VYEE.FSSVLLIFQALVYRYGL...S..A.AD...L...KIH...........SP....---....--ASFVGK..LL.S.KTHH..------.----..ARHLDDLSEQERG..QIGGWV.HGLFd......aDV..S.....GLGDELM......S.SCSPQDF..YLLIPTLLHQIVL.....AF...S...A...........G......VL-....T..........EDM.LKGGLE............Y................L....VEPFLLPS.LIPAILYLCAH......LW.ADQ.R.D..Q....Q.K.....A..--.--....-V.I.RIL..QL.I.I.....L..P.N..S.I..aN..EE...........ASRMLS..TVL....TIVAVPLENALRSYLKQD.pNN....Q--------.----..-----.-...----.....-......--.....-D.ID.P.LL.RALR.EN...I.P.L...............S.R............R...MG.AA..DH..N.EIE.......TW.C.ST...S..........G...G..N....LTAMVRHIMQSLt....qWC.QTHAnln...........gipPSYT..HR..Q.MIVAT..KMVG...AKCL...LTTILEEL.KQQTEA--....---.---..---...-.....GNGSIAYDVA.TALVCAPD.VT.D...E..T...T.LL.QappM.VALLD---ES.........-......GQVPA..QLQRRVSLR.....................................TALKHHAENWNkIRNSDPSMAEIvvrl.....................yrrvEAQMALPPEP--..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------qqmvvmdgvsnlvgldgvagsmndaiaaaaaaaavdaag.................................................................................................................................................................................................................
D4AZE1_ARTBC/296-473                   ...................................................................................................................................................................................................................................................................................................................glyiyvn--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........-SLGNHMALVEELITASF----.DVL.SNG.MYR.N..E.PQ..QSMFLFRA---FLVNKLPPFLSDla............gsV-.---Vepi...................pveLCITRALA.....RV.DP-.--..NT..F..P..SFS.EI..F....S..--....THGN.SV..L--.-.....-...---.-...SD.VRQEFLFSCALHKLIP.ESSIERLLGE.NPM--.-Q..TL.P.NGGRFV.K.H..DL..V.A.Q.INNSHERAEQ........................................LLN......GIESMDGNARA......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------iveaiae.................................................................................................................................................................................................................................................
G0WFF2_NAUDC/10-1100                   .........................................................................................................................................................................................................................................................................................................................i-EKQSVFDLAIKCADKQIPANEFLNLFNEFYNEKFLSK....................VENVd.........................eDAQNDSANLG...........EISEALSSDFVNLL.....NSG...N.....SF...LIAD..YIAHLLF.......VNY...NTN..LVQ....RSLSKLDLIT.....NTDMLIHFFSK.ASMF.................................................................................FSSL.SDKL.VQDQ.LC.K.D.LP..DI.I.IPSI.......................................................LS..M..N......MK.EI.PK...GL..L..V..SITKLLQV..L..L.RFITTP....V......................................PITAP.NS.R.D.NS....RQ.......L....MSR.LS...H..T.N.KLLY..............................KKLSQ.T.LESKL.V.FK.EL.R.APS...........fVKDNI..HDF...ATSP.S......................................LTSP...Q..FISS..............PLS.M.MKTPM......STS.SGA....................KYKD..M..RL..L..RYYK...NIWLNY..KIL.YWEPI.NSDFLSKYATIASSLFK.EPI..........QPLPSTDHLLTDLIETSFTCFA.QFV.SNK.QYH.Q..T.NA..NLNLLEKRWTIFISKQLPLLMLE................HT.SKNP.........................QIASKALE.....NI.DDK.VT..KA..I..K..TYY.SQ..I....D..DL....KSTN.ED..LFD.D.....Y...PTT.S...LD.IRHDFIKSLVMLNLSP.PSLINDYLRE.SELID.PK..TL.T.TTDDLL.V.T..NP..Q.G.I.QENIHDIPTF........................................LLN......SINALELEMIN......GNNNDNNntdn.......issinNGI..YQLFM.NFD.TI....APTKQRQ.LSE...AILSLLN....DSVD..K.G..NYTIITKLCAL..L.SFN...F...NH.....SLTTI.LSFTN...P.Q.SFLECLMNF......VDISW................K......D......P..........T.......T.......V....K....SE...........D...N.........E.....D...S...G....Y.A...........SNN..........ISLS.FSWSLLLIITISQTYDV...K..L.TK...V...ALT...........SP....SLS....TVNSFSIN..FL.S.KLST..LPDAYI.LDDS..KSLSPELLTQSYK..LVQRWM.YDLF........VN..G.....SISDNLS......Q.TTEPRQL..ATLLPFILKQVLL.....AI...E...L...........G......AIN....D..........NSN.ILGGFE............Y................F....LQPFMMIG.LIKTVYWLEQY......LA.VLK.T.G..T....Y.S.....D..EL.IQ....NI.F.VLL..NS.I.F.....N..P.G..T.L...N..ED...........SRSFHN..AVL....RLNAVPLLKVLRKFRV-Q..TQ....SNYNVYSSA.NGGY..PALES.L...IRKL.....V......SV.....LN.IS.P.IY.NTDP.RI...V.S.S...............-.E............N...MY.SQ.qKP..L.GYG.......KL.L.IL...D..........E...N..P....INKIMTNQINSF......WN.LHSS.................TYYN..LD..Y.LSELI..NLIS...PEKF...FTDVLQTL.IYKSKTYG....VPV.ARN..KMS...T.....KESEHVLDYC.FYFLVLHD.VE.T...Q..I...E.AV.R...L.SQLMA--EEN.........Q......QVDGR..PLKKETVAKke................................tiiPKAETTQ----.DDDFDMLFGEN.............................DTSTHDPEED--..................LQIIT......I.eH.....AVNEFNDIATL..KNDSF.AILIH......EMKV.SRER.A.F..KE.GAVSREEYEKVCKYHKKYLSML........................................................................................................................................................................................................................................................
A0A1Y2X839_9PEZI/63-968                ................................................................aiiadiflkpqpsnpesldpripryfqglvkyklidtpsilkalykystshaqaskagngslensedkaqlrwgnsygaeevifyrltkavamgsgigsagdalqickliaqwmtlftsastafahdvmsqlhspqsrdemeaaraafvmlllaicesqtflnalsrpfakharralseslasfipsilqsasqiasrlelfrtetlasfepadkkkdvthpgfddiestmaldnfvvpelpnvtaragl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...YIYLNA..SLV.GRPLI.DDAALFNYLH---NRYQ.GDI..........------QATTIDLILTSF----.DVL.ANA.VFR.N..E.GQ..QASYLLRS---YLINKLPLLLAT................LA.TSMYppl...................saqFCITEALS.....LV.DT-.--..NA..F..P..TLS.AM..F....D..DT....HNSN.TF..T--.D.....-...---.-...-S.VRQDFCFACCLHGLIP.ESSIEGLLGE.ITY--.--..--.-.--QTLP.Q.A..GR..Y.V.K.EQLVEECMGDper..................................iqrFIG......ELDNMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALAEVIG....RLCN..N.K..ETMTLKLLCSQ..L.-AK...K...PL.....LLDVM.LLFCK...P.I.TMLHPLCEL......LDNHW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.FGSVLLLVLAFVHRYNL...S..T.MD...L...GIR...........P-....---....--DSFVAK..LL.S.VHQL..------.----..SRPLDELTDRENG..HLDSWI.RGLFd......tES..G.....GLADELL......S.SCPPQDF..YLLVPTLFHQIVL.....AY...C...T...........N......HL-....D..........EES.LKTGVE............Y................L....VNTFLLPS.LVPAILYMSNL......LW.VEL.S.H..G....Q.E.....-..--.HK....AV.I.RIL..QL.I.L.....L..T.K..Q.G...S..TE...........AQTMLS..SVV....NIIAIPLDYSLRSCQRWD..PK....N--------.----..Q----.-...----.....-......--.....-A.IE.P.LL.KAMR.EN...I.RlS...............R.R............T...AS.AA.nNE..L.--E.......AW.C.ST...A..........N...G..G....LTALVRHLVQGFv....sWS.IHPGln............vmpTSYT..HR..Q.ILTAL..RMLG...AKRF...LYIVLEEV.KVQTEA--....---.---..---...-.....GNGSIAHDVA.TALICAPD.VT.N...L..P...P.PT.E...A.VLYLDS----.........P......NRPYV..PPQLRISLP.....................................AALKAEAENCKiIQKSDPVMAEI.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ivrlyrkveaqmlipppaesmlqgelan............................................................................................................................................................................................................................
A0A395HCR3_9EURO/2-945                 .........................................................................................................................................................................................................................................................................................................................t-SSEQWGTFLRQCLLHRIDAAEFKNLTRLLLQRSPIT-....................----...........................----------...........--------------.....---...-.....EA...PLLN..VLLETRIa....tgIKW...DPL..LPLy..iDCLCKMGVVQ.....TSTVLNSLLKY.SSIHdkpsspgse..............................................................avqskqkrtcYTLM.TDIR.VVQD.AM.L.S.VS..TG.S.APKT.......................................................--..-..-......-F.LE.AI...GI..F..H..SIVDWIQA..V..V.AWHNSH....Mdashq...........................tgglmsSPDAV.SL.F.E.SL....GI.......L....LAA.LS...G..T.A.KGLQvlsad...................shealkIKLGQ.A.LSAYL.P.LC.VE.-.---............VSLPL..RNR...LDGL.Qkefnlfgepps...............kaldvsmmenvnVNAL...Q..FEDSvm..........dgPMI.N.SRAGL......---.---....................----..-..--..-..----...YVYINA..MLV.GRPLV.DDSMLLNFLS---NRYG.GHY..........------QVLIEEIITAAF----.DVL.SNA.SYR.S..E.SS..RSMFLFRS---FLVNKLPAFIAA................-M.LAASmvs..................lpmeLCISHALS.....RL.DP-.--..NT..F..P..SFS.QM..F....A..--....MQSN.TV..L--.-.....-...---.-...SD.VRQEFLFACASHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTLP.V.G..GP..Y.N.K.DELVSQINANper..................................aeqLIN......EIESMEGNAGA......-------................---..-----.---.--....-------.IVG...AITEVMH....HLCN..Q.K..ETMTLKNICNS..L.-SR...R...TQ.....ALDVI.LLFRG...A.K.QILQPLCAL......LD-AW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQP..........VYDE.FGSILLLVLTFKFRYDL...R..P.HD...M...GIG...........GN....---....--NSFVMR..LL.E.NGFC..------.----..SQKLDDLSEKQNK..NLGAWI.NALF........VA..E.....GISEDSM......S.ACSPQEF..YLLVTTLFNQSLG.....AC...E...A...........G......KL-....E..........FET.LKGGFE............Y................L....LEPFLLPS.LILALNWLGNH......IW.ETE.S.D..P....S.I.....P..--.--....--.L.KTL..QS.L.V.....S..P.S..S.I...S..GE...........AKEIHR..TVL....NITARSLEEQLKSIRARQ..PE....---------.----..-----.-...----.....-......--.....-D.VK.P.IL.DALE.PC...L.S.F...............Q.R............S...GS.CH.rTE..L.--E.......SW.T.SH...T..........P...G..G....LLASIRSTFQSLv....lWS.TSPDms............mapHSYT..HR..Q.LIAGI..QIQG...SARV...LTTLIEEL.KLQTES--....---.---..---...-.....GNGDLALDVA.ATMICAPL.AE.S...-..-...F.AV.D...Q.NNYSH-HPID.........P......SKEPL..PRCLILTLR.....................................GALFVQHENVPkISEKDPLRAEVivr......................lyrrVNALMTPPSQVP..................-----......-..-.....NLDMNNIIQNM..Q----.-----......----.----.-.-..--.----------------------lgvdgpgqmdlep...........................................................................................................................................................................................................................................
A0A166EYQ9_9AGAM/474-741               ..............................................................................................................................................................................................................................................................................................................cvadltlkkfas--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....-LSR..S.L..DVDQLGTLCKL..L.SLD...-...-D.....RLLEI.LSLHT..sL.R.DFVAYGLLF......LE---................-......-......-..........-.......-.......-....-....-D...........F...D.........Y.....E...T...V....G.D...........PQS..........AVTL.SGEVVLFVQLLTYRYQL...K..P.CR...F...VVD...........ER....---....---ECKTI..YL.S.TIYQ..------.----..TLRPSTLSPEDRT..LFQAWS.SALFd......kSS..E.....GIEDNLL......R.MTNPEKL..LYLAPSLFSQAIA.....AT...L...T...........R......AI-....D..........LDV.LKSGVS............Y................F....LGGLLNWT.LVGVLNYL---......IA.DVN.R.A..-....G.F.....N..AL.CQ....--.F.EVL..QS.I.F.....A..S.P..G.C...P..--...........-----K..TVL....QICGHSLLRLLSDRKLEH..VK....QRYKV----.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ndtgirqa................................................................................................................................................................................................................................................
A0A3M6YUL5_HORWE/54-615                ........................................................................................................................................................................................................................................................................................................dvllgfqaskgavddpll--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..-FHy..aQHLLEASYIS.....TGELLLALLER.S-SF.................................................................................ATKP.ADGN.EGER.IS.S.G.LP..TC.E.ERIFtllaq............................................lhlngsLS..L..A......AK.DL.-H...QA..V..Y..AIARWLRV..V..H.ERESNK....Qlnsd.............................elltlNTTTC.GL.Y.D.AL....GT.......L....ALA.IL...G..N.Q.-SFRsvakqkwwkqrrs...lvvremldydmhvlQWMQS.Q.LSGRL.Q.AL.TR.M.PPF...........vESDSD..GRP...IISG.Q......................................QVLE...S..VTEL..............PVA.Q.TRAGL......---.---....................----..-..--..-..----...YIWLNA..CLC.GRPLT.DEMAMLSHLQ---ARYN.GDN..........------QHVAVNLIVASF----.DVL.ANA.-YL.KgdL.PQ..RAKMI-Q---SFLCNKVPLLLAM................LS.TFMPpga...................tmdGCIQIAFM.....QI.SM-.--..DA..L..P..PLE.VG..S....A..NV....---R.EK..L--.-.....-...---.-...VQ.ARFNFLRACALHQLML.ESNIGNILGE.HVQL-.NK..IP.R.------.-.-..--..F.T.K.DGLVRQCSNNigq..................................idgLLD......HPTMMQGNAGA......-------................---..-----.---.--....-------.VAG...CIVDNLN....SLCF..N.K..DTMSLKTLCNV..L.IKH...-...IN.....DMDIV.LQYSQ...P.A.NLLQPLCAL......LN-DW................T......-......-..........-.......-.......-....-....--...........-...H.........D.....Q...D...Q....S.E...........FTP..........AYEE.YASILLLTLAIVHRYGL...S..E.AD...A...GVV...........GT....---....--DNVVFK..LA.KmDAAN..IPP---.----..----SALTSDQSA..QLSKWC.EGLFatd..eqgET..S.....GISD---......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------e.......................................................................................................................................................................................................................................................
A0A166NLH4_9PEZI/49-984                .......................................................................................................................................................................................................................................................................................................pvavadlflrpqphnhesl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...DPR..VPRy..lQVLSDLNYID.....THSILKALYRY.STSRahsqdaaqpvn..........................................................getqrpniprwgSSYA.AEEV.MFYR.LT.K.S.VA..QG.T.AIQNtg...................................................tgLE..I.aN......IM.AK.WI...AL..FtdA..ATAFTVDV..M..G.QLHNSQ....V......................................REEME.SA.R.A.AF....VA.......L....LLG.VC...E..N.Q.VVLKalskp...................eaqdtrKALSE.S.LANFV.P.TI.MQ.S.AGP............IATRL..DMF...RTST.Lag..................................fePVDE...Q..KNKSna.........eieDLF.D.STVAL......ENF.VIS....................ELPI..V..N-..S..RAGL...YIYLNA..ALV.GRPLI.DDLAIFNYLN---NRYQ.GDV..........------QSTTVDLILASF----.DVL.ANA.ASR.N..E.GN..QAAHLLRS---FLMNKLPTLIES................-L.SKHMygp..................vnaeYCITEALG.....RV.DT-.--..TT..F..P..TLS.SM..F....D..ET....RSNN.-P..F-T.D.....-...---.-...-S.VREEFCWACCLHGLVR.ESSIETLLGE.TPY--.--..--.-.--QSLP.A.G..GR..Y.V.K.ENLVAECLADper..................................mqaLIG......ELDNKDGNAGA......-------................---..-----.---.--....-------.VCQ...ALTEVMG....QLCR..N.K..ETMSLKLLCSQ..L.-AQ...K...PL.....SLDVM.LMFEK...P.A.TILHPLCDL......LD-NW................K......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLVMAFAYRYGL...S..A.SD...M...GVA...........SS....---....--DSFVAR..LL.G.QGHQ..------.----..SRPFDELSDQEKG..HLNGWI.HGLFd......sEA..G.....GLGDELM......S.SCPPQDF..YLLVSTLFQNIVL.....AF...S...T...........G......HL-....A..........EES.LRGGIE............Y................L....VDTFLLPS.LVVAITYLANS......LW.VER.S.D..-....-.-.....-..-C.QK....AI.V.RVL..HS.V.L.....A..P.T..S.I...S..NE...........AQAMLT..SVM....NIVAKPLEHSLRAYQRSD..PK....S--------.----..QEVEP.L...----.....-......--.....--.LK.A.IK.DSIP.LS...R.R.T...............-.-............G...AA.DH..TE..L.--D.......--.-.AW...S..........L...G..G....FSNSIRQTLQQLv....qWS.IHPTmd............rmpPAYT..HR..Q.MLVAL..KLLG...AKRL...LQLLYEDI.RQQTDT--....---.---..---...-.....GSGSIIYDVA.TAIVCAPD.VV.N...-..-...T.PS.N...P.VNFLD----N.........S......GNMPA..PVQRKLTLR.....................................EVLKSDAEDCKrLQKTDMNLAEIvvrl.....................yrkvESQMAVSQAQ--..................----A......I..Q.....-----------..-----.-----......----.----.-.-..--.----------------------adtmlqndlglgldtgagslddamaaaaanvaqgdgmsvdnv..............................................................................................................................................................................................................
A0A3A2ZK57_9EURO/1-888                 .........................................................................................................................................................................................................................................................................................................................m--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....------GRVK.....ASTVLGSLLNH.SSICekpqseh...................................................................qekkqkrYTLM.TDIK.VIQD.LI.L.P.VS..TG.N.IPRT.......................................................--..-..-......-L.AE.AL...NL..F..S..AVVDWIQA..V..L.AWNNNT....Mddgqq...........................qdglmgSPDLV.SL.F.E.SL....GI.......L....LAV.LS...A..T.G.KGLEvlssd...................sheglkIKLGR.A.LSAYI.P.LC.VQ.-.---............VSMPI..RNR...LDAL.Qkefnlygepas................ksldsmmdsvnVNAL...Q..FEASvm..........dgPII.N.SRAGL......---.---....................----..-..--..-..----...YVYINA..MLV.GRPLV.DDSIMTSYLT---NRYG.GHY..........------EVLIEEIITAAF----.DVL.SNA.MYR.N..E.SS..RTMFVFRS---FLVNKLPCLFAA................-M.SAAAmvp..................vrteMCISHALN.....RL.DP-.--..NI..F..P..SFS.QM..F....S..--....MQGN.TV..L--.-.....-...---.-...SD.IRQEFLFACASHRLIP.ESSIERLLGE.NPM--.--..--.-.--QTLP.V.G..GP..Y.V.K.DDLVSQINANher..................................aeqLIN......EIESMEGNAGA......-------................---..-----.---.--....-------.IVG...AIT----....----..E.K..ESMTLKNICNA..L.-SR...R...PQ.....ALDVI.LLFRS...T.R.QILQPLCAL......LD-SW................R......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....S.E...........NQP..........VYDE.FGSILLLVLAFKYRYDL...R..P.YD...L...GIS...........SN....---....--DSFILK..LL.D.DGSS..------.----..SQKLQDLNEKQNK..NLGAWI.GALF........IA..E.....GISEETM......S.ACSPQEF..YLLVTTLFSQSLS.....AC...E...A...........G......KL-....E..........FDT.LKGGFE............Y................L....LEPFLLPS.LIIALGWLGNH......IW.ESE.S.D..P....S.I.....P..--.--....--.L.KAL..HS.L.V.....S..P.T..S.I...S..GE...........AEAIHR..TVL....NITARTLEGQLKDVRARH.pSR....T--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DALE.PY...L.S.F...............Q.R............I...GN.CH.rSE..F.--E.......SW.T.TH...-..........S...G..G....LLGSIRSTFQSLv....lWS.QNPEms............mapHSYS..HR..Q.LLAGI..RVLG...SARV...LAALVEEV.KLLTEA--....---.---..---...-.....GSGDLAIDIA.VTMICSPM.SE.S...-..-...F.AV.D...Q.NSYHP---VD.........P......NKEPN..PQCPILTLR.....................................DALALGHENVPkIAEKAPLRAEV.............................IVRLHRRVSALM..................DLPSH......V..N.....NLDIGNIIQNM..QLGVE.GQGPM......DLAH.TG-A.D.V..GG.NAVGEEDPENINMMLDN-----aaaa....................................................................................................................................................................................................................................................
A0A074XYF4_AURPU/4-613                 ......................................................................................................................................................................................................................................................................................................................rvgl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...YAYLNA..ALC.ARPLT.DDMSLFNHLH---AKYQ.NDT..........------QSLVSDLTTASF----.DVL.ANA.LQQ.R..R.SP..NHILCYRS---FIANKLPMLIAT................LS.GSFPpm....................taqIAIQMALG.....RI.DV-.--..HP..F..P..PLS.TD..D....D..--....KTNN.ET..L--.-.....-...---.-...KK.SRQEFVQACILFQLGN.EQAFYSVMGE.PPA--.--..--.P.VSPRVI.R.Y..NR..Q.S.LaQQCFANVHRVe......................................eLAR......ELESMNGNAGA......-------................---..-----.---.--....-------.IAG...ALVDTVQ....HFYS..S.K..DTMSLRTLCNI..L.-SR...R...LP.....LMDII.LQYSQ...P.A.DLLSPLCSL......LN-EW................T......-......-..........-.......-.......-....-....--...........-...H.........D.....E...D...Q....S.E...........FQP..........PYEE.FASVLLLILATMHRYEL...T..E.SE...I...GSF...........AS....---....--DSFIIK..LL.N.NFST.sMPV---.----..----SALDHDQHK..QFTKWV.QGLYatd..eqgET..S.....GISDETM......S.HCPPQSF..YLLVPTLFEQSVQ.....AC...K...L...........L......VL-....N..........MNT.LKGGLE............F................L....LEPFLLPS.LICGLSWVTKH......SW.EDH.G.D..T....E.I.....L..--.--....--.L.QML..RK.L.L.....Q..P.D..S.I...S..GD...........AQAMHQ..TIL....GMIARPLAMSLQALQRRQ.pKR....K--------.----..-----.-...----.....-......--.....-D.VV.P.LI.DVLG.PY...V.E.S...............Q.R............S...GK.CS.aAE..I.--N.......EW.S.TT...A..........D...G..G....LRAVVRNTIRGLv....rWS.SQASin............slpYNYT..HK..T.MIATL..EILG...ADEV...LAVILDEL.KSQTLN--....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------gsgsaaleiattivcaplpvpalsqanalmqfdqsapapvnqrrtlrqalqaq...................................................................................................................................................................................................
A0A232LV26_9EURO/470-921               ............................................................................................................................................................................................................................................................................................................qftftpaassgyaw--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........R...W.........D.....E...D...Q....G.E...........NQP..........VYDE.FGSILLLVLAFSYRYDL...S..Q.YD...L...GIS...........GD....---....--QSFVLK..LL.G.QGSC..------.----..SQKLNELSETQHK..NLGAWI.SGLF........IA..E.....GITEETM......S.ACSPQEF..YLLVATLFSQSVS.....AC...E...A...........G......KL-....E..........FET.LKGGFD............Y................L....LEPFLLPS.LVVALTWLGSY......IW.ETE.S.D..P....T.I.....P..--.--....--.L.RVL..HS.L.V.....R..P.S..A.I...S..GE...........AEAFHR..TVL....YITSRSLEEQLRDVRT--..NR....T--------.----..-----.-...----.....-......--.....-D.IK.P.LL.DTIE.PY...L.S.F...............Q.K............S...GN.CR.rQE..L.--E.......TW.T.SH...S..........S...G..G....LLASIRNTLQSLv....lWS.TNPEis.............ttPSYT..HR..Q.LLAGV..RILG...STRV...LPALIEEV.KLQTEA--....---.---..---...-.....GSGDLALDIA.AAFICSPL.TE.S...F..A...V.DQ.S...L.YNP-----ID.........P......NKESL..PRCPILTLR.....................................DALILQHENVPkISEKDPLRAEVivr......................lyrrVNALLSPPSQMT..................-----......-..-.....NLDVTNIIENM..NLESV.--TGE......HMGL.QSAE.Q.V..TG.GGVGAAEPENINQMLNEA----aaa.....................................................................................................................................................................................................................................................
A0A367Y1D9_9ASCO/714-900               ...............................................................................................................................................................................................................................................................................................................fittyvlgnrg--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--DVVNSL.IQEIYNF-....---.--Q..KSN...H.....EDSKMFINLM.VFIVLLDS.IE.T...R..Q...D.RD.Y...W.KRELP-----.........S......SCKT-..------TV-.....................................QKSSEPFFEASmDHHYSSIFNDPssnssfgqqqdgl...dgindflkgvggdDDDQMMQDDDLFnek...........pktsDQLQN......L.lQ.....KAHHHRCLVNQ..FRKKR.GDLLN......NAL-.----.-.-..--.----------------------fgksvsllndklveemtn......................................................................................................................................................................................................................................
G0SGD2_CHATD/511-950                   .......................................................................................................................................................................................................................................................................................................................aaq--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..---AIVEICRD..L.-AS...K...PL.....SLDVL.LLFDK...P.H.KILHPLCEL......LD-NW................A......-......-..........-.......-.......-....-....--...........G...Y.........E.....E...D...H....G.E...........YQP..........VYEE.FGSVLLLLLAFVYRYNL...S..T.AD...L...GIR...........SS....---....--GSFVAK..LL.N.GVDR..CQP---.----..---LEQLSEQEKS..HLGGWI.HGLFd......tEA..G.....GLGDELM......S.SCPPQDF..YLLAPTLFHQIVN.....AL...S...A...........G......YLT....D..........-EM.LKGGLE............Y................L....VDVLLLPA.LVPALLYLSNL......LW.A-D.N.Q..P....-.-.....-..-I.QN....AV.I.KIL..QP.I.L.....K..P.T..S.I...S..NE...........ASTMLS..SVL....NIVAKPLEHALKSYQRQD..--....---------.-PEC..QKIEP.L...LLAI.....A......DN.....LA.VS.R.RTgGADH.TE...L.-.-...............-.-............E...SW.CS..AQ..I.TNP.......AT.G.AL...I..........H...G..G....LAAAVRTTIQQLv....qWA.QNPTlnsm.........ngmpAPYT..HR..Q.TLAAQ..QILG...PHRL...LGIILDEL.KSSPEP--....---.---..---...-.....---GIAYDVV.TTMICAPD.VR.N...S..T...I.SS.P...S.TQSNNSSDHN.........D......---QA..QNHQSQDAK.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------hkhphrltlrdalrleahdfrahlradpvlaet.......................................................................................................................................................................................................................
A0A178AD59_9PLEO/3-980                 ...........................................................................................................................................................................................................................................................................................lmvkewsvfldrciehrvqpdlfdgaaaqlh-------------------------------AKSPLP-....................----...........................----------...........--------------.....---...-.....GR...KISA..VLLRPRIc....naSSV...DPR..VVVy..lERLLALRKVD.....ASDVLSAAFQY.SKDRlpktedg...................................................................kskeascNPQE.LEEI.VFHR.LS.K.A.FQ..AE.E.RPVS.......................................................--..-..-......-S.TE.GL...RT..L..V..VLSRWMQT..M..V.TSHTSD....Tmmqama..........................glqhqpQQQSI.NV.R.E.GM....GM.......L....LVG.VV...E..N.P.KMLNilnnp...................kgkdlrKSFVK.S.FSSFI.T.FL.SH.N.SIGs..........qNSLQI..ANR...LEIS.Q......................................KQHD...F..HDKPat..........lnGES.N.GDTGL......EVA.--Alql.............nnvmDLQT..V..N-..T..RAGL...YVFLNS..LLV.ARPLT.DDYTIINYLH---SRYK.IDA..........------QNMATDLITAAF----.DIL.ANA.MYR.S..E.SS..QTMFCFKS---FLVNKIPILLSQ................LS.PTMFpm....................tpeLCITQALG.....HI.DP-.--..NA..F..P..AFS.QG..F....D..DI....MGNN.NS..L--.-.....-...---.-...AD.VRQDFLNACALHGLLT.TATVERLLGD.TPI--.--..--.-.---QGP.P.E..TR..H.D.K.KTILDQCKNNfdk..................................ismYID......EIDNLDGNAGA......-------................---..-----.---.--....-------.IVG...AIVEFVT....HLCE..T.Q..MTMYLKQLSSL..L.-FK...K...PQ.....ALDVI.FQFTS...P.T.SILRPLCQI......LD-DW................H......-......-..........-.......-.......-....-....--...........-...Y.........D.....S...D...G....G.E...........YQP..........VYDE.FGAVLVLVMAFVHRYDL...T..Y.HD...I...GIG...........PG....---....---SFVAR..LI.T.NGQQ.sILP---.----..----VDLTEDQGK..HLGHWL.KGLYd......sGN..E.....GLSNDVF......A.SCSPRDF..YIIVPTLFQQTVM.....AL...S...A...........G......IL-....S..........FES.VKGGIE............Y................L....METFLLPS.LIGGLQWMSSY.....aLT.QTH.S.D..-....-.-.....-..--.ID....AM.L.RIF..RE.V.I.....L..S.G..P.S...S..GD...........AQAMHG..AVL....AIVSSSLEKCFRSIQRRD.aSR....A--------.----..-----.-...----.....-......--.....NN.IE.P.LL.QAIK.GN...Q.H.Y...............V.R............S...MY.AS.mKE..L.--E.......QW.T.NA...P..........N...S..T....LHTSLRHTVQQLs....qWA.TTASiq............pnpPSYT..HR..Q.VYATL..KILG...SNKV...LRAVVDEI.KAQTEA--....---.---..---...-.....DNGAAALDVG.VSIICAPT.VD.D...S..P...V.SV.D...W.VG-------S.........T......IPASH..PPRTRLNLR.....................................EMLKHDFDNAAaLVANDPLAAET.............................VVRLHRRVEAQLas.............lgeNA---......L..Qp...vMNLPSVNLGDM..QGQTI.SDDIT......QAMD.DA-A.A.A..SI.DDITNMDNKALQRSMEEL----tgt.....................................................................................................................................................................................................................................................
A0A5M6C2R2_9TREE/564-696               ......................................................................................................................................................................................................................................................................................................vahfelelpdllhdarrais--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..---LVDLESSHKE..CLNGWV.KAIF........GS..D.....GIEDQIL......L.ATSPQDL..CKLTPTLIQQAIA.....AV...T...S...........G......QI-....D..........LDT.LHSGLS............Y................F....SQPLLSWC.LGGVIGWL---......CR.EIE.R.Q..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------gllsalhlvvlqdlvmghac....................................................................................................................................................................................................................................
A0A656KHB5_BLUGR/58-964                ........................................................................................................................................................................................................................................................icldpkasryvlcllnlgfvdipnilralwrsstcrainceqlnggqgnswtrsfnaeeaifyrlt--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..-K.I.ISSG.......................................................LA..L..K......IV.KE.AV...ET..V..E..LCTQWLEG..T..I.TLAQAQ....Hq...................................llALLNV.QS.D.E.VT....AQ.......I....MAT.GT...F..V.V.TVLEnefiqsaia............kghvnktsrKRLEK.V.VSNFI.T.LM.LL.H.WPQ...........gVDRLE..AFR...TETL.P......................................AIEP...V..EKTSksgvd....kdiddI-I.G.EGISG......AIS.VNNm.................vvSEMD..E..VN..T..RVGL...YIFLSS..LLV.GRPLI.DDNAIFKFLN---KRYQ.GDL..........------RSTVVDLILAAF----.DVL.ANA.MVR.N..E.KD..QTKNLLRC---FLINKLPLLLSTlct..........qlfP-.---Pit.....................seICITEALS.....QV.DT-.--..TN..F..P..TLS.AM..F....D..ET....-SGN.NM..F--.-.....-...P--.-...ES.VRQDFCFACCLHGLIA.ESSIETLLGD.VPI--.--..--.-.--QSLP.A.E..GR..Y.L.K.NELVQKCLSEsdr..................................verMID......ELQYMDGNVGA......-------................---..-----.---.--....-------.NSQ...AITELIT....RLCN..N.K..ETMALKSICDK..L.-VR...N...PS.....SLDIM.LLFDK...P.L.SILQPICDL......LD-NW................H......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLLLSFVKRYDL...T..P.LS...L...GPR...........PS....---....--DSFVLK..II.Q.VPRT..---TY-.----..---HSSLSQTTQS..HLKSWL.LGLFs......pEN..S.....GLTDDLM......S.SCPPQDF..YLLIPSLFSSIVL.....AS...S...T..........yG......LV-....-..........STT.LSSGLE............Y................L....VDTFLLPS.LVPGISFLATH......LW.ENH.G.D..K....-.-.....-..--.-D....AV.V.QIL..SS.L.IitplsN..T.N..N.I...N..SE...........AVQKLG..VVL....NITAKELEHSLRWLQRAE.pQR....Q--------.----..-----.-...----.....-......--.....-D.IE.P.LS.KALR.CY...L.G.W...............E.R............C...AV.SQ.hTE..L.--E.......NW.T.ST...N..........G...G..G....LLMAIKQTITNLl....qWH.LQPDg..............npANYT..HR..Q.ILVGV..KILG...AKRV...IKLILEEL.KSGIEA--....---.---..---...-.....GHGGAALDIA.SAIVSSSD.AT.A...W..D...S.TF.G...L.GSTVG-----.........N......NEGTR..YLQRRMNLR.....................................EALKNEAYNAPkLQRTEPFTAETivrl.....................yrkvESL---------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------vvngniedhevlteaelnavvdmsglaqtdgnhddmsgl.................................................................................................................................................................................................................
H6BKY6_EXODN/409-680                   .............................................................................................................................................................................................................................................................................................................lvdelvrsdgsag--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....------S.ISQ...ALVEIMH....SYCQ..S.K..ETQYLKDLVNA..I.-LR...K...PA.....AINCI.CLFIR...P.A.FWLGPLCTL......LD-EW................R......-......-..........-.......-.......-....-....--...........-...W.........D.....E...I...H....G.E...........AQP..........VYDE.FGAVFLLVLVTKTRLRL...S..N.AN...V...GVR...........KK....---....--DGFLAR..YF.D.RENL..------.-EES..---LEKLPEATTS..HLGNWV.NALY........LA..E.....GLSDELF......T.SCSPHDF..YLLIPTLLRQSIV.....AY...Q...Q...........G......KL-....T..........QES.LKAGLD............Y................L....LEPFLLPS.LIPALDWVGNL......--.-VK.E.D..Q....M.S.....A..E-.--....--.-.IVL..QA.L.L.....K..S.P..S.G...-..SE...........SRDIHQ..TIL....GVCAPELEMNIRASQS--..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------dkfgf...................................................................................................................................................................................................................................................
M7UQZ1_BOTF1/22-860                    .................................................................................................................................................................................................................................................................................................................kmsysaeem--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.MLYR.LA.K.T.VS..TG.T.RPKN.......................................................--..-..-......-V.QE.AV...DL..L..V..ICVQWMDM..V..A.ASMGRG....Ahemm..............................dieaHVEEIgMV.G.M.AL....GT.......L....MVA.VV...G..N.A.KILGaiqngr..................cpkgtgVDLGK.A.MAGFV.P.LL.LQ.S.SPQ............----N..AQR...LDVF.Rtqtlit.........................ilpvdkkE---...-..--RAana........einEIL.D.STIGM......NID.NIVv..................aDLPT..V..NS..-..RAGL...YIYLNS..ILV.GRPLI.DDNAIFAYLH---NRYQ.GDV..........------QSTTVDLILASF----.DVL.ANA.TFR.N..E.GP..QTTTILRS---FLINKVPLLVSTla............tsF-.---Fppl...................tseFCITEALS.....HV.DT-.--..NA..F..P..TLS.TL..F....A..ES....--TN.ND..MFS.D.....S...---.-...--.VRQDFCFACCLHGLIP.ESSIETLLGD.IPM--.--..--.-.--QSLP.A.G..GR..Y.S.K.QDLVEQCLSDser..................................aegLIS......ELENMDGNAGA......-------................---..-----.---.--....-------.VSQ...AIAEVIK....HMCG..N.R..ETMTLKTLCSQ..L.-AR...N...PS.....SLDIM.LLFNK...P.T.LFLQPICEL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLVVSFAHRYNL...S..T.VD...L...GIK...........NP....---....-AESFVAK..LL.V.QGHL..------.----..SRALDPLSQQDQN..HLDGWI.RGLFe......pEG..G.....GLGDELM......S.SCPPQEF..YLLVPTLFHHIVL.....AL...S...T...........E......NL-....S..........EDG.LKGGLE............F................M....VEPFLLPS.LIPGITWLSAH......LW.EAR.P.Q..A....T.-.....-..--.--....YV.L.QIL..SA.L.I.....K..S.P.pS.Is.nN..ME...........ASHLLN..AIL....KIIAQNLEQSLRWLQRAE.pHR....H--------.----..-----.-...----.....-......--.....-D.ID.S.IS.KALE.SN...V.G.W...............E.R............K...GA.SK.ySE..L.--E.......VW.T.AT...P..........G...G..G....LAASIKHTVVTLv....qWG.LQCDrnpg........mqimpASYT..HR..Q.VLTGL..KMLG...AKRL...LNTIIEEV.KTQTEA--....---.---..---...-.....GNGSVVLDIA.TSLICAPD.SA.S...-..F...D.SG.S...G.VDIMS-----.........-......GNTPQ..LLQRRLTLR.....................................EALKAEAENMPkVHKTDTFHAET.............................V-----------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------irlyrrveaqaviqqqllpddndlgalnevm.........................................................................................................................................................................................................................
A0A0D1Y6N7_9EURO/444-708               ......................................................................................................................................................................................................................................................................................................................sagf--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.ISQ...AIVEIMH....NYCQ..N.K..ETQYLKDLANA..I.-IR...R...PA.....AINCI.SLFIR...P.S.YWVGPMCTL......LD-EW................R......-......-..........-.......-.......-....-....--...........-...W.........D.....E...I...H....G.E...........AQP..........VYDE.FGAVFLLVLVTKARLQL...P..Q.SD...L...GIR...........KK....---....--DGFLSE..YM.N.NGDS..------.----..EKELGSLSEVRMA..HLGNWI.NALY........LA..E.....GLSDELF......T.NCSPHDF..YILIPTLLRQSIT.....AY...Q...Q...........D......KL-....T..........QDS.LKAGLD............Y................L....LEPFLLPS.LASALSWIANI......LH.---.-.D..E....S.S.....A..--.--....-A.A.VIL..DV.I.M.....K..P.-..P.G...N..PE...........SRDIHR..TIL....AMCGSELQKSVDSVQP--..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------qldqlngt................................................................................................................................................................................................................................................
A0A4S2MV06_9PEZI/252-825               ...............................................................................................................................................................................................................................................................................................................daqagvcarah--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..---L...YVWLSS..LLA.GVPNV.EENYVVGYLL---SRYK.DST..........------PEMVTDFMTAVI----.DVV.AHA.VHK.K..E.PP..ATLMLLRS---FLVNKIPLILL-................RL.SQYPqilsga.............isqaflRADTGALQ.....DI.SP-.--..SR..F..D..PYS.LR..P....N..DT....----.QD..MFD.P.....-...ENM.N...VD.LRSDFLFACALHGIVD.ESEITTMLGE.LPV--.-S..AM.S.ASGKYT.V.E..LL..Q.E.Q.YHANHDRADR........................................LLE......EIESMEGNAGA......-------................---..-----.---.--....-------.VCR...TLFEIMK....GMCE..T.R..ATMPLRNFCSF..L.-TR...K...TS.....SIDIM.LLFVK...S.S.ELLEPLCDL......LD-TW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.FGSILLFVFTVIRRYNL...P..I.SS...L...YVT...........HP....--L....PQESFLAT..LL.T.IHDS..------.----..--PIDSLPPDRYT..SLGGWI.KELF........EL..E.....GISDSLM......S.SCSPQEF..YYLVPTLFTQTLA.....AY...Q...Q...........G......VL-....D..........KEI.ITEAFG............F................L....LQPFLLPS.IVAGLQVISTH......LW.ANI.T.N..P....S.T.....A..--.--....--.L.ALL..APlI.L.....T..G.D..S.L...T..AE...........TAEAHR..TAI....SIPARQLCTVLTTVIH-H..LQ....S--------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------hpqqqpeqpenlttalkllsrlrplqhftrsstpskdeldgfvqhgstiaqtlttsftllatwqpsapspppavfsmklltasrfllgprkmlrvllqa.....................................................................................................................................................
A0A2P5I0W3_9PEZI/15-923                .................................................................................................................................................................................................................................................................................tarrewerfiqrclvqrldfdefaeyapllharhplghgpv--------------------------------------....................----...........................----------...........--------------.....---...-.....--...--AD..LVLRPTSw....nrYTL...DPR..MPHy..iQTLLDLGLLD.....TPAILAALYRY.STCHvllaahreqgggggeahgggggg...................................gggdnkpmaetgvgkndvahcwlSSFS.SEEV.IFYR.LT.K.A.VA..QG.L.AIRN.......................................................--..-..-......-S.KD.AL...DV..S..A..IMARWMTL..F..T.AASAAF....Qaddervimg...................garskasqqkRDDMD.NS.R.A.AF....VM.......L....LLS.VC...E..N.P.VLLQalgkp...................fakgarKALSQ.S.LASFI.P.SI.MQ.N.ASQia........arLELFR..TET...LAGF.E......................................PIDK...K..KEAAna.........emdELL.D.ETLGL......---.--Qn..................lSIPD..L..HVdrS..RAGL...YIYLNA..ALI.GRPLI.DDAAFYNYLH---NRYQ.GDI..........------QLTAIDLILASF----.DVL.ANA.IFK.N..E.GQ..KTANLIRS---YLINKVPLILAS................FA.SQEPmyp..................fnseLCITNALS.....RV.DT-.--..NT..F..P..TLT.SL..F....E..NN....LSSN.PF..T--.-.....-...---.-...ES.VRSDFVTACCLHGLVP.ETSIDKLIGD.YTY--.--..--.-.--QTLP.A.G..GR..Y.N.K.DKLVQECLADplqe................................riqkLVT......ELENMDGNVGA......-------................---..-----.---.--....-------.CCQ...ALTEMLG....KLCS..N.K..ETMSLKTLCSK..L.-VG...K...PL.....NLDVL.LLFDK...P.T.TILSPLCEL......LD-NW................G......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...D...Q....G.E...........YQP..........VYEE.FGSVLLLLLAFVYRYNL...T..A.SD...L...GIR...........SS....---....--DSFVAK..LL.A.NGQL..------.----..SRPLDELNDQEQN..QLDGWI.HGLFd......tDG..G.....GLADDLL......S.SCPPQDL..YLLIPTLFHNIVL.....AF...S...T...........G......HL-....T..........EET.LKTGIE............Y................L....VEPFLGPS.LVTGIMYLSNC......LW.TDR.A.E..E....N.K.....A..--.--....-T.V.KIL..QL.I.V.....R..P.S.qK.M...S..PE...........SSDMLN..TVK....NIVAKPLENGLRTYQRQN..PR....S--------.----..-----.-...----.....-......--.....QD.VE.P.LL.QVLR.GN...V.D.L...............S.R............R...TG.AAgdKE..L.--E.......QW.I.SS...G..........S...G..G....LTSSIRTTFQNLt....mWS.LNPGv..............mpTAYA..HR..Q.VLVGL..KLMG...ARRL...LQAILEEL.KQLTET--....---.---..---...-.....GNGSIAYDVA.IALVCAPD.VS.S...N..A...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ndalaptppqr.............................................................................................................................................................................................................................................
A0A2C5Y623_9HYPO/65-903                ..........................................................................................................................................................................................................................................................................................................rayighillrpypqqh--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......VSI...DPK..TPQy..iQVLTQLGYVD.....APSILTPLYNF.SSMHrrleqlrpagan........................................................ppddahkpsltwdNSAW.AEEV.FFYH.VI.K.M.MV..EG.T.AYKSai..................................................dayVL..I..N......IV.SK.WM...NL..F..A..SVSNALEA..D..M.LGQDKN....Allheel.........................dssraalVPLVL.RL.V.E.TP....AI.......V....VLL.KQ...Q..S.G.KGVR..............................RHLAQ.G.LANFV.P.TL.PP.G.TPF............TERLE..MFR...CGTL.A......................................ELEP...G..-GKE..............RQA.A.AKAAMdelippN--.--Vald.............nfviSDMA..I..ST..T..RVGL...YIYLNA..LLI.GRPLL.QDISFLAYLQ---NRHH.GET..........------QSSAINLILASF----.DVL.ANA.VIR.N..E.RP..KDAHLLRS---FLTNKVPLLLCQlfa..........pqfST.ASSE.........................FCITQALN.....QV.DT-.--..SL..F..P..TAS.LM..F....D..ES....RSNN.PY..T--.-.....-...---.-...ES.VREDFCTACALHGLVQ.REHVERILGE.TSMS-.--..YE.P.SLEK--.F.S..KT..K.L.V.NECLSDPEKIq......................................gLVR......SLDNMDGNVGA......-------................---..-----.---.--....-------.VCH...ALVELIR....QLCN..S.K..ETMTLKILCSQ..L.-AQ...K...PQ.....SLDIL.LLFEK...V.S.AILDPLCNV......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...D...Q....T.E...........YQP..........VYVE.FGAILLLVFTFAYRYNL...T..P.TL...L...EFS...........ST....---....--ESCVLQ..IL.F.RA-H..IPR---.----..--LAAELIEKESE..QLSGWV.RGLFd......sET..G.....GLGDDLM......S.SCPPQQF..YLLAATLFQKIVG.....AY...A...C...........G......QL-....N..........DES.LKSGME............Y................M....LDTFLLPS.LVPAIRFL---......CE.CIW.V.E..Q....K.E.....Q..--.-R....SV.I.KIL..QL.I.L.....M..P.S..S.I...S..AE...........ARAMLS..SVK....NLIAKPLEYALRSFQKQD..PK....N--------.----..QDIEP.L...LRA-.....-......--.....--.--.-.LR.DNLP.LS...R.R.T...............-.-............G...ES.EH..TD..V.--E.......SW.A.SS...P..........N...H..G....SSGGLGHTIQALv....hWG.VHNGin............ampPSYT..HR..Q.LISAC..KILG...PESV...LCMMLEEI.RNQTDA--....---.---..---...-.....GLGSIVYDVG.VAMVCAPD.VT.N...E..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------pvtlltggqi..............................................................................................................................................................................................................................................
MED5_CANGA/1-1094                      ..........................................................................................................................................................................................................................................................................................................................MESKSLNTLALRCAARKIPASEFLNLYKEFYNETFPAN...................sIDNDdaktq................egsgsqDKTDVEESISkpv....gsknDPVAILCAEFMKLL.....ENG...K.....YV...ILAD..YVVEVLF.......VNY...HSE..LVR....EFLPKLKDLM.....NKGILIHFFSK.SCAF.................................................................................FVNL.TDNL.VISQ.LI.K.D.LR..AT.I.VPCI.......................................................LE..T..N......FC.DI.SN...EL..V..V..AIAKFLQA..V..L.RFTPQP....I......................................QINSE.TY.R.D.NT....FN.......L....TKR.LS...L..I.N.KILS..............................KKFAG.I.IDKKL.Q.FK.EV.L.GPF............TKDST..LDF...DNSP.S......................................ITSP...Q..FIPS..............PLP.S.MKERSv....tSSQ.SAI....................KYKD..L..KL..L..RYYK...NIWLNS..KLM.NWQPF.DSEFISNYSAIKSSLYP.DQV..........QNIQNVDLLFTDLIETAFTCFA.QFV.SNK.LYH.Q..S.NS..TYNLLERKWILFLSKILPLLVYK................NS.SRTA.........................HVIGNALD.....GI.DDK.VI..KA..I..S..AYY.QE..N....D..DG....RSRN.DD..LFD.D.....Y...PST.S...LD.IRHDFIKSLTMLGVVP.PVFITNYLRG.DQTVD.SK..AL.A.TTDDLT.F.T..NQ..Q.G.I.IEIVNDIPNF........................................IRS......SLEGMEMENVS......EPTLVSS................NGL..LQVLS.NFD.TV....SPTKQFE.LAN...AIVDMLS....ESST..T.F..ELNTFVKLTAV..L.TFN...Y...SH.....SLTSI.LMYVT...P.E.VLTKLYLEF......VDKHW................N......S......Q..........V.......I.......G....K....QE...........T...D.........G.....E...S...Q....F.E...........NVN..........ISMS.FSWAILMLTILYKQYHI...D..F.VS...M...RAD...........YT....TDN....IKNSFAIT..FV.E.NLPD..ISDLFF.IDEK..NSDDPEVQVKSHK..LVRDWL.NDLF........VN..G.....SLSDSLL......Q.NIEPKQL..AILVPYIFKQVTL.....AM...E...I...........G......AVG....D..........LQN.LIGGFE............Y................F....LQPFMLVG.LIKVMYWLEQY......LS.CLK.S.D..E....T.D.....E..KL.IQ....KV.L.SLL..NT.I.I.....C..P.S..T.L...N..ED...........SKAFHF..AVL....RLNAIPLLGILYQFRSNK.hAE....SNYGIYSSD.NEGN..PTLEL.M...ISRL.....I......SS.....LS.IS.P.VY.DIDS.TI...L.V.T...............-.D............N...NF.VQ..KP..P.KFQ.......SF.F.VT...N..........E...I..S....MNKMLTNQMNSF......WS.LHSS.................TYYN..LD..F.LKTLI..DTLT...PKQF...LLDVLRTL.EYKVETLG....VKD.VRN..KSS...S.....NESDQVIDYL.FYFLVLYD.IE.N...S..E...D.AK.A...M.AQFMEDTV--.........-......--DIS..INGDSGIVKqe.................................tqPKSEYNP----.DDDIDMLFGEN.............................DTSMQANEEDTL..................-DNKE......L..-.....-KSDRNCALGK..NRHTF.GFIIH......EIKL.SYGT.-.L..ES.DSMSYEDYKKICEYHSRYLKML........................................................................................................................................................................................................................................................
A0A167KPU6_METRR/32-964                .....................................................................................................................................................................................................................................................................................krlssetfeefvpliqdshplppflialillrpqpyn--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..------V.......VSL...DPR..IPPy..iQILSQLGYVD.....APSILKVLYKF.SSLHtqlkglpqngtqpagnhdn..........................................hnhspsgrsqnpqrwncsawV---.-EEF.MFYH.VI.K.M.VV..EG.T.AFRDsc...................................................avLQ.lV..Q......VI.SQ.WM...EL..F..T..LVTSFFATdvM..G.ELQSSQ....A......................................RIDME.TT.R.A.AF....VP.......L....LLR.LV...E..V.P.AFVKgissp...................haretrKVLSN.N.LAGFI.Q.TL.QP.A.PGF............VERLE..IFR...TETL.Arl..................................dpI-DK...T..KEAAana........amdELL.G.TTVG-......---.--Lds...............fvvPDLM..I..SN..T..RSAV...YVFLNA..SLV.GRPVM.DDNVLLSYLQ---NRNQ.GAT..........------QSSAIELILASF----.DIL.SNA.VFR.N..E.GP..KDAHLLKS---FLVNKVPLLLCHlflr........eptfDT.NASE.........................FCITEALN.....QV.DT-.--..SL..F..P..TAS.LM..F....D..ES....RSNN.PY..T--.-.....-...---.-...ES.VREDFCTACALHGLVQ.REHVERILGE.TSMS-.--..--.-.---YEP.S.L..EK..Y.S.K.EKLVQDCLADaek..................................vegLIR......ELEKMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALVEVMR....QLCN..N.K..ETMSLKLLCSQ..L.-AQ...K...PQ.....TLDIL.LLFEK...L.P.TILDPLCHL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........IYEE.FGSILLLVLAFSYRYNL...T..A.AD...L...GIT...........SP....---....--DSCIAR..IL.S.RAHI..-SR---.----..--DRDELTEQEKG..HMSGWI.HGLF.......tES..G.....GLGDDLM......S.SCPPQDF..YLLVATLFQNIVV.....AY...T...Y...........G......NL-....N..........DET.LKGGIE............Y................L....VDTFLLPS.LVPALRFLADY......LW.VEQ.K.E..-....-.-.....-..--.QK....AI.I.KVL..QL.I.L.....L..P.T..S.I...S..GE...........ASTMLS..SVR....NLVAKPLEHSLRTYQRQD..PK....---------.---N..QDIEP.L...LRA-.....-......--.....--.--.-.LK.DSLP.LS...R.R.T...............-.-............G...GA.DH..HE..I.--A.......LW.T.NS...S..........S...T..G....LAGAVRHTVQGLv....qWS.MHPGln............smsTSYT..HR..Q.LMAAQ..KIMG...AKRT...LRLLLDEV.RAQSET--....---.---..---...-.....GSANIVYDVA.AAIVCAPD.VA.G...E..T...L.PN.-...-.NHMMD---AS.........G......NV-AA..VTQRPLTLR.....................................EALRLEAEGCSkLQKTDPVLAEI.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------vvrlyrrveahmmmpqnqailea.................................................................................................................................................................................................................................
A0A1E4RN83_9ASCO/1-934                 ..........................................................................................................................................................................................................................................................................................................................MTEVSLKKLIGLSVKRKTSSKVFVSLFNQLNERSPVT-....................-EDE...........................----------...........-----FLDTFLNYP....gNEE...E.....AA...KAIE..YCIKTS-.......LSS...ETN..MARl..wNLMSKLEVKQ.....QVKILKEV---.----.................................................................................NKIL.---L.KEGK.LS.T.K.LQ..AC.M.IESI.......................................................IK..Y..S......GS.VM.SE...GT..L..V..YQSVLLLG..S..I.VKKWHL....I.....................................dGETKV.IL.S.N.FI....DT.......L...dASS.YK...D..L.S.RFLI..............................KSSGQ.S.LGKFH.A.VK.P-.-.---............-SEAS..HNI...VNTN.Q......................................LSKD...I..----..............TMI.N.SN---......---.-SS....................KFNE..L..NN..L..K--S...YLWLYD..LME.NWSFSkNQIFVNSYEK----LFC.SSS..........-KSKNKHTSIVNMVESIFNGFV.TSL.TNQ.---.-..-.AP..SYIIY--NWKNFLITKLPDILLK................VA.SPKSi......................iqDAIKDCFK.....AF.DDV.TN..KT..L..S..TFN.WN..N....S..-I....----.--..---.-.....-...---.-...FD.IRRIFIKHCIYAEVLP.LEFYFEQFPE.DGD--.--..--.K.FNSTIL.N.N..--..-.E.K.NFTIKSIEDE........................................LT-......-IKLLEINSEF......--TSLVE................SGL..IEYIN.QLP.DQi.rfQPKYQQE.LTV...IINKVID....SLIE..E.K..NIEKLNRLIIA..I.TNN...Y...-E.....VLNLI.FINDNq.gP.W.NVLNKLIQF......ID---................-......-......-..........-.......-.......-....S....EN...........F..nI.........E.....E...D...D....-.N...........FQE..........SYSY.FGVLILGIITIIETFNI...D..I.SN...T...SIM...........NS...yTID....YINNFYYR..HC.D.NLTS..-----Q.VNTT..EEEELTIISNYNN..LINEWI.NSLFd......dNN..D.....GLSDELI......K.SINVKQI..YKIIPIIYKQAII.....AT...E...N...........G......KI-....N..........EDI.LNGGID............Y................L....SQIFLVPC.TLSVIKWLLNK......IE.IES.F.K..S....T.F.....D..TK.SH....LW.I.KIL..FE.I.L.....K..S.N..L.G...D..SIndgefqfsndeSNLIFK..IVL....KISGSSIIEILTRFPLWN..--....---------.----..-----.-...----.....-......--.....-N.VE.L.IK.KIIN.IV...Q.K.T...............I.D............P...NY.KK..QS..F.---.......--.K.IT...T..........N...L..N....FIDELKLNLN--......--.----.................---N..HN..L.VNQLI..SKID...KN--...--ELVRYL.ITEFNNY-....---.-QH..NIN...N.....EDSKISINLL.TFIILLKS.FK.S...F..D...S.KA.L...L.IKLFNQ-CRN.........E......LPNSS..KIDLSFNITidf...............................nfsV-IFNDP-NLE.NSEDDDLFNES.............................PSKFQVKDHY--..................NKITQ......L.nT.....GLYQFVKIYQI..FKNN-.-----......----.----.-.-..--.----------------------ldsvfqktlavlknkfiney....................................................................................................................................................................................................................................
X0D090_FUSOX/13-927                    ...................................................................................................................................................................................................................................................................................saieywsqfvarcisqrldtekfenyvrlvhdqhplppa--------------------------------------....................----...........................----------...........--------------.....---...-.....--...LVAD..FFLRPQPs....ndNSL...DPR..IPPy..lQVLTRLGYVD.....APSILKALYKY.SSLHayaqqpnandgketeket............................................eqsddkekdeqkqkvtrwkSSY-.----.----.--.-.-.--..--.-.---Waeevlfygitk................................svvegkairdskTA..L..D......MT.RI.IS...KL..M..V..LFTTAFAA.dM..LeQLHTAQ....V......................................RDEME.SS.R.A.AL....VA.......L....LLR.MC...E..N.D.ILVGavskp...................iakdvrKEMSA.S.LASFV.P.TL.QL.V.PQI............TDKLE..QFR...TEIL.As....................................sDPAD...K..KKQA..............TNA.A.MDELL......DSA.VGLdn...............fvvAEIP..V..SN..T..RAGL...YIYLNA..ALI.ARPLL.DDHALFSYMS---NKYQ.GDI..........------QSSAIDLILASF----.DIL.ANA.VFR.N..E.GQ..KDAHLLRS---FLINKVPILLYQllp..........pgfPG.TSAE.........................FCITEALS.....HV.DT-.--..SL..F..P..TAS.LM..F....D..ES....RNNN.PY..T--.-.....-...---.-...ES.IREEFCAACVLHGLVQ.REHVERILGE.ISL--.--..--.S.YEPSLQ.KhS..KD..K.L.V.QDCLSDTEKIq......................................gLVR......ELDKMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALVEVLR....QSCH..S.K..ETMSLKVLCSQ..L.-AA...K...PQ.....SLDVI.LLFEK...L.P.NILEPLCQL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....D...D...Q....E.E...........YQP..........VYEE.FGAVLLLVLAFTYRYNL...N..A.VD...I...GIA...........SP....---....--DSWVAK..II.G.RGHI..------.----..GRQCNELTQREND..HLNGWI.HGLFd......tEA..G.....GLGDELM......S.SCPPQEF..YLVVAPLFQSIVV.....AY...T...H...........G......YL-....N..........DES.LKGGIE............Y................L....VDTFLLPS.LVPAIRFLADY......LW.IDQ.K.E..-....-.-.....-..--.QK....SI.I.KIL..QL.I.L.....L..P.S..S.I...S..GE...........ASTMLS..SVK....NLIAKPLEHALRTYQRRD..PK....N--------.----..QDIEP.L...LR--.....-......--.....--.--.T.LK.DSIP.LS...R.-.-...............-.R............T...GG.TD.lNE..L.--E.......SW.T.VT...P..........P...T..G....LSSAIKLTIQGLv....hWS.IHPAmn............smpTSYT..HR..Q.ILAAL..KIMG...PKRV...LHVILEEI.RQHTEA--....---.---..---...-.....GSASIVYDVA.ISLICAPD.AA.K...D..-...-.AP.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------avvdangnmlppvqrqrslrdllkveaegcrklqkkdpa.................................................................................................................................................................................................................
MED5_KLULA/1-1062                      .........................................................................................................................................................................................................................................................................................................................m---ESVSQLVSNCASRGIPAQQFLNFYHELINEKYGAS....................LNAG...........................NEERESESRK...........QVFEDVSRELVQAF....hSSE...D.....AI...LLAE..YMVHLLF.......INY...DTY..LSS....ALLPQVYSIQ.....SETLLMHFHSL.AASF.................................................................................IGKL.EDKL.IKEQ.MR.Q.D.LS..TF.I.LSSC.......................................................LQ..C..D......MS.TF.NN...QL..F..I..SIVKYLQA..L..L.TLIDDSi..dI......................................EMDKD.NL.K.L.AV....TS.......L....LTR.TT...K..L.N.RILG..............................KRIGR.E.FETKL.N.L-.--.-.---............SLSAK..LAM...VNSP.Q......................................IFSP...S..SGATrf..........agTPG.-.STKPMdl.alsA--.-TSst................snKIQD..L..KL..I..RFYK...NLWLNN..KIH.HFNTS.DSQLLEKFSSIN-SRLS.SSL..........AEEHLIQEQITDLIETTYTSFA.QLV.NNK.LYH.Q..T.NT..NFNLLERKYVHFITKRLPLIIKD................FL.PQNP.........................SVIVNSLQ.....NI.DEK.VK..KA..I..K..SYY.SN..K....N..DS....PERN.ED..LFD.D.....Y...SGN.N...FD.IRHDFLKNLIMLNLRP.PSVLNEFLRE.DQMVD.VK..TL.K.TDDSLV.I.V..NS..Q.G.V.QEKVSDVQEA........................................LKS......LIADLDIENQY.....vANGNNYRfs............pdNAL..LKLLM.SFD.TI....APTKQVE.IAN...AFLQILQ....KATD..T.S..DLKTLGKVLWI..L.TSN...V...GH.....STTSM.LCCIS...P.G.PFINAVVKF......LEKQQ................R......N......S..........T.......V.......S....S....--...........-...S.........D.....E...P...D....F.D...........SLH..........SYVT.YGMALSFVVFLKTTYDF...D..I.EP...F...IQN...........FE....---....--ESYTLK..FL.S.SIED..ISDIFV.LQNE..SAE------GSKL..YLQNWL.RDLF........IN..G.....SISDSQM......K.NTNVKDL..INLIPFIFKQSVI.....AV...Q...A...........G......VVS....N..........ILN.LTSGFE............Y................F....LQPFLMPG.LIKIMFWLEYY......LH.SLK.N.N..N....P.P.....S..QI.LS....SC.W.ELI..NI.L.I.....C..P.P..S.L...D..DD...........AKGLHF..MIL....KLNCVRLLNVLYLFRNDE.sNS....SQYGVYAAH.ESID..PKLEA.V...ISKL.....E......YI.....AS.IS.N.IY.DVDT.KC...Y.E.T...............T.K............E...VY.SH..GT..L.FSN.......KI.P.VT...N..........E...H..P....IDIIMTNQLNSF......WN.LHSS.................TYYN..YD..Y.LLELI..KLIT...PEKF...LVDSIRTL.TYKVAAYG....IPG.VQG..KLN...T.....SAIEQVANFL.AYFMILHD.VQ.T...E..E...Q.RL.A...L.LNYIESGVIV.........S......KETET..KQEPETKL-.....................................-----------.DDDFDMLFGEP.............................FNNTLDETSLVF..................SQNEQ......-..-.....PKSYSSSVFPV..LHDTF.GVVIA......EMKK.RYDT.S.K..NN.GLLSEAAYENATTFIRKYVENL........................................................................................................................................................................................................................................................
F8PGS0_SERL3/574-722                   .......................................................................................................................................................................................................................................................................................................................ctt--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..---LWF.KALFd......tNS..E.....GIEDTIL......R.STNPTNL..LIISSTVFSHAIR.....AR...Y...E...........G......KM-....D..........QDV.FSNGIS............Y................F....MSPLLKWT.LVSIVKVM---......LS.EIQ.R.E..C....L.A.....A..SV.-H....--.I.EVL..RT.L.L.....L..S.P..S.C...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ppsvlnlcgadilkmlsiglplppsssrqvydldiirntalqsl............................................................................................................................................................................................................
G2Q887_MYCTT/50-1019                   ................................................vivadvllrpskrqrysldprvpiyldallkqrrvdvasvlralykyssahlkvqspdpgvldggengrkeggegeggkgakevkqgtpkgskivrwqnsyedeemilwrlaqavhqgsgirtaknviqiakvlakwmplfaeaaaafsrdafdslhglqvrdetadartafvllliafsdnplvqatlekpackdvckmlsdalqafipcvmqvlpemasrlevfrnetlgkhlaaekkdadvnnymdnlmgmdslqipevpvvn--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.SRAGL......---.---....................----..-..--..-..----...YIHLSA..ALV.GRPVI.DDSALFAYLH---NRYQ.GDV..........------QSTAVQLILASF----.DLL.ANA.VFR.N..E.GP..KTGHLLKS---FVVNKVPLILVS................LT.AAAMypf...................dpeMCIKEALG.....QV.DT-.--..NV..F..P..TLS.GM..F....E..-M....SNTN.SS..F-H.D.....-...---.-...-S.VRQDFCFSCQLHGLLS.QAAIENLLGE.ITY--.--..--.-.--QSLP.D.E..GR..Y.S.K.DNLVHACLQDvdr..................................tqkLIG......ELDNMNGNVGA......-------................---..-----.---.--....-------.AAQ...AIIEVIG....SLCR..N.K..ETMTLKQLCSQ..L.-AA...K...PL.....SLDVL.LLFDK...P.E.KILHPLCEL......LD-NW................A......-......-..........-.......-.......-....-....--...........G...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLLLAFVYRYNL...S..P.AD...L...GIR...........SP....---....--DSFVGK..LL.S.GGAV..CRP---.----..---LEDLSEQEKS..HLNGWI.HGLFd......sEA..G.....ALGDDLM......A.SCPPQDF..YLLVPSLFHQIVV.....AL...S...A...........G......YLT....D..........-DM.LKNGLE............Y................L....VDVLLLPS.LVPAILYLSNQ......LW.VSS.P.Q..-....-.-.....-..-L.QS....SI.I.KIL..QV.I.I.....R..P.S..S.S...S..NE...........AWTMLS..SVL....NIVAKPLEHALRSYQRQD..PK....S--------.----..QEVEP.L...LRAI.....Q......DN.....LLlSR.R.TG.GADH.TE...L.E.S...............-.-............-...-W.CS..TH..I.NHG.......--.-.AT...P..........H...S..G....LSAAVRHTMQNLi....qWA.QNPQln............gmpAPYT..HR..Q.TLAAV..KMLG...AKRF...LAILLDEL.RALADS--....---.---..---...-.....PQAGIAYDVA.TALICAPD.VT.N...D..A...S.LS.G...A.SGGA----PS.........T......TNNNN..NKNKNSNN-.....................................-NSGNNT----.NSNTNANTNNT.............................GNSSNNNNNNNS..................NNAGT......-..P....pTDDPAASSRQQ..QQHRH.TSLRD......ALKS.EADE.W.K..KT.QKADPVMA--------------etvvrlyrrvea............................................................................................................................................................................................................................................
A0A5C3QX17_9AGAR/473-720               ..................................................................................................................................................................................................................................................ervwldpsshhefsqllqsrfatfsttfdtegigqlcklmythdipllivsihsglshlifhslsvlaqfnw--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....E...T...A....G.D...........PQS..........AFSQ.LGDVILFVQATLSKFHI...T..K.TH...F...THG...........DA....---....-THSTAFL..KL.A.SLGA..-PT---.----..GV----HDEEHKT..AFTSWL.KALFd......pSS..E.....GIDDTLLrqvastS.STQPAVL..LAITPMIIENAIH.....LF...K...S...........K......QM-....D..........LEA.LNNGIS............F................F....TGPLLNWT.LVGVIRYL---......IR.EIQ.R.K..M....V.A.....M..QV.--....-H.L.HVL..YT.L.L.....S..S.T..S.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------cp......................................................................................................................................................................................................................................................
A0A3M6XMZ3_HORWE/439-615               .....................................................................................................................................................................................................................................................................................................vrqcsnnigqidglldhptmm--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-QGNAGA.VSG...CIVDTVN....SLCF..N.K..DTMSLKTLCNV..L.-IK...H...IH.....DMDIV.LQYSQ...P.A.NLLQPLCAL......LN-DW................T......-......-..........-.......-.......-....-....--...........-...H.........D.....Q...D...Q....S.E...........FTP..........AYEE.YASILLFTLAIVHRYGL...S..E.AD...A...GVE...........GT....---....--DNVVFK..LA.KmDAAN..IPP---.----..----SALTSDQSA..QLSKWC.EGLFatd..eqgET..S.....GISD---......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------e.......................................................................................................................................................................................................................................................
H0EY00_GLAL7/199-373                   ......................................................................................................................................................................................................................................................................................................................lnat--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.-SR.N..E.RG..QTITIIRS---FLINKIPLLLTT................LS.ST-Lfpp..................ltaeYCITEALN.....RV.DT-.--..NA..F..P..TLS.NM..F....D..ES....--SN.NN..MFS.D.....S...---.-...--.VRQDFCFACCLHGLIE.ESSIETLLGD.IPM--.--..--.-.--QSLP.A.G..GR..Y.V.K.QDLVQQCLSDpgr..................................aeaLIS......ELGNMDGNVGAv....sQ------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------aitetpsspnfltkvtspepwttspp..............................................................................................................................................................................................................................
A0A317WIG9_9EURO/2-946                 .........................................................................................................................................................................................................................................................................................................................t-SSEQWGIFLRRCLLHRIDAAEFKSLTRLLLQRCPIA-....................----...........................----------...........--------------.....---...-.....EA...PLLD..VLLETRLa....tgIKW...DPL..LPLy..iDCLCKMGLVQ.....TSTVLNCLLKY.SSIHdkpqppgqe..............................................................avqikqrqkcYTLM.TDIR.VVQD.AM.L.S.VS..TG.T.TPKT.......................................................--..-..-......-F.SE.AI...CI..F..N..AIVDWIQA..V..V.AWHNGH....Mdashq...........................tgglmgSPDAV.SL.F.E.SL....GI.......L....LAA.LS...G..T.G.KGLEvlsav...................shealkIKLGQ.A.LSAYL.P.LC.VE.-.---............VSLPL..RNR...LDSL.Qkefglfgepps...............kaldvsmmgnvnVNAL...Q..FEDSvm..........dgPMI.N.SRAGL......---.---....................----..-..--..-..----...YVYINA..MLV.GRPLV.DDSMLLNYLS---NRYG.GHY..........------QALIEETITATF----.DVL.SNA.SYR.N..E.SS..RSMFLFRS---FLVNKLPSFIAA................-M.LAASmvs..................lpmeLCISHALS.....RL.DP-.--..NT..F..P..SFS.QM..F....A..--....MQSN.TA..L--.-.....-...---.-...SD.VRQEFLFACALHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTLP.V.G..GP..Y.N.K.DELVSQINANper..................................aeqLIN......EIESMEGNAGA......-------................---..-----.---.--....-------.IVG...AITDVMH....HLCN..Q.K..ETMTLKNICNS..L.-SR...R...VQ.....ALDVI.LLFRS...A.R.QVLQPLCAL......LD-AW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQP..........VYDE.FGSILLLVLTFKYRYDL...R..P.CD...I...GIG...........GN....---....--PSFVLR..LL.E.GGSG..------.----..SEKLDDLNEKQNK..NLGAWI.NALF........IA..E.....GISEETM......S.SCSPQEF..YILVTTLFSQSLG.....AC...E...A...........G......KL-....E..........FDT.LKGGFE............Y................L....LEPFLLPS.LVLALNWLGNH......IW.ETE.N.D..P....T.I.....S..--.--....--.L.KAL..QS.L.V.....T..P.S..S.I...S..GE...........AKEIHR..TVL....NITARSLEEQLKDVRARH.pSR....T--------.----..-----.-...----.....-......--.....-D.IK.P.IM.DALE.PY...L.S.F...............Q.R............S...GS.CH.rSE..F.--E.......PW.T.TH...S..........P...G..G....LLGSMRNTFQSLv....lWS.TSPDms............mapQSYT..HR..Q.LIAGI..RVQG...STRV...LAALVEEL.KLQTEA--....---.---..---...-.....GNGDLALDIV.ATLICAPL.AE.S...-..-...F.AV.D...Q.NNYSQ-HPID.........P......TKEPL..PRCPILTLR.....................................DALFLLHENVPkISEKDPLRAEVivr......................lyrrVNVLMTPPTQVP..................-----......-..-.....NLDMNNIIQNM..Q----.-----......----.----.-.-..--.----------------------lgvggpgqmdld............................................................................................................................................................................................................................................
A0A2T0FHF9_9ASCO/189-629               ..............................................................................................................................................................................................................................................................................qvdtvsytpsktfrllwldtavsrlehlessaflqqldilwpne--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----RTPTLIYELTLTAFDGCA.VAA.NSP.---.-..-.ES..AVSFG--LWTGLLLKRLPLVIQD................LL.ARDSanp...................tadSALSRVLT.....TM.DKK.II..EI..-..-..---.--..-....V..DA....----.--..---.-.....-...---.-...SD.LRASFIRTCIDLGVCD.STVLHVLHKN.HPA--.--..--.-.RHEDPT.V.A..-L..E.G.T.IK-VDDIARN.......................................iIAQ......DFEKVSWETSI......-------................--A..VKLVH.EYA.SH....GPLRQKA.IGS...QFLKLFL....KSSS..I.S..MRHHVALLCGA..L.-IV...Y...PT.....ACDHL.FLHVP...L.R.VVLDVLLAH......LD---................N......-......-..........-.......-.......-....-....--...........-...A.........A.....N...A...A....I.T...........QAA..........GYGD.AGTILEFLQFTFARYQL...D..K.QL...L...ADP...........RN....NMH....YRSSWSQT..FL.L.KTPG..---EY-.----..-PTVSNLNDTQLK..LLGLWI.GGLF........GG..Q.....GIGDAAL......Q.PY--GEV..LSILPALVGQVAS.....AL...Q...L...........N......VI-....N..........QET.LALSLE............Y................F....IQPGLTPL.LAIIVDQLCHD......LW.LQH.S.P..L....G.T.....L..HI.VS....AL.L.QVL..Q-.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------rens....................................................................................................................................................................................................................................................
A0A1B7NC13_9AGAM/555-701               ...........................................................................................................................................................................................................................................................................................vlakfrisspiikggktyrtellrctsrvyh--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..---ADELSPEHKS..AFATWF.KAIFd......sSS..E.....GIDDAIL......R.TTKPQIL..LQISATLFAQAAM.....AR...N...E...........G......RI-....D..........IET.LQTGMS............Y................F....LGPLLRWT.LVGVIHAM---......LF.EIQ.H.R..S....L.F.....A..--.-P....WH.L.SIV..QA.I.L.....C..S.S..S.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------cp......................................................................................................................................................................................................................................................
A0A1A0H1P7_9ASCO/1-631                 ......................................................................................................................................................................................................................................................................................................................msst---TLLKKLLRASLARNTNPKLFASLLEQLLAREQISD....................AELG...........................----------...........EMLLNVADSPVKAN.....STTsilA.....RR...LQIE..YVLEFAF.......S-S...SEN..LARf..fKLLPQLSLKS.....QLKYILYF---.-KTQ.................................................................................VGKI.IDRS.LINE.FY.N.G.LA..QF.T.IAASpsr.................................................pgeCS..P..H......SN.RL.WY...HV..V..F..VWGAFIDL..-..-.--DSSI...pA......................................NPSLK.ES.F.Q.KM....AL.......F....AGD.LE...DdyI.G.ALIS..............................RKFGA.A.ADPGA.S.L-.--.-.---............-NFQT..TRM...AKS-.-......................................----...-..-EEA..............PTT.M.PEKSL......SLNlNGK....................KYSN..Y..VS..L..K--K...FIWLNF..HFQ.LWKM-.DTEMSRAFMT----FFN.LQD..........---LSHTDLAKELICSFLNGAA.VAV.RLG.---.-..-.EE..PYVIF--NWKNFILTHLAQDLKE................IV.LSSHavd..................hewhETVSAAIT.....SC.ND-.--..LV..I..T..ETK.IG..G....V..--....----.--..---.-.....-...-KE.S...YN.LNKEFMRSCLHQELISlEKYIQVFPSE.AENL-.--..--.-.--STSI.L.A..HE..I.E.N.LRLTELITAE........................................FKS......RLENVNPEFTS......----LQE................SNL..IDYFK.NLP.LTnfrfLNAKQCK.LAQ...LSENLID....NIVR..E.K..NNEKLRWISLV..F.-LN...V...-P.....SIANF.IFYQSrkgP.W.MFLSKIINY......ID---................-......-......-..........-.......-.......-....S....ES...........F..nV.........D.....E...D...D....G.N...........FQD..........TYAC.FGVILTSVISVAAFFGI...E..F.AS...L...GLK...........NS...yTID....YINQFYFR..LC.N.MLTN..---TYT.GASE..--QEKQIISNYEN..LVTEWA.NALFd......vNN..D.....GLSDDLL......K.SVNVKQI..YK-----------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------........................................................................................................................................................................................................................................................
A0A428U9J1_9HYPO/14-952                ......................................................................................................................................................................................................................................................................................................................tidf-----WKTFVSRCIARRVDTDRFEVLVQQVYAEHPLP-....................----...........................----------...........--------------.....---...-.....PA...VIAD..FFLRPQPs....ndNSL...DPR..IPPy..lQALTRLGYID.....TPSVLRALYKY.SSSHaqaqqqpnngddknetaq............................................ppktqikrwkssywaeeaiFYSL.TKAV.VEGR.AI.P.DsTI..AL.D.VVKI.......................................................IS..K..Y......MT.LF.TA...AS..T..A..FAADMLG-..-..-.QLHSPQ....I......................................RDEME.SA.R.A.GL....VA.......L....LLR.LC...E..N.D.ILVKavskp...................fakdarKELAT.S.LASFV.P.TL.QL.V.PEL............TEKLE..LFR...TETL.A......................................SLDP...A..DKKKq............vANA.A.MDELL......DST.VGLen...............fviPEIP..I..SN..T..RAGL...YIYLNA..ALI.GRPIL.DDNALFSYMN---NKYQ.GDV..........------QSSAIDLILASF----.DIL.ANA.VFR.N..E.GQ..KDAHLLRS---YLINKLPLLLYQlcp..........pqfPG.TSAE.........................FCITEALH.....HV.DT-.--..SL..F..P..TAS.LM..F....D..ES....RNNN.PY..T--.-.....-...---.-...ES.VREEFCASCVLHGLVQ.RDHVERILGE.ISLSD.EP..SL.Q.K-----.Y.S..KE..K.L.V.QDCLSDTDKIq......................................gLIP......ELDKMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALIELLR....QYCH..S.K..ETMSLKLLCSQ..L.-AA...K...PQ.....SLDVI.LLFEK...L.P.AILEPLCQL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLVLAFAYRYNL...T..A.AD...V...GAI...........TP....---....--DSCVAK..II.G.RGHI..-AR---.----..--QGDELTEQENG..HIGGWI.HGLFd......tEA..G.....GLGDELM......S.SCPPQEF..YLLVAPLFQNIVV.....AY...A...H...........G......YL-....N..........DES.LKGGVE............Y................L....VDTFLLPS.LVPAIRFLSDY......LW.LDQ.K.E..-....-.-.....-..--.AK....SV.I.KVL..QL.I.L.....L..P.S..S.I...S..GE...........ASTMLS..SVK....NLIAKPLEHSLRTYQRRD.pKN....Q--------.----..-----.-...----.....-......--.....-D.IE.P.LL.RVLK.DS...I.PlS...............R.R............T...GG.AD.iNE..L.--E.......SW.T.ST...A..........T...N..G....LASAIKHNIQGLv....hWS.MHPAin............smpTSYT..HR..Q.MLAAL..KLLG...SKRL...LHIILEEV.RQQTEA--....---.---..---...-.....GNANSVYDVA.TSLICAPD.AV.K...-..D...A.PV.A...M.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ldangnmppplqrprtlremlkaeaegckklqkkdaalaeivvrlhrrvemlmvmpeaqamlqtadm.....................................................................................................................................................................................
A0A0U5FSV3_9EURO/289-961               .................................................................................................................................................................................................................................................................................................................yvyinamgh--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........-----YEILIQEIITAAF----.DVL.SNA.MYR.N..E.SS..RTMLLFRS---FLVNKLPTFFAA................-M.LSVSmvs..................lpmeVCIGHALS.....RL.DP-.--..NT..F..P..SFS.QM..F....S..--....MQGN.SS..L--.-.....-...---.-...SD.VRQEFLFSCASHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTLP.V.G..GP..L.V.K.DDLVAQISANher..................................aeqLIS......DIESTEGNAAA......-------................---..-----.---.--....-------.IVG...AITEVMH....NLCN..Q.K..ETMTLKNICNS..L.-SR...R...PQ.....SLDVM.LLFRS...P.K.QILQPLCAL......LD-SW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....A.E...........SQP..........VYDE.FGSILLLVLTFKYRYDL...R..P.FD...L...GIT...........SS....---....--NSFILK..LI.E.RGSS..------.----..SLKLEELSEKQNK..NIGEWI.AALF........IA..E.....GISEETM......S.GCSPQEF..YMLVSTLFRQSLG.....AC...E...A...........G......KL-....E..........FDT.LKGGFE............Y................L....LEPFLLPS.LVVALTWLSNH......IW.ESE.Q.D..P....T.I.....P..--.--....--.L.KTL..QS.L.V.....S..P.S..S.I...S..GE...........AREIHL..TVL....NITARALEEQLKDVRARH.pNR....T--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DALE.PC...L.S.F...............K.R............T...AS.CH.kSE..L.--E.......SW.T.TH...S..........P...G..G....LLGSIRSTFQSLv....iWS.TSPDvn............mapPSYT..HR..Q.IISAI..RMLG...ATRV...LTSLLEEL.KLQSQS--....---.---..---...-.....GNADLALDIA.ATLICTPL.AE.S...-..-...-.--.Y...A.IDQNTHHPVD.........P......TKEPV..PRCPMLTLR.....................................DALNLHHADVPkISEKDPLRAELvvr......................lyrrVNVLLAPPAQVT..................NLDMN......M..-.....NMNMNSIIQNM..QLGV-.--DQT......SMDL.D--P.S.G..AS.SAPGQNEQANLDQIMDNA----aaav....................................................................................................................................................................................................................................................
A0A1E3IPX5_9TREE/499-707               ..................................................................................................................................................................................................................hftteilkviqdapqvmppenllllvsshpcllsaittyvcppsflqlttshllsepaeidnlarsedpqgyltkfgegivliesfvrefelrlpnllvkarra--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-VGYDLLSTEETE..RLNRWV.KAIF........GS..D.....GIEDQLL......L.ATPPQAL..YILLPTLVQQALA.....AV...A...Y...........G......QI-....D..........LDI.LHSGLS............Y................F....SQPFLSWC.LGGVIGWL---......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------cceivrlgalstlhliv.......................................................................................................................................................................................................................................
A0A094CMN5_9PEZI/132-758               ..............................................................................................................................................................................................................................................................................................................ksaqealgtvna--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..-LTEWMRL..L..V.MANAAD...dMmreig...........................agndthNQETM.AV.R.V.AV....GA.......L....LVA.LA...E..N.-.AVVNealrnr..................cpkdtlKGFSQ.S.LANFT.P.LL.IN.G.SSM............FADRL..ELY...TKTL.Malepv............................dkkaqK---...-..---Agae.......idqiIDS.A.MALGM......NNI.PVV....................EIPT..M..NS..R..A-GL...YVYLNS..LLT.GRPMV.DDNQLLNFLH---NRYQ.GDI..........------QTTCIDLIVSSF----.DVL.ANA.IFR.S..E.NP..QTTFLLRS---FLINKVPLLIS-................-M.ISAPmfpp.................lnpeLCITEALS.....HV.DT-.--..NA..F..P..TFS.SM..F....D..DT....--SA.GD..MFS.D.....S...---.-...--.VRQDFCFSCCLHGLIP.EESIERLLGE.IPM--.--..--.-.--QTLP.A.G..GR..Y.T.K.DEVLEQCLSDsek..................................ieaFTD......ELEHMDGNVGA......-------................---..-----.---.--....-------.VSQ...AITELLR....RLCE..S.K..DTMALKSLCVH..L.-AR...K...PS.....SLDVL.LIFDK...P.L.TILPPICQL......LD-AW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...D...Q....G.E...........YQP..........VYEE.FGSILLLVLAFVYRYDL...S..A.TE...L...GVQ...........TP....---....--DSFIAK..LL.V.RGST..------.----..ARLLDDLSTLESS..QLDGWI.KGLFn......aEG..G.....GLGDEPM......A.LCPPQDF..YLLVPTLFSQIVL.....AS...Q...H...........G......HLT....D..........-DV.LRGGLE............Y................L....LDPSLLPS.LIPAMLSLA--......-S.NIL.T.T..P....P.P.....S..--.--....--.-.SLL..HA.L.I.....L..P.Q..S.I...S..AE...........ASLLHN..AIL....PIPGPHLSRSLRALQRSA.pTR....T--------.----..-DL--.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------dpliaalrphlhfsrta.......................................................................................................................................................................................................................................
A0A1C7MR29_GRIFR/470-741               .......................................................................................................................................................................................................................................................................................................................sha--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...AFAEVVM....KRFT..S.S..DVESLSSLCKI..L.-CK...C...DI.....ALDML.SLHAK...I.T.DVVAHALAF......VE-DY................D......-......-..........-.......-.......-....-....--...........-...-.........C.....E...T...V....G.D...........PQT..........AVSH.LGDVVLFLQSTIVRFNL...S..S.PK...Y...SLG...........RR....E--....-LNSGYLR..SA.A.LVYR..V-----.----..----DELKGEDAT..GFKAWF.KALFd......aSS..E.....GIEDSIL......R.ATRPKTL..LRIAATLFSYAIS.....LC...T...E...........R......KM-....E..........TDV.LNNGIS............Y................F....LGPLLNWT.LAGVVRVL---......LM.EVQ.H.K..G....F.K.....A..-P.IH....--.L.EVL..QT.L.L.....S..S.S..S.C...P..P-...........------..SVL....RLSATNILRLFPDPKT--..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------qeqgrtgsfdttpirraalqal..................................................................................................................................................................................................................................
A0A421JUH3_9ASCO/370-726               ................................................................................................................................................................................................................................................................................................kskfnkslsinkvlpnstddlvelnl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.RQRFN----Ekl....................................lnINS......EFTSLE-----......------E................SGL..IEFMH.GLP.RDl.efSQKHQLE.LSS...IIIEIIN....DLIS..G.K..DFEKLNRLLLC..I.MNN...I...--.....DLLNL.IMFNCq.qA.Y.GLLYQLIDF......ID---................-......-......-..........-.......-.......-....S....TQ...........F..nI.........D.....E...D...D....E.N...........FQD..........TFTY.FGVTLLAIILIIDHFKL...D..Y.SY...R...IKN...........SF....IID....YLNNFYYG..LC.E.NLTN.qIPA---.----..DEEENEQVLNYNN..LISDWI.NGLFd......dNN..D.....GLSDELI......K.SVNIKQI..YELIPIIYQQAII.....AT...S...L...........G......KL-....S..........YSS.LTNGLD............Y................L....SQVFLIPS.TVSLISWL---......LK.EVN.LlN..K....L.D.....S..DN.VH....--.L.KVL..SE.I.I.....Q..S.N..T.T...S..SSts......sstSQDVPV..LILniirNIHGRDIYKTITKFKEWE..T-....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ipi.....................................................................................................................................................................................................................................................
A0A0D2GP52_9EURO/69-369                ............................................................................................................................................................................................................................................................................................gmvkvsdallvliskwnemktpptqpvlgc--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.-YNQ.TL.Q.D.IT..MI.I.VSAR.......................................................YK..T..N......AS.EV.CT...SL..L..L..-SSRWLSS..L..A.RHLSQQ....Lgd..................................saNPEHS.PV.I.E.AL....AF.......L....VVS.LA...A..T.D.GGLEalspaniskg.........dpkkgsgrelrTSLRQ.A.MEHCL.P.LY.P-.-.--V............LSTQL..MER...VNAV.Lkhi...............................nlldDGSS...Q..----..............PAN.S.STQSS......EIQ.ALQfq...............vsiPDSQ..I..VA..S..KPGT...LIYLEN..MLS.TGSTI.DDGIVVNFLS---SRHQ.NDY..........------QAMFIDLFTSSF----.RIL.KTQ.---.N..T.AP..KMQLLHQQCQTFAQNKLPVLLSMisa..........ssfNS.FNTE.........................QAITDAWH.....QV.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------mps.....................................................................................................................................................................................................................................................
A0A443I005_BYSSP/3-982                 ........................................................................................................................................................................................................................................................................................................................ta--VEQWRKLLHQCLIQRIDANEFKSLSKLLLRRSPLP-....................----...........................----------...........--------------.....---...-.....EA...TLLD..VVLESRTv....tdVQW...DPL..LPLy..vDSLAKLGHVK.....ISTVLSSALKY.STIVdnksgdspggtaa......................................................ageeikkkkgrkvsSSLM.TDIR.IIQD.AM.M.T.IS..AG.F.SPKT.......................................................--..-..-......-T.VE.AV...NI..F..S..AVAEWIIA..V..V.AWHNGN....Vdeqhq...........................tgglmnSPDGM.TL.F.E.SL....GI.......L....LAA.LS...A..T.G.KALEalamg...................nseawkVKLGQ.A.LSAYL.P.LC.AG.-.---............VSLPL..RNR...LDSL.Qkefnlygdsas...............kslevsmmdgvnVNAL...Q..FEASvi..........dgPVV.N.SRAGL......---.---....................----..-..--..-..----...YVYVNA..MLV.GRPLV.DDSMLINYLT---NRYG.GHH..........------GVLVEELITAAF----.DVL.SNA.MYR.N..E.SS..RTMFVFRS---FLVNKLPSFFAS................MS.AA-Smep..................ipmeLCISNALN.....RV.DP-.--..NA..F..P..SFS.QM..F....A..--....MQGN.TV..L--.-.....-...---.-...SD.VRQEFLFACATHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTLS.A.S..GQ..Y.V.K.DELVSQINANper..................................aehLIG......EIESMEGNAGA......-------................---..-----.---.--....-------.IVA...AITEVMH....NLCD..Q.K..ETMTLKNICNS..L.-SR...R...PQ.....ALDVI.LLFRS...P.K.TVLQPLCAL......LD-AW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........NQP..........VYDE.FGSILLLVLAFKHRYNL...S..Q.YD...L...GIS...........TN....---....--NSFVLT..LL.D.RGPS..------.----..SQKLDDLTDSQHK..NLGAWI.SALF........IA..E.....GISEESM......S.SCSPQEF..YMLVATLFSQSLG.....AC...E...A...........G......KL-....E..........FDT.LKGGFE............Y................L....LEPFLLPS.LVVALTWLGNY......IW.ESE.S.D..P....T.I.....P..--.--....--.L.KVL..YS.L.V.....K..P.S..S.I...S..GE...........AQAIHR..TVL....QITARTLEEQLKDVRTRQ.pSR....S--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DGLE.PY...L.S.F...............Q.R............T...GS.CH.rSE..L.--E.......GW.-.TN...S..........S...G..G....LLGSIRNTFQSLv....lWS.TNPVis............mtpHSYT..HR..Q.ILAGI..RILG...ASRV...LAALIEEL.KLQTEA--....---.---..---...-.....GSGDLALDVA.VTLVCSPM.AE.S...-..-...F.AV.D...Q.SFYHP---ID.........P......NKDAL..PRCPILTLR.....................................DALIIQHDDVPkISEKDPLRAEVivr......................lyrrLNNLMAPPSQV-..................-----......-..T.....NLDVSNIIQNM..NLDGV.GEHGQ......MGLG.PGEH.G.V..GQ.GGVGDEDPENINQMLNEA----aaa.....................................................................................................................................................................................................................................................
A0A1J9R6I2_9PEZI/9-907                 ................................................................................................................................................................................................................................................................................................drclqnrlsadkverlavqlskripr--------------------------------------....................----...........................----------...........--------------.....---...D.....EA...QLAE..ALLQPRSr....atACS...DPL..IPVy..lERLLVLGFLN.....PPEILHALFRY.SRDYaagaehss................................................................rrarlqqwhITPD.LEEL.VFAR.LS.K.A.FI..TV.E.RPST.......................................................--..-..-......-F.AE.VQ...KT..L..A..ILTQWMNA..V..N.SSQTAE....Svmhs.............................ladgtQEQRT.QT.V.L.SL....SM.......L....VIA.ML...E..N.P.KVAGaaqaa...................lpkgmrKSLSD.A.LTGFV.P.HL.TQ.A.SLQ............WG---..-DR...LSML.Qkqyslttenasg..............gindgpgnhgldVSVL...Q..LETVm...........dlPII.N.SRAGL......---.---....................----..-..--..-..----...YVFINS..LLT.ARPLT.DDNMILNYLH---ARYK.VDY..........------QSMAVGLITASF----.DVLaANT.TYR.S..E.SN..EAIFNFRS---FLINKVPSLVAI................--.LAGSmfpt.................ttpeLCITQALN.....HI.DR-.--..NA..F..P..SFS.QT..F....D..-M....APVN.SL..L--.-.....-...---.-...SD.VRQDFLVACALHQLVP.ESSIERLLGE.TPM--.--..--.-.--SSVP.V.G..GK..Y.V.K.ENLVAQCSTNfer..................................veeLLN......EIEGMDGNAGA......-------................---..-----.---.--....-------.IVG...AMTDIIR....NLCA..T.R..ETMSLKTICNT..L.-SR...K...PR.....SLDVM.LQYTS...P.A.SILQPLCQL......LD-SW................K......-......-..........-.......-.......-....-....--...........-...N.........D.....E...D...Q....S.E...........YQP..........VYDE.FGSVLLLVQAFMHRHDL...K..S.SD...L...GLE...........DA....---....---SFVIQ..LT.E.RGHK..------.----..SLDADELTEDQNK..YLAGWL.RGLY........DP..E.....GISDELL......S.NCKPQDF..YLLVPTIFSQTIF.....AC...S...A...........D......VL-....P..........LDT.VKAGLE............F................L....LETFLLPS.LVGAVMWITSH.....aLE.QNV.H.D..-....-.-.....-..--.LD....IT.M.QIL..TR.L.I.....R..P.T..S.I...S..GE...........AQAMHS..TIV....SMVSRRLERCLKSIQHRE.pSR....T--------.----..-----.-...----.....-......--.....-D.VN.P.LL.ESLR.PY...H.D.Y...............E.R............T...PW.SS.sAE..L.--E.......PW.M.SN...P..........G...A..S....FRSAIKFTMQHLt....sWN.STADlt............ptpPAYT..HR..Q.IFSAL..QIVG...AQKV...LRAILEEL.KNQTVA--....---.---..---...-.....GAGAVAIDIA.VNIVCAPL.HV.N...S..C...T.PV.S...W.LN--------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------sqvpahnpqrngsfslremlknelddpasliqadaglaeaairlhrrveaql....................................................................................................................................................................................................
A0A2T4CDX9_TRILO/15-978                .....................................................................................................................................................................................................................................................................................dsvkcwsdfvskcltkrldagpfedyvklifarhplt--------------------------------------....................----...........................----------...........--------------.....---...-.....PE...VIAD..FLLQPQAs....ncVSP...DPR..IPPy..iSVLTQLRYID.....AVSILRSLYRY.SSLHtqtplqaqgqdhdqdrdqdhqqeererekekerekd.........geeegkdatakehghektlpgdtkheaqqdtlrpsrTRWK.SSSW.LEEV.MF.Y.H.VI..RL.V.VEGT.......................................................AS..K..D......-S.RT.AL...EL..I..H..VTSKWMSL..F..A.AASNSM....Aaemlsg.........................tlqdpqvRHDME.VS.R.A.AF....VP.......L....LLR.LV...D..N.P.ALVKvishp...................sakaprKEFSD.S.LTSFV.H.VF.QP.V.PPF............VEKLE..MFR...TEVL.A......................................PLDP...V..EKNN..............QAA.N.AMDEL.....lDST.VGLd.................nlMIPD..M..PItnT..RAGL...YVYLGA..SLV.GRPLI.DDHAFFSYLN---NRYQ.GNN..........------QQSAIDLILASF----.DLL.ANA.VFR.N..E.GP..RDAHLLRS---FLTNKVPLILGQlcp..........pgfST.PSAE.........................FCITQALS.....QV.DT-.--..SV..F..P..TAS.LM..F....D..ES....RNNN.PY..T--.-.....-...---.-...ES.VREEFCSACALHGLIE.REHVERILGE.SSM--.--..SY.E.PSQEKY.F.K..-E..K.L.V.QSCLSDPDKIq......................................aLVR......DMDKMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALVELLR....QLCN..S.K..DTMSLKILCSQ..L.-VQ...K...PQ.....SLDVL.LLFEK...L.P.TILDPICQL......LD-GW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGAILLLVLAFAYRYSL...Y..P.AD...I...GIL...........AT....---....--DSSVAK..II.G.RAHI..-SR---.----..--GLDRLSEQEHG..HLGGWI.HGLFd......sDA..G.....GLGDDLM......S.SCPPAEF..YLLIATLFENIVI.....AY...T...Q...........G......SLT....D..........-DA.LKSGVE............Y................L....VDTFLLPS.LIPAIRFLSDY......LW.VEQ.R.E..Q....-.-.....-..--.-K....SV.I.KIL..QL.I.L.....L..P.T..S.I...S..GE...........ASTMLA..SVK....GIVAKPLEHSLRAYQRQD..PK....N--------.----..QDIEP.L...L---.....-......--.....--.-R.A.LK.DSLP.HS...R.-.-...............-.R............T...GA.AE.hQE..L.--E.......MW.T.AS...S..........S...S..G....LAGAAKHLIQNLv....qWG.MHPQmt............ampTSYT..HR..Q.IIATL..KIVG...ASRL...LRVMLEEI.RQQTLA--....---.---..---...-.....GSGSIAYDVV.TALVCAPN.VS.N...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------elpltsglldetgslppplqrrltlrevlkmeaenyrrlhkkdpelaei.......................................................................................................................................................................................................
A0A319CXX0_9EURO/2-946                 .........................................................................................................................................................................................................................................................................................................................t-SSEQWGTFLRRCLLHRIDAAEFKSLARLLMQRCPIA-....................----...........................----------...........--------------.....---...-.....EA...PLLD..VLLETRLa....tgIKW...DPL..LPLy..iDCLCKMGLVQ.....TSTVLNCLLKY.SSIHdkpqppgqe..............................................................avpikqrhkcYTLM.TDIR.VVQD.AM.L.S.VS..TG.T.TPKS.......................................................--..-..-......-F.PE.AV...GI..F..H..AIVDWIQA..V..V.SWHNNH....Mdashq...........................tgglmsSPDAV.SL.F.E.SL....GI.......L....LAA.LS...G..T.S.KGLEvlsav...................theslkVKLGQ.A.LSAYL.P.LC.VE.-.---............VSLPL..RNR...LDSL.Qkefglfgepas...............ktldvsmmenvnVNAL...Q..FEDSvm..........dgPVL.N.SRAGL......---.---....................----..-..--..-..----...YIYINA..MLV.GRPLV.DDSMLLNYLS---NRYG.GHY..........------QSLIEEIITATF----.DVL.SNA.SYR.S..E.SS..RSMFLFRS---FLVNKLPSFIAA................-M.LAASmvs..................lpmeLCISHALS.....RL.DP-.--..NT..F..P..SFS.QM..F....S..--....MQSN.TA..L--.-.....-...---.-...SD.VRQEFLFACASHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTLP.M.G..GP..Y.N.K.DELVSQINANper..................................aeqLIN......EIESMEGNAGA......-------................---..-----.---.--....-------.IVG...AITEVMH....HLCN..Q.K..ETMTLKNICNS..L.-SR...R...VQ.....ALDVI.LLFRS...A.R.QVLQPLCTL......LD-AW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQP..........VYDE.FGSILLLVLTFKFRYDL...R..P.CD...I...GIG...........GN....---....--NSFVFR..LL.E.GGSG..------.----..SEKLDDLNEKQNK..NLGAWI.NALF........IA..E.....GISEETM......S.TCSPQEF..YTLVTTLFSQSLG.....AC...E...A...........G......KL-....E..........FET.LKGGFE............Y................L....LEPFLLPS.LVLALNWLGNH......IW.ETE.N.D..P....T.I.....P..--.--....--.L.KAL..QS.L.V.....T..P.S..S.I...S..GE...........GREIHR..TVL....NITARSLEEQLKDVRSRH.pSR....T--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DALE.PY...L.S.F...............Q.R............S...GS.CH.rSE..L.--E.......SW.T.TH...S..........P...G..G....LLGSMRSTFQSLl....lWS.ASPDms............mapQSYT..HR..Q.LIAGI..RIQG...SSRV...LAALVEEL.KLQNEA--....---.---..---...-.....GNGALALDIA.ASLICAPL.AE.S...-..-...F.AV.D...Q.NNYSQ-HPID.........P......TKEPL..PQCPILTLR.....................................DALFLVHENIPkTSEKDPLRAEVivr......................lyrrVNVLMTPPSQVP..................-----......-..-.....NLDMTNIIQNM..Q----.-----......----.----.-.-..--.----------------------lgvggpgqmdle............................................................................................................................................................................................................................................
A0A167D9E0_9ASCO/649-847               .....................................................................................................................................................................................................................................................................................................................dsmav--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.-D...V...NGK...........SD....DPE....TQNSFWLS..CV.L.DGVR..--DAIV.----..---VDDMSEDRKV..LLGGWI.SALY........DS..G.....GISDDLM......R.LSSIKEL..TLLVPSIFQQSIA.....AC...A...A...........E......II-....D..........QDT.LRGGLD............Y................F....LQPFLLPT.LLAAFRYLSDC......LW.LSS.S.A..-....-.-.....S..QD.LS....HV.L.FVL..VF.L.V.....S..P.S..G.L...S..PE...........ATNIHK..IIL....TIISSELKASLIDLKNRT..SK....E--------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------hntidqllialephvt........................................................................................................................................................................................................................................
Q2HB43_CHAGB/241-425                   .............................................................................................................................................................................................................................................................................................................vnsraglyiylsa--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........------------AISASF----.DLL.ANA.VFR.N..E.GP..KTGHLLKS---FVVNKVPLILVS................-L.TNSPtmyp.................fnseMCIKEALA.....QV.DT-.--..NV..F..P..TLS.GM..F....E..-M....SNTN.SS..F-H.D.....-...---.-...-S.VRQDFCFSCQLHGLLS.QTAIENLLGD.ITY--.-Q..SL.P.DEGRYV.K.D..NL..V.Q.A.CLLDVDRTQR........................................LIG......ELDNMNGNVGA......-----AA................QAI..IELCS.QL-.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------aakp....................................................................................................................................................................................................................................................
A0A4R0R5V9_9APHY/1623-1900             .........................................................................................................................................................................................................................................................................sepsriqaeaqdastdmelyidsklasesnmndietfmgrvwkdpfshk--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....------S.CAS...AIRKRFT....TTVS..S.L..DIDALGHLCKI..L.C-T...V...ES.....ALDIL.TLHHD...L.V.ELLAMALRL......VE-DY................D......-......-..........-.......-.......-....-....--...........-...-.........C.....E...T...V....G.D...........PQT..........AVAH.LGDVVLFLQSALARFHL...S..S.TV...F...RIK...........DR....---....---ELRTD..VL.S.AGSI..-TH--R.IDQK..--------GEDTL..VFNAWF.KALFd......sNS..E.....GIDDTIL......R.STKPKVL..LRIAGTLFSHAIQ.....QC...V...E...........R......KL-....D..........KET.MNNGFS............Y................F....SGPLLNWT.LIGVVKVL---......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------lgeyerglmripyypevmqtlltstsc.............................................................................................................................................................................................................................
A0A1V6UCQ8_9EURO/8-487                 .......................................................................................................................................................................................................................................................................................................................aip---EQWRTFLHQCLVNRIDIDEFTDLSGLMFVRAPVK-....................----...........................----------...........--------------.....---...-.....ES...ELLD..LLLEARAs....ssVTW...DPL..LPLy..vDGLCKVGRVK.....SSSALASLLKH.SSVLdatesgegdgga.........................................................qgspskakkqkpSTLM.TDIK.VIQD.VM.V.F.IS..TG.S.IPKT.......................................................--..-..-......-V.VE.AA...DI..Y..S..ATVDWIMA..V..V.AWHNHS....Ldvsqq...........................tgglmgSPDAV.SL.F.E.SL....GI.......L....LAA.LS...G..T.N.KGLEvlssd...................ynqalkTKLGQ.A.LSSYL.P.LC.ID.-.---............VSLPL..RHR...LEEL.Qkvfnlypgqps...............ksldgpaidsvnVNAL...Q..FESSvm..........dgPVV.N.TRAGL......---.---....................----..-..--..-..----...YVYINS..MVV.GRPLV.DDTILINYLT---NRYQ.GHN..........------DVLIEEIITAAF----.DVL.SNG.VYR.N..E.SS..RTMLLFRS---FLVNKLPAFFAA................IS.AA-Smvp..................ismeMCISHALS.....RL.DP-.--..NA..F..P..SFS.QM..F....S..--....MQGS.SV..L--.-.....-...---.-...SD.ARQEFLFACASHKLIQ.ESSIEQLLGE.NPM--.--..--.-.--QTLP.G.G..GP..Y.V.K.DDLVSQINNNher..................................aeqLIG......EIESMEGNAGA......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ivga....................................................................................................................................................................................................................................................
J4UJ97_BEAB2/14-962                    ...................................................................................................................................................................................................................................................................................................eavkywsdfvarcivqrldsnrf--------------------------------------....................----...........................----------...........-------QDFVQLV.....HAR...Hp..lpPV...LIAD..LFLRPQPs....nrVSL...DPR..IPPy..vRILAQLRYVD.....APSILRVLYKY.SALHahdrpplplpsslpenggdge......................................tmkkeeeeekgaggggvmrqdkMVRW.QE--.-SAW.AE.E.V.LF..YH.V.IKTMf....................................................egTA..F..T......DA.KT.GL...EL..V..D..ITCKWMDL..F..V.HASSEL....Aadmlan..........................khdrqaRDEME.TV.R.A.AL....VP.......L....LLR.LV...D..N.H.ELLRiiskp...................fakgirKHLSE.S.LGNFI.Q.TV.QP.P.PLY............IERLE..IFR...TQTL.A......................................QLDP...I..DEKKk............aANA.A.MEELL......DST.VGSdnfv............vpdiLISN..S..RA..A..L---...YVYLNA..ALV.ARPVL.DDSMLYAFLS---NKYQ.ENQ..........------QASAVDLIVASF----.DVL.ANA.VFR.N..E.GP..RDAHLLRS---FVVNKLPLLLCQlch..........pefSA.ASAE.........................FCITEALS.....RV.DT-.--..GI..F..P..TAS.LM..F....D..ES....RNNN.PY..M--.-.....-...---.-...DS.VREEFCAACALHGLIE.RDHVDRILGE.TSMS-.--..--.-.-YD--P.S.L..ER..A.N.R.DRLVSDCLSDsgr..................................iqnIIS......QLDRVDGNVGA......-------................---..-----.---.--....-------.VAH...AIVELIR....QLCN..N.K..DTTSLKLLCLQ..L.-SQ...K...PQ.....SLDII.LLFDK...V.T.SVLEPVCTL......LD-NW................N......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.YGAILLLVFAFTYRYNL...S..P.LD...I...GIQ...........SA....---....--DSHVAK..II.A.KSHM..LRP---.----..---LEDLNEQEAE..HVAGWI.TGLFd......nET..G.....GLGDDLM......S.SCPPHEF..YLLVAPIFQSIIT.....AY...T...Y...........G......YI-....N..........DES.LKGGVE............Y................L....VDTFLLPS.LVPAIRFLSDY......IW.IDE.K.E..-....-.-.....-..--.QK....SI.V.KAL..QL.L.L.....T..P.S..S.I...S..GE...........ASTVLS..AVK....NLIAQPLEHALRTYQRQD..PR....N--------.----..Q----.-...----.....-......--.....-D.IE.P.LL.RSLK.EN...L.P.L...............S.R............R...TG.GP..EH..H.EMV.......SW.A.NN...S..........N...S..G....LSGAIRHTIQGLv....qWS.LQPGvn............vmpTSYT..HR..Q.LITGL..RIIG...PSRL...LRLIMEEV.RQQSEL--....---.---..---...-.....GNASIVYDVA.AALIAATD.PT.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------neappgpnlldtagtmqatpppqrpqglrealktaaegckrlqkhdqflaeatvrlhrrveml.........................................................................................................................................................................................
A0A1A5ZTV0_9TREE/588-750               .....................................................................................................................................................................................................................................................................................................ahyqlplpallqdarradsfc--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-----HLDNESKE..CMNGWV.KAIF........GS..D.....GIEDAIL......L.ATPPQKL..YALTPTLIQQAIL.....AV...A...T...........S......QM-....D..........LDT.LHSGLS............Y................F....SQPLLSWC.LGGVVSWL---......CK.EIK.R.Q..G....L.L.....S..-A.LH....--.L.VVL..QD.L.I.....L..G.H..S.C...P..E-...........------..ALI....RVNAQSLNELLKD-----..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------islvdvfqssnfd...........................................................................................................................................................................................................................................
A0A1B9HZ55_9TREE/591-841               ...................................................................................................................................................................................................................................................................................................................rcassfs--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-----HLDDESKE..CMNGWV.KAIF........GS..D.....GIEDAIL......L.ATPPQKL..YSLTSTLIQQAIL.....AV...A...A...........S......QI-....D..........LDT.LHSGLS............Y................F....SQPLLSWC.LGGVVSWL---......CK.EIK.R.Q..G....L.L.....S..-A.LH....--.L.VVL..QD.L.I.....L..G.H..S.C...P..EA...........LIRVNL..KVL....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ndllndnslievfqssnfdlngiklklnhfnlnellsipsinssiplneslkllrkidennssinwektffnsienelklksnkkiikiifkeifnfnfnfnkinndnlikfiplilnfkf...............................................................................................................................
B8LUB6_TALSN/2-1029                    .......................................................................................................................................................................................................................................................................................................................kpi---EQWRKLLHECVSRRIEVDVFRRLVKILSRRAPLQQ....................AS--...........................----------...........--------------.....--L...V.....NV...LLGS..QSITAEI.......FPY...DPL..IPRy..aTALRKLGLIR.....ISTLLDGLRRQ.SFIEgqstavsdhdk..........................................................sateqnqkavhrSTLM.TDTR.IVQD.LI.A.P.LS..ST.-.---N.......................................................LS..F..S......TH.D-.VQ...SI..F..M..VTAEWILD..V..V.RWHSGN....Isedhq...........................eggltsSPDAL.AL.F.E.SL....GI.......L....LVA.LS...A..T.A.KGHDvltse...................saaefkIPLGQ.A.LTAYL.S.TS.AT.-.---............ISLNL..RNR...LDSL.Qkgyqlyggpas...............kdldiqmmdgmnMNGL...Q..FEASvl..........dgPVI.D.SRAGL......---.---....................----..-..--..-..----...YVYINA..LLV.GRPLI.DDEMLLSYLS---NRYG.GHQ..........------EVLIQELITATF----.DVL.SNA.MYR.N..E.SA..RNMFVFRS---FLVNKLPPFLAGm.............aaT-.---Sieq..................ipmeMCISHALN.....RV.DP-.--..NA..F..P..SFS.QM..F....E..--....MQGN.TV..L--.-.....-...---.-...SD.VRQEFLFACALHRLIP.ETSIERLLGE.NPM--.--..--.-.--QTLP.V.G..GR..Y.V.K.NDIVAQILSNqgv..................................adrLIS......EIELMEGNAGA......-------................---..-----.---.--....-------.VVA...AVTDVIH....SLCE..Q.K..ETVTLKGICNS..L.-SR...R...PQ.....VLDAM.LLFRS...P.K.SILQPLCTL......LD-SW................K......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQP..........VYDE.FGSILLLVLAFKYRYDL...S..Q.YD...L...GVT...........AS....---....--NSFVLK..LL.D.RGST..------.----..SMKLAGLDAQQNK..NVGAWI.SALF........IA..E.....GISEETM......S.SCSPQEF..YLLVATLFSQTLG.....AC...E...V...........G......KL-....E..........FDT.LKGGFE............Y................L....LEPFLLPS.LVFALKWLGNY......IW.ESS.E.A..D....L.L.....L..--.--....-L.L.KVL..HA.L.V.....K..P.N..S.I...S..GE...........AEACHQ..MVL....NITARSLEEQLKDVRTRL..TG....GRT-DLHSD.IQPS..PHQ--.D...IQH-.....-......--.....-E.IQ.S.LL.DILD.PY...L.S.F...............Q.C............N...GN.SR.rSE..L.--D.......SW.T.TH...A..........D...-..G....ICGVIRVTFQGLi....mWS.ASAQms............mspHTYT..HR..L.ILAGI..RLST...ASNV...LSVLLDEL.KAQAEE--....---.---..--A...S.....GSLDLAIDIA.ATLICVPM.PE.S...F..A...Q.EQ.T...I.YH--P---VD.........T......TKEVF..PRCLLLTLR.....................................QALMVQHQNVPkLAEKDPSRAEVivr......................ltrrVNALLTPPAHVG.................tL----......-..-.....--DVTNI----..-----.-----......----.----.-.-..--.----------------------idnmnleaaaaaaaaggdgldlgngnangntnnlggaanesidqilnnvvtatannndhgneqhdldttgmdtsldd...........................................................................................................................................................................
A0A5C3EWK5_9BASI/517-825               .................................................................................................................................................................................................................................................................................................aitdefpgghklaeevqslsqslrm--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................-DA......QLEGLDIASSL......-ENKLAS................DDL..TELLD.K--.-Vc..rDPGVHHA.FSQ...QLLQQLH....YWLE..A.Q..DYDSVSRCCKA..L.LAN...L...-P.....ALDTL.TLYFD...P.A.ELATMLASL......LD---................-......-......-..........-.......-.......-....R....GD...........V...G.........Q.....A...S...D....-.-...........---..........EPST.LCNILLLLQLVCQRYSV...A..A.DA...V...VPS...........DN....---....-RDSFFAR..FL.R.ASSV..VYR---.----..---LADLAPDERS..LVGRWI.SALF........DN..E.....GISDELT......R.DSSPRAL..LRLAPTLFSQSIN.....AC...N...S...........G......II-....D..........LET.LRGGLS............Y................F....LQDLLSYT.LPAAMRWL---......LQ.EVQ.R.V..P....L.L.....P..LL.SR....--.S.STS..EE.V.L.....L..S.S..G.L...G..RDa.........tSRTVHL..AVV....QL----------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ilg.....................................................................................................................................................................................................................................................
A0A168H770_CORDF/14-953                ...................................................................................................................................................................................................................................................................................................eaakywsefvarciaqrlssdrf--------------------------------------....................----...........................----------...........-------QDFVQLV.....HAK...Hp..lpPV...LVAD..FFLRPQPs....nhVSL...DPR..IPPy..iQILTHLGYVD.....APSILRVLYKY.SALHvydkphadhnge........................................................tkredgeetkqdkTVHW.QDSS.WAEEvLM.Y.H.VI..KN.M.VEGT.......................................................-A..F..T......GA.KA.GL...EL..I..T..ITCKWMDR..F..I.NVSSTI....Aadiltn..........................khdrqgLAEME.AV.R.A.AL....AA.......L....LLR.ML...D..N.H.ALLRiiskp...................fakglrKHLSD.S.LGSFI.P.TL.QP.V.TPA...........fVERLE..IFR...TQTL.A.....................................qLDPP..dK..KKKAana........vmdELL.D.STVG-......---.--Lesfv............ipeiPISN..S..RA..A..L---...YVYLNA.aKLV.GRPVL.DDAMLYAFLN---NKYQ.GNQ..........------QSSAIDLIIASF----.DLL.ANA.VFR.N..E.GP..KDASLLRS---FVVNKLPLLLCQlch..........pefSA.TSAE.........................FCITEALS.....RI.DT-.--..SV..F..P..TAS.LM..F....D..ES....RNNN.PY..M--.-.....-...---.-...DS.VREEFCAACALHGLIE.RDHVDRILGE.TSMS-.--..--.-.-YD--P.S.L..EK..A.N.R.DRLVSDCLSDsgk..................................iqnIIS......QLDKVDGNVGA......-------................---..-----.---.--....-------.VAH...AIVELIR....QLCI..N.K..DTMALKPLCTQ..L.-AQ...K...PQ.....SLDII.LLFEK...I.T.SILEPVCSL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.YGAILLLVFAFTYRYNL...S..P.LD...I...GIQ...........SV....---....--DSHVAK..II.T.KSHI..LRP---.----..---LDELSEQEMG..HVTGWI.NGLFd......nET..G.....GLGDDLM......S.SCPPHEF..YLLVAPIFQSIIT.....AY...T...Y...........G......YI-....N..........DES.LKGGVE............Y................L....VDTFLLPS.LVPAIRFLSDY......IW.VDQ.K.E..-....-.-.....-..--.QK....SI.V.KAL..QL.L.L.....T..P.S..S.I...S..GE...........ASTVLS..SVK....NLIAQPLEHALRTYQRQD..PR....N--------.----..-----.-...----.....-......--.....QD.IE.P.LL.RSLK.EN...I.P.Q...............S.R............R...TG.GA..EH..H.EME.......SW.A.NS...S..........S...N..G....LFGAIRHTMQGLv....qWS.LQPGvn............vmpASYT..HR..Q.FIAGV..RIIG...PSRL...LRLIMEEI.RQQSDL--....---.---..---...-.....GNAPVVYDVA.AALVAATD.ST.N...D..T...-.PP.V...S.SNLLDTAGTM.........Q......SPPQR..PQS----LR.....................................DALKTAAEGYKrLQKQDPFLAE-.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------amvrlhrrvetlmvmpqaqa....................................................................................................................................................................................................................................
A0A0D1Y6N7_9EURO/92-369                ...................................................................................................................................................................................................................................................................................................................tqnalqc--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.-CNQ.TL.Q.D.IT..MV.I.VSNK.......................................................YK..T..N......PS.EA.QA...SL..L..-..LSSRWLAT..L..A.RQASQN....Vap..................................alTVEQS.HV.L.E.SL....AF.......L....VAS.MA...A..T.D.AGLEalslsvdtms.........ntskaasqdlrASLRQ.A.LELCL.P.LY.ST.L.STH............LMDRL..NTV...LKHI.Nl...................................leHGST...Q..PAGS..............SAQ.T.SEIQV.....lQFQ.VSI....................PDTH..M..VA..A..RAAT...IVYLEA..MFT.MGSTI.DDGTLINYLC---SRHQ.NDY..........------QAVSVDLIVSAF----.QIL.KAK.---.S..V.SP..QSPLPYQQCRIFVQNKLPNLLSMvsa..........ssfNS.FDTQ.........................QTITDAW-.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------tqvisq..................................................................................................................................................................................................................................................
A0A423WHK2_9PEZI/57-1002               ........................................vadlflrpaswnkytldprvplymqtlldlkyidapailkalyrystchvlaerqnteqkqdekaadggdkapdqqqqkdgkkevtrwqssfsseevifyrltkavaqgvaiknsrdslevstmmaqwmmlftaasaafppdedvmmggaggarrdkasqqskddmensraafvmlllgvcenhvvlealskppakgvrkalsqslasfvpsimqnasqiaarlelfrtgmlagfepidkkkeadnaemdelldetiglqnvaipdlhvdrsra--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..--GL...YIYLNA..ALV.GRPLI.DDASLYNHLH---NRYQ.GDI..........------QLTAIDLILGSF----.DVL.ANA.IFR.N..E.GQ..KSAHLLRS---YLINKVPLVLAS................FA.ASATpmyp.................fnseLCITNALS.....RV.DT-.--..NT..F..P..TLS.SL..F....E..NG....LSSN.PF..T--.-.....-...---.-...ES.VRSEFVAACCLHGLVP.ETSIDKLIGD.YTY--.--..--.-.--QTLP.A.G..GR..Y.V.K.DTLVQECLADpahe................................rvqrLIG......ELDNMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALTEMLG....RLCT..N.H..ETMSLKTLCSQ..L.-AR...N...PL.....NLDVL.LLFDK...T.T.TILNPLCQL......LD-NW................S......-......-..........-.......-.......-....-....--...........-...Y.........E.....D...D...Q....G.E...........YQP..........VYEE.FGSILLLLVAFVHRYNL...S..A.SD...L...GIR...........SA....---....--DSFVAK..LL.G.KGQL..------.----..SRPVEDLQEQEKN..QLNGWI.HGLFd......tDG..G.....GLTDELL......S.SCPPQDL..YLLIPTLFHNIVL.....AF...S...T...........G......YL-....T..........EES.LKTGIE............Y................L....VEPFLLPC.LVTAMIYLSN-......--.CLW.T.D..R....P.E.....E..--.NK....AI.I.KIL..QL.I.L.....K..P.S.qK.M...S..QE...........SSDMLN..SVK....NIVAKPLENGLRTYQRQN..PK....S--------.----..-----.-...----.....-......--.....QD.VE.P.LL.QVLK.DN...I.E.L...............S.R............R...TG.AA..GD..K.ELE.......QW.T.SS...G..........S...V..G....LTTAIKHTVQTLt....mWS.LHPGv..............mpMPYA..HR..Q.VLVGL..RLLG...AKRL...LQAILEEL.KQLTET--....---.---..---...-.....GNGSTAYDVA.IGLVCAPD.VT.T...T..S...D.NA.A...P.SI-LD---EA.........G......HAPAA..PQQRRLTLR.....................................EALRWKAEGWKkIQKHDPAMAET.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------vvrlyqkveaqmapaaiaiaplahggadeeamnamvddvaa...............................................................................................................................................................................................................
A0A317XNT7_9BASI/581-850               ....................................................................................................................................................................................................................................................................asevqslpqslqmdaqlegltlaalfesrfssgedpvellhrvasdpgtlftfs--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.--Q...QLTLQLQ....SWLD..V.H..DFDSISRWCKA..L.PED...L...-A.....SLDTI.MVYID...P.V.QMVHPLASL......LD-RQ................D......-......-..........-.......-.......-....-....--...........L...-.........-.....-...D...Q....-.-...........ASD..........EPST.LGSILLFLQLLCHRYNV...G..P.DR...I...VSA...........NN....---....GAPCFFAE..YL.S.TASA..CHT---.----..---LSDLSEDDRA..LVGRWI.HALF........GN..E.....GISDDLI......Q.ASSPKTL..LKLSPLLFSQSIT.....AC...I...Y...........G......VI-....D..........LET.LRGGLS............Y................F....LQDLLSYA.LPGALNWL---......LR.E--.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------vlrvplipildllss.........................................................................................................................................................................................................................................
A0A1Y1UM03_9TREE/574-700               ................................................................................................................................................................................................................................................................................................................ppellrdarr--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..SLNLPSMDEMQKS..CVNGWV.KALF........GP..D.....GIDDQVL......L.VTSPADF..YRLAPSLIQQAIT.....AT...A...A...........G......ML-....D..........LPT.LHSGLS............Y................F....SQSLLSWS.LGGITDWL---......CT.EIV.R.N..G....H.L.....S..-A.LH....--.L.NVL..QN.L.V.....C..S.G..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------alp.....................................................................................................................................................................................................................................................
A0A3N4JKV3_9PEZI/221-857               ................................................................................................................................................................................................................................................fqtslslfmqyiqvqnptlaarmdalfrhqqnqspqqnrnsrnakgaetidgmmmgigdgadndgpvvwarggl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...FVWLSG..LLA.GRPQV.DDEAVIGYLY---SRYR.NDI..........------NTLLVDFVTAVL----.DVL.SNA.ILR.N..E.AA..STLFLLRS---FLTNKVPILLSR................LS.-PSPmt.....................asYALSQALL.....RT.DAS.TL.aNP..P..P.sSFD.PY..S....H..-N....TSTN.PD..M--.-.....L...FNT.L...VD.LRQEFLFACALHGVVG.EEDIQGIIGE.LPL--.--..--.-.--GALP.V.A..GR..Y.D.V.GDLMNQCAMDpdr..................................verLLE......EIEGVEGNSGA......-------................---..-----.---.--....-------.VVR...TVVEIMR....NMCE..Q.K..ETMPLRSICSF..L.-AR...K...TS.....SLDVM.LLFVK...P.V.YLLEPLCEL......LD-TW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.FGYILLLVLTLIHRYDI...Q..V.TD...L...TSS...........ST....--P....NTDSFIPQ..LL.S.KGST..SQR---.IENF..E------SSDKHA..QLGGWI.REIF........EG..E.....GISDGLM......S.SCRPQDF..YRLVPTLFMQSVM.....AC...E...R...........G......VL-....D..........IDT.LKEGFA............F................L....LEPFLLPS.LVGGLGWLGNH......LW.ESH.E.D..I....S.I.....P..--.--....--.V.QIL..HS.L.L.....V..P.S..S.I...S..PD...........ASEVHK..TVI....SISARQLERILRELVRRG..TA....G--------.-SRQ..SVVEG.L...VANL.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------qpytsfkrngaatrdelenwthhagggglmqslglafqslvnwstsqgdinivrpsatythrlilatwrvlgarntvrgiigevvk..................................................................................................................................................................
A0A117DX34_ASPNG/2-984                 .........................................................................................................................................................................................................................................................................................................................t-SSEQWGTFLQQCLLHRIDAAEFKNLTRLLMQRYPIG-....................----...........................----------...........--------------.....---...-.....EA...QLLD..VLLETRLa....tgIKW...DPLppLYI....DCLCKMGLVR.....TSTMLNSLLKH.SSIHdkmpsaggseana......................................................aaaaavqgkqkrkcYTLM.TDIR.VVQD.AM.L.S.VS..TG.T.ASKT.......................................................--..-..-......-F.AE.AL...SI..F..A..SIVDWIQA..V..V.AWHNSH....Ldtshq...........................tgglmsSPDAV.SL.F.E.SL....GI.......L....LAA.LS...G..T.A.KGLEvlsad...................shealkIKLGQ.A.LSAYL.P.LC.VE.-.---............VSLPL..RNR...LDSL.Qkefnlfgepps...............kaldvsmmenvnVNAL...Q..FEDSvm..........dgPVI.N.SRAGL......---.---....................----..-..--..-..----...YVYINA..MLV.GRPLV.DDSMLLNFLS---NRYG.GHY..........------QVLIEELITASF----.DVL.SNA.SYR.N..E.SS..RTMFLFRS---FLVNKLPTFIA-................AM.LAASivsl................plpmeLCISHALS.....RL.DP-.--..NT..F..P..SFS.QM..F....A..--....MQSN.TV..L--.-.....-...---.-...SD.VRQEFLFACASHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTLP.V.G..GP..Y.N.K.DELVSQINANper..................................aeqLIN......EIESMEGNAGA......-------................---..-----.---.--....-------.IVG...AITDVMH....HLCN..Q.K..ETMTLKNICNS..L.-SR...R...PQ.....ALDVI.LLFRS...L.K.QVLQPLCAL......LD-AW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQP..........VYDE.FGSILLLVLTFKFRYDL...R..P.QD...M...GIG...........GS....---....--NSFVLR..LL.E.NGFC..------.----..SQKLDDLSEKQNK..NLGSWI.NALF........MA..E.....GISEETM......S.ACSPQEF..YMLVTTLFNQSLS.....AC...E...A...........G......KL-....D..........FDT.LKGGFE............Y................L....LEPFLLPS.LILALNWLGNH......IW.ESE.S.D..P....S.I.....P..--.--....--.L.KAL..HS.L.I.....S..P.S..S.I...S..GE...........AKEIHR..TVL....NITARSLEEQLKSIRSRQ..PD....D--------.----..-----.-...----.....-......--.....-T.IK.P.IL.EALE.PH...L.S.F...............Q.R............S...GS.TR.rSE..L.--E.......SW.T.AH...T..........P...G..G....LLASIRSTFQSLi....lWS.TSPDms............mapQSYT..HR..Q.FIAGI..HIQG...SMRV...LCALIDEL.KLQATT--....---.-SP..TNT...T.....GSSDLALDIA.ATMICAPL.AD.S...F..A...V.DQ.N...T.YSPHHIDPTN.........T......TKEIP..PRNPILTPR.....................................GALYQLHDSVPkICEKDPLRAEIivr......................lwrrVNAALTPPSQLD..................--MNN......-..-.....------II---..-----.-----......----.----.-.-..--.----------------------qnmqlgvgvggpgqmdldtsgaggheeestinqmldnav.................................................................................................................................................................................................................
A0A3M2TCB5_9EURO/2-947                 .........................................................................................................................................................................................................................................................................................................................a-SSEQWRTFLRQCLMNRIDVDEFRDLSKLLSARCPIP-....................----...........................----------...........--------------.....---...-.....ES...ALLD..ALLESQDa....tgVKW...DPLppLYI....DVLSKTGRVK.....ASTVLGSLLKH.SSVCdkppsele.................................................................hqpqkrkrYTLM.TDVK.VVQD.VM.L.S.VS..TG.S.IPRS.......................................................--..-..-......-V.TE.AA...GL..L..S..AVADWIQA..V..L.AWNSSR....Vddvhq............................dglmgSPDAA.SL.F.E.SL....GI.......L....LAV.LA...G..A.G.KGMEvlsad...................shqalrIKLGQ.A.LSAYL.P.VC.VQ.-.---............VSLPL..RNR...LDSL.Qkelnltgepas................ksldsmmdsvnVNAL...Q..FEATvm..........daPVI.N.SRAGL......---.---....................----..-..--..-..----...------..YLV.GRPLV.DDSMMINYLT---NRYA.GHY..........------EVLIEEIITAAF----.DVL.SNA.MYR.N..E.SS..RTMFLFRS---FLVNKLPCFFA-................AM.SAVAmvp..................lpmeMCISNALN.....RL.DP-.--..NT..F..P..SFS.QM..F....S..--....MQGN.SV..L--.-.....-...---.-...SD.VRQEFLFACASHRLIP.ESSVERLLGE.NPM--.--..--.-.--QTLP.V.G..GP..Y.A.K.DDLASQINSKher..................................aeqLIG......EIEAMEGNAGA......-------................---..-----.---.--....-------.IVG...AITDVIH....HLCS..H.K..ESVTLKSICNA..L.-SR...R...PQ.....ALDVI.LLFRS...T.R.QFLQPLCVL......LD-SW................R......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........NQP..........VYDE.FGSILLLVLAFKHRYDL...R..P.YD...L...GIS...........RS....---....--DSFILK..LL.D.SGPC..------.----..SQKLEDLNEKQNK..NLGTWI.GALF........IA..E.....GISEETM......S.TCSPQEF..YLLVTTLFNQSLS.....AC...A...A...........G......KL-....E..........FDT.LKGGFE............Y................L....LEPFLLPS.LVIALGWLGNR......IW.ESE.S.D..P....T.I.....P..--.--....--.L.KTL..HS.L.V.....S..P.S..S.I...S..GE...........AEAMHR..TVL....NITARGLEEQLKDLRTRH.pSR....T--------.----..-----.-...----.....-......--.....-D.IK.P.IV.GALE.PY...L.S.F...............Q.R............T...GN.CH.rSE..L.--E.......NW.T.-T...S..........S...G..G....LLGSLRSTFQSLv....lWS.QNPEis............mapHSYT..HR..Q.ILAGI..RMLG...SARV...LAALVEEA.KVLTDA--....---.---..---...-.....GSGALALDIA.ATMVCAPM.TE.S...-..-...F.AV.D...Q.NAYHP---VD.........P......NKEAP..PQTPILTLR.....................................DALTLQHENVPkIAEKDPLRAEVlvr......................lsrrVNALAAPSAHVH..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------nldvgsivqnmqlgveshgqmeleqpsagaaapaadvpn.................................................................................................................................................................................................................
A0A4P6XP58_9ASCO/173-972               .................................................................................................................................kevlakvsratraagdsnmtayvtrkfisttdisasnghekvietehstafktsnfsplnldnkrfanyvalkkfiwlsnhfrlwkantdlvrafinffrlhdlkhaelakeltnsflhgysaavklrerpyvvfnwknfiltdfahdlknlahafrvdhewedaiitsvasctdttvlltkvgg--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...ATE.S...YD.LGREFTRACVYQGV--.-VSLEKFTDA.YPAI-.-S..AL.T.LAQAIT.H.E..--..I.E.I.MSQVDTIDAD........................................FTT......KLYNMDPAFT-......---SFEE................SKL..VDYSR.NLL.SSdlrfLKAKQQR.LAS...VTCDLID....KLIQ..E.K..HNEKLSWVALL..L.-LN...V...PA.....IANYI.FYQGS...P.W.NVLNKFINY......ID---................-......-......-..........-.......-.......-....N....ET...........F..nV.........D.....D...D...D....G.N...........FQD..........TYTC.FGVMLTGVVSLASLFGI...N..F.AE...I...SIQ...........SS...yTLD....YINEFYFR..LS.D.PLTS..---NYAgIDEQ..---EKQIIASYDR..LFTEWA.KALFd......vNN..D.....GLTDELL......K.SVNVKQI..YKFVYLLFREAFT.....AR...V...V...........G......SL-....N..........ETS.LNNGID............Y................L....SQSFLAPC.SLEAMQWL---......IS.RVGpQ.Q..K....T.S.....N..TM.IE....IL.L.RILetNT.G.I.....A..S.S..L.N...T..SE...........HNYTFR..MIL....NIVGPSIVRKIRSFGNM-..--....---------.----..-----.-...----.....-......--.....-I.SE.N.MQ.KLMN.KI...L.Q.E...............T.D............A...EY.CQ..WN..I.LAD.......E-.-.QT...N..........G...H..V....STNSIKNEITSF......--.LKES.................EAMM..SD..S.LIEAW..ARMKhkwDSVP...SEAICYTL.LEEVEHS-....-AG.TRG..SVI...M.....EESKLVVDFY.LFMLTCSG.AP.D...A..D...DvDS.Y...L.VALNSSRKSE.........S......LM---..---------.....................................TKAGSQF-ALTiNDHYSSVFNESgpd......................pigtS-----NGDD--..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------srpqeeplggygmsdlfddmsenlfdelmalfnkqadmttgqksptenqpldcqasymkmmrr.........................................................................................................................................................................................
A0A395RZ90_FUSSP/15-955                .....................................................................................................................................................................................................................................................................................ieywcqfvarcvserletdkfeayvkivhdqhplppt--------------------------------------....................----...........................----------...........--------------.....---...-.....--...LVAD..FFLRPQPs....ddSSL...DPR..IPPy..lQALTKLGYVD.....TPSILRALYKY.SSSHahaqaqkehlqsnteegkgkekekgnqdd.......................egkveekedaqskknitrwknsywaeevlFYRL.TKSV.VEGR.AI.Q.D.--..--.-.----.......................................................--..-..-......-S.RT.AL...EV..A..M..IISKFMEL..F..T.TALPAT....Afaadmle.......................qqfpsgqlRDEME.SS.R.A.AL....VA.......L....LLR.LC...E..N.N.ILVSaiskp...................faknvrKALST.S.LASFL.P.AL.QL.V.PEI............ADKLE..LFR...TEIL.A......................................SSDPa.dK..KKQV..............ANA.A.MDELL......DST.VGLen...............fvvAPIS..I..SN..T..RAGL...YIYLNA..ALI.GRPIL.DDHALFSYMS---NKYG.ADI..........------QSSAIDLILASF----.DIL.ANA.VFR.N..E.GQ..KDAHLLRS---FLINKLPLLLYQllp..........pgfSG.TSAE.........................FCITEALT.....HV.DT-.--..SL..F..P..TAS.LM..F....D..ES....RNNN.PY..T--.-.....-...---.-...ES.IREEFCAACVLHGLVQ.REHVERILGE.ISL--.--..--.S.YEPSLQ.KhS..KD..K.L.V.QDCLSDTDKIq......................................gLVR......ELDKTDGNVGA......-------................---..-----.---.--....-------.VCQ...ALVEVLR....QSCH..N.K..ETMSLKLLCSQ..L.-AA...K...PQ.....SLDVI.LLFEK...L.P.NILEPLCQL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.FGAVLLLVFAFTYRYNL...N..A.VD...I...GIT...........TP....---....--DSWVAK..II.A.RGHI..------.----..GRQGDELTQRENE..HINGWV.HGLFd......tEA..G.....GLGDELM......S.SCPPQEF..YLIVAPLFQSIVV.....AY...T...H...........G......YL-....N..........DES.LKGGIE............Y................L....VDTFLLPS.LVPAIRFLADY......LW.IDQ.K.E..-....-.-.....-..--.QK....SI.I.KIL..QL.I.L.....L..P.S..S.I...S..GE...........ASTMLS..SVK....NLIAKPLEHALRTYQRRD.pKN....Q--------.----..-----.-...----.....-......--.....-D.IE.P.LL.RTLK.ES...I.P.L..............sR.R............T...GG.TD.lNE..L.--E.......SW.T.AT...P..........P...S..G....LSSAVKLTIQALv....hWS.IHPAmn............smpTSYT..HR..Q.ILVGL..KMLG...PKRL...LHVILEEV.RQHTAA--....---.---..---...-.....GSANIIYDVA.TSLICAPD.AV.K...D..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------apvtgmldangnmlppiqrprslrdllkvevescrklqkedpvlaehvvrl.....................................................................................................................................................................................................
A0A2T3B2R4_AMORE/294-961               ..................................................................................................................................................................................................................................................................................................................tmnsragl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...YIYLNA..LLV.GRPLI.DDNALFAYLH---NRYQ.GDV..........------QSTSIDLILASF----.DIL.ANA.KLH.N..E.RA..QTTTILRS---FLINKVPLLLTT................-L.SASFfpp..................ltaeYCITEALN.....HV.DT-.--..NV..F..P..TLS.TL..F....D..ES....--SS.ND..MFS.D.....S...---.-...--.VRQDFCFACCLHGLLE.ESSIETLLGD.IPM--.--..--.-.--QSLP.A.G..GR..Y.V.K.EELVQQCLSDpek..................................vegMID......ELEHMDGNVGA......-------................---..-----.---.--....-------.VSQ...AITEIIG....RLCS..N.K..ETMTLKTICSL..L.-AR...K...SS.....TLDIM.LLFDK...P.I.TILQPICDL......LD-NW................H......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....V.E...........YQP..........VYEE.FGAILLLVLSFVHRYNL...S..T.AD...L...GIR...........SS....---....--SSFVAK..LL.N.QGQL..------.----..SRAMENLTEQEQN..HLDGWI.RGLFd......hES..G.....GLGDELM......S.SCPPQDF..HLLVPTLFHHIAL.....AC...S...T...........N......YL-....S..........DET.LKGGLE............L................F....VEPFLLPS.LIPAITWLASH......LW.ESR.G.D..-....-.-.....-..--.AN....AV.L.QIL..SA.L.V....tN..S.A..S.I...S..NNi.........eASQMLN..SVI....NIIAKNLEHSLRWLQRAE.pQR....Q--------.----..-----.-...----.....-......--.....-D.IE.P.LS.KALR.GN...L.G.W...............E.R............R...GA.SD.hTE..L.--E.......SW.T.ST...P..........G...G..G....LTVAIKNTISGLv....hWG.LNPGmn............inpANYT..HR..Q.ILVGL..KLLG...ARRL...LHTIIDEV.KAQTEA--....---.---..---...-.....GNGPAVLDVA.TAIICAPD.AA.T...W..E...S.-S.A...A.AG-LEQLLGS.........G......TAAVR..-PQRRMSLR.....................................EALKMEAEQAPrTYKQDVFQAET.............................V-----------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------vrlyrrveaqavvpvggasmqdameverelm.........................................................................................................................................................................................................................
A0A1B8DFP2_9PEZI/21-756                ............................................................leqfakvlstksplatpliaelllrpsesrnydldpqvslyvqallridildvpsvlrallrhstsrpvdatkeeqevasgsqtrwtksygheerlvyglskivaagdrpksaqealgtanaltewmrllvmsnaaddmmreigagnvthnqetmavrvavgallvalaenatvndalknrcpkdtlkgfsqslanftpllingssmfaerlelytktlvalepmdkkaqkagaeidqiidsamalgmdnipvv--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................EIPT..M..NS..R..A-GL...YVYLNS..LLT.GRPMV.DDNQLLNFLH---NRYQ.GDI..........------QTTCIDLIVSSF----.DIL.ANA.IFR.S..E.SP..QTTFLLRS---FLINKVPLLIS-................-M.ISAPmfpp.................lspeLCITEALS.....HV.DT-.--..NA..F..P..TFS.SM..F....D..DT....--SA.GD..MFS.D.....S...---.-...--.VRQDFCFSCCLHGLIP.EESIERLLGE.IPM--.--..--.-.--QTLP.A.G..GR..Y.T.K.DEVLEQCLSDsek..................................ieaFTD......ELEHMDGNVGA......-------................---..-----.---.--....-------.VSQ...AITELLR....RLCE..S.K..DTMALKSLCAH..L.-AR...K...PS.....SLDVL.LIFDK...P.L.TILPPICQL......LD-AW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...D...Q....G.E...........YQP..........VYEE.FGSILLLVLAFVYRYDL...S..A.TE...L...GVQ...........TP....---....--DSFIAK..LL.V.RGST..------.----..ARLLDDLSSVESS..QLDGWI.KGLFn......aEG..G.....GLGDEPM......A.LCPPQDF..YLLVPTLFSQIVL.....AS...Q...H...........G......HLT....D..........-DV.LRGGLE............Y................L....LDPSLLPS.LIPALLSL---......AS.NIL.T.A..P....P.P.....S..--.--....--.-.SLL..QA.L.I.....L..P.Q..S.I...S..AE...........ASLLHN..AIL....PIPAPHLSRSLRALQRSV.pTR....T--------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------dldpliaalrphlhfsrs......................................................................................................................................................................................................................................
A0A1L9UIC4_ASPBC/2-987                 .........................................................................................................................................................................................................................................................................................................................t-SSEQWGTFLQQCLLHRIDAAEFKNLTRLLMQRYPIA-....................----...........................----------...........--------------.....---...-.....EG...PLLD..VLLETRLa....tgIKW...DPLppLYI....DCLCKMGLVR.....TSTMLNSLLKH.SSIHdkmqpspgsap..........................................................eaavqgkqkrkcYTLM.TDIR.VVQD.AM.L.S.VS..TG.T.ASRT.......................................................--..-..-......-F.AE.AL...SI..F..A..SIVDWIQA..V..V.AWHSSH....Ldtshq...........................tgglmsSPDAV.SL.F.E.SL....GI.......L....LAA.LS...G..T.A.KGLEvlsad...................shealkIKLGQ.A.LSAYL.P.LC.VE.-.---............VSLPL..RNR...LDSL.Qkefnlfgesps...............kaldvsmmenvnVNAL...Q..FEDSvm..........dgPVI.N.SRAGL......---.---....................----..-..--..-..----...YVYINA..MLV.GRPLV.DDSMLLNFLS---NRYG.GHY..........------RVLIEELITASF----.DVL.SNA.SYR.N..E.SS..RSMFLFRS---FLVNKLPTFIAA................-M.LAASmvs..................lpmeICISHALS.....RL.DP-.--..NT..F..P..SFS.QM..F....A..--....MQSN.TV..L--.-.....-...---.-...SD.VRQEFLFACASHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTLP.V.G..GP..Y.N.K.DELVSQINANper..................................aeqLIN......EIESMEGNAGA......-------................---..-----.---.--....-------.IVG...AITEVMH....HLCN..Q.K..ETMTLKNICNS..L.-SR...R...PQ.....ALDVI.LLFRN...L.K.QVLQPLCAL......LD-AW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQP..........VYDE.FGSILLLVLTFKFRYDL...R..P.QD...M...GIG...........GS....---....--NSFVLR..LL.E.NGFC..------.----..SQKLDDLSEKQNK..NLGSWI.NALF........MA..E.....GISEETM......S.ACSPQEF..YLLVSTLFNQSLG.....AC...E...A...........G......KL-....D..........FDT.LKGGFE............Y................L....LEPFLLPS.LILALNWLGNH......IW.ESE.S.D..P....S.I.....P..--.--....--.L.KTL..QS.L.I.....S..P.S..S.I...S..GE...........AKEIHR..TVL....NITARSLEEQLKSIRARQ..PD....D--------.----..-----.-...----.....-......--.....-T.IK.P.IL.EALE.PY...L.S.F...............Q.R............S...GS.TH.rSE..L.--E.......SW.T.AH...T..........P...G..G....LLSSIRNTFQSLi....lWS.TSPDms............mapQSYT..HR..Q.LIAGI..HIQG...SMRV...LCALIDEL.KLQATT--....---.-SS..AAT...T.....GSSDLALDIA.ATMICAPL.AE.S...F..A...V.DQ.N...T.YSPHHHHMDP.........T......NKDPP..PRNPLLTLR.....................................GALYQLHESVPkISEKDPLRAEIivr......................lwrrVNAALTPPSQVP..................-----......-..-.....NLDMNNIIQNM..QLGV-.GVGVGg...pgQMDL.DTSG.-.-..-A.AAHDEEEENTINQMLDNAV---aa......................................................................................................................................................................................................................................................
A0A0A2VHG7_BEABA/718-925               .........................................................................................................................................................................................................................................................irffsisgeastvlsavknliaqplehalrtyqrqdprnqdiepllrslkenlplsrrtggpehh--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.EMV.......SW.A.NN...S..........N...S..G....LSGAIRHTMQGLv....qWS.LQPGvn............vmpTSYT..HR..Q.LITGL..RIIG...PSRL...LRLIMEEI.RQQSEL--....---.---..---...-.....GNASIVYDVA.AALIAATD.PT.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------neappgpnlldtagtmqatpppqrpqglrealktaaegckrlqkhdqflaea....................................................................................................................................................................................................
G8BG32_CANPC/302-608                   ...........................................................................................................................................................................................................................................................................................................lrdllntdpeltsfd--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......------E................SGL..VDYIA.ELS.K-....-RGSQEK.VTE...TVLDSMR....EFIR..T.K..QLEKLNRILLA..L.MSN...I...--.....EMINI.ILFHT...N.M.SLLHILIDY......VD--F................E......-......-..........-.......-.......-....-....-T...........F...T.........T.....G...S...D....D.D...........FQD..........VYSY.CSVCVLSILLIIEVFQI...D..L.SK...I...EIN...........SY....SVG....FVNNFFYR..LG.D.NLTN..NTP---.-LEK..DEDDLTIIGNYNN..LVTEWI.NALFd......dSN..D.....GLSDELM......K.SLSIKQI..YKLMPVIYKQAIV.....AR...K...L...........G......KI-....N..........NAI.LSNGLD............Y................L....SQPFLFPV.ISCLVKWM---......--.--A.R.D..S....T.D.....T..EL.YK....--.-.EVM..LE.L.V.....K..P.N..I.G...-..QS...........TNPMSY..AIL....NICGNDVLKLVDDYRI--..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------rkvihyrg................................................................................................................................................................................................................................................
A2QHS8_ASPNC/2-631                     .........................................................................................................................................................................................................................................................................................................................t-SSEQWGTFLQQCLLHRIDAAEFKNLTRLLMQRYPIA-....................----...........................----------...........--------------.....---...-.....EA...QLLD..VLLETRLa....tgIKW...DPLppLYI....DCLCKMGLVR.....TSTMLNSLLKH.SSIHdklqspggse.............................................................avqgkqkrkcYTLM.TDIR.VVQD.AM.L.S.VS..TG.T.AFKT.......................................................--..-..-......-F.AE.AL...SI..F..A..SIVDWIQA..V..V.AWHNSH....Ldtshq...........................tgglmsSPDAV.SL.F.E.SL....GI.......L....LAA.LS...G..T.A.KGLEvlsad...................shealkIKLGQ.A.LSAYL.P.LC.VE.-.---............VSLPL..RNR...LDSL.Qkefnlfgepps...............kaldvsmmenvnVNAL...Q..FEDSvm..........dgPVI.N.SRAGL......---.---....................----..-..--..-..----...YVYINA..MLV.GRPLV.DDSMLLNFLS---NRYG.GHY..........------QVLIEELITASF----.DVL.SNA.SYR.N..E.SS..RTMFLFRS---FLVNKLPTFIA-................AM.LAASivsl................plpmeLCISHALS.....RL.DP-.--..NT..F..P..SFS.QM..F....A..--....MQSN.TV..L--.-.....-...---.-...SD.VRQEFLFACASHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTLP.V.G..GP..Y.N.K.DDLVSQINANper..................................aeqLIN......EIESMEGNAGA......-------................---..-----.---.--....-------.IVG...AITEVMH....HLCN..Q.K..ETMTLKNICNS..L.-SR...R...PQ.....ALDVI.LLFRS...L.K.QVLQPLCAL......LD-AW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQP..........VYDE.FGSILLLVLTFKFRYDL...R..P.QD...M...GIG...........GS....---....--NSFVLR..LL.E.NGFC..------.----..SQKLDDLSEKQNK..NLGSWI.NALF........MA..E.....GISEETM......A.ASNV---..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------spapl...................................................................................................................................................................................................................................................
S0DSP8_GIBF5/35-887                    .........................................................................................................................................................................................................................................................................................fenyvrlvhdqhplppalvadfflrpqpsndns--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......--L...DPR..IPPy..lQVLTRLGYVD.....APSILKALYKY.SSLHayaqqpnahegreneken............................................gksddkekdenqqkitrwkSSYW.AEEV.LFYG.IT.K.S.--..--.-.---Vvegka.............................................irdskTA..L..D......MT.RI.IS...KL..M..V..LFTTAFAA.dM.iE.QLHTAQ....V......................................RDEME.SS.R.A.AL....VA.......L....LLR.MC...E..N.D.ILVGalv.......................pqitD----.-.--KLE.Q.FR.TE.-.ILA............CSDPA..DKK...KQAT.Naamde............................lldsaVGLD...N..FVVAd............iPVS.N.TRAGL......---.---....................----..-..--..-..----...YIYLNA..ALI.ARPLL.DDHALFSYMS---NKYQ.GDI..........------QSSAIDLILASF----.DIL.ANA.VFR.N..E.GQ..KDAHLLRS---FLINKIPILLYQllp..........pgfPG.TSAE.........................FCITEALS.....HV.DT-.--..SL..F..P..TAS.LM..F....D..ES....RNNN.PY..T--.-.....-...---.-...ES.IREEFCAACVLHGLVQ.REHVERILGE.ISL--.--..--.S.YEPSLQ.KhS..KD..K.L.V.QDCLSDTEKIq......................................gLVR......ELDKMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALVEVLR....QSCH..N.K..ETMSLKVLCSQ..L.-AA...K...PQ.....SLDVI.LLFEK...L.P.NILEPLCQL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....D...D...Q....E.E...........YQP..........VYEE.FGAVLLLVLAFTYRYNL...N..A.VD...I...GIA...........SP....---....--DSWVAK..II.G.RGHI..------.----..GRQCNELTQREND..HLNGWI.HGLFd......tEA..G.....GLGDELM......S.SCPPQEF..YLVVAPLFQSIVV.....AY...T...H...........G......YL-....N..........DES.LKGGIE............Y................Y....L-------.------WI---......--.---.-.D..Q....K.E.....Q..--.-K....SI.I.KIL..QL.I.L.....L..P.S..S.I...S..GE...........ASTMLS..SVK....NLIAKPLEHALRTYQRRD..PQ....N--------.----..QDIEP.L...LR--.....-......--.....--.--.T.LR.DSIP.LS...R.-.-...............-.R............T...GG.TD.lNE..L.--E.......SW.T.VT...P..........P...T..G....LSSAIKLTTQGLv....hWS.MHPAmn............smpTSYT..HR..Q.ILAAL..KIMG...PKRV...LHVILEEI.RQHTET--....---.---..---...-.....GSASIVYDVA.ISLICAPD.AA.K...-..-...D.AP.A...V.VD--------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------angnmlpsvqrqrslrdllkveaegcrklqkkdpalaei.................................................................................................................................................................................................................
A0A0D7AH31_9AGAR/408-666               ...........................................................................................................................................................................................................lrfmsltnaldvdafgnlcrllclsdvlldilslhvkisslvraalvfledydcetvgdpqsafthlgdimlfiqsvvvrfhvrvtmsadflrythiprrvedipapdlas--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..-YNAWY.KALFd......sNS..D.....GIEDNLL......R.TTNPKIL..LGLAVTLFSHAIE.....AA...S...S...........Hd....sKV-....D..........IEV.LKNGVS............Y................F....NGPLLNWT.LVGVVRGL---......LE.DVH.R.R..S....L.N.....A..-P.LH....--.L.EIL..QS.L.V.....S..E.S..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------cprpvlrlcgpailatlhalakegrasaafntsfealyskvigv............................................................................................................................................................................................................
A0A2J6QSN4_9HELO/11-956                ...........................................................................................................................................................................................................................................................................................................fsrslatrletssfe--------------------------------------....................----...........................----------...........--------SFVQLL.....STK...H.....PLsasRISE..LFLRPTEn....naVSL...DPR..VVRy..vQVLLGLELVT.....VPSVLRALWKV.SSFRdqaghddgleknavgee...............................................ngaivptkakeegkrwsNSYT.AEET.LFLR.LT.K.Y.IS..AG.T.APHN.......................................................--..-..-......-T.QE.AV...EL..V..M..VCVQWMRT..V..I.SVISVQ....Haaqeml..........................glaqthAAEMA.SQ.N.M.AL....AT.......L....VSA.VV...E..N.G.RVLHalgkgs..................vpkpvrKELKD.A.LANFV.P.LI.IQ.S.SPQ............AARAL..EIF...-RTQ.Tilaie...........................pfdkkeR---...-..----..............--A.A.DKEIEei.ledN--.--Mvven............mvvaDMPT..M..N-..T..RAGL...YVYLNS..LLV.GRPLI.DDHAIFSYLN---NRYQ.GDI..........------QSTIIDLILAAF----.DIL.ANA.TFR.N..E.RA..AFITILRS---FLINKIPLLLAT................-L.SASLfpp..................ltseYCITEALS.....HV.DT-.--..NA..F..P..TLS.GM..F....D..EL....-STN.NM..L--.-.....-...---.S...DS.VRQDFCFACCLHGLIA.ESSIETLLGD.VPM--.--..--.-.--QSLP.A.G..GR..Y.M.K.DELVQQCLSDper..................................tegLID......ELEHMDGNVGA......-------................---..-----.---.--....-------.VSQ...AITEVIT....RLCA..N.K..ETMSLKSLCSQ..L.-AR...K...PL.....ALDVM.LLFDK...P.T.SILQPLVEL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGLILLLVLSFTHRYGL...T..V.VD...L...GIR...........AQ....---....--DSFVAK..LL.N.QGHL..------.----..SRAMEELTEQEQS..HLDGWI.RGLF........EV..G.....TLGDELM......S.SCPPQDF..YLLVPTLFHHIVL.....AC...S...T...........K......NLT....D..........-EG.LKSGLE............Y................L....VEPFLIPS.LIPGITWLSSH......LW.ESR.G.D..-....-.-.....-..--.AS....AC.I.AIL..TA.L.I.....T..N.S..S.S...N..TE...........ASQMLT..AIL....NIVAKNLEHSLRWLQRAE.pTR....Q--------.----..-----.-...----.....-......--.....-D.VE.P.LS.KALR.PS...L.G.W...............E.R............R...GA.SD.hTE..L.--E.......TW.T.SS...P..........S...G..G....FVVAIKQTMANLv....qWG.LNPGin............inpANYT..HR..Q.ILVGV..KMLG...AKRI...LNTIIEEV.KSQTET--....---.---..---...-.....GNGSIILDVA.SALICAPD.PQ.S...W..D...N.GA.P...G.IDVLG-----.........-......-TEPR..PLQRRMNLR.....................................EALKNEAAAAPkLHKTDTLHAETvvrl.....................yrkvE-----------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------aqllmpqqtlmshdaldihqaldsaa..............................................................................................................................................................................................................................
A0A0G4MNN8_9PEZI/14-840                lsrwqkfianslakrldperfesyapilyskhplpxpiclvsplnedlpqmvegvfseqidlqiqattkfrkllskernxdpripqylqslsklryidipsvlkglyrystshtqahpadgqapegdgeatrlirwgssygseevmfyrltkavaqgaaiqnaavaleiakimskwmtlftdastafavdpmgqmqanqardemdcaraafvalllgvcenqvvlkalsrpqaaaarkamseglatfvptimhnagpvttrldhfrtrilasfepaeagkplaapeldqlfdsgvelnnfvipelpvansragl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...YIYLNA..ALV.GRPLI.DDTAIFNYLN---NRYQ.GDV..........------QSTTIDLILASF----.DVL.ANA.VFR.N..E.GN..KAAHMLRS---YLMNKLPILISN................-L.SKHMypp..................ltaeYCITEALS.....HV.DT-.--..NA..F..P..TLS.SM..F....D..ES....RNNN.PY..T--.-.....-...---.-...DS.VREEFCWACCLHGLLR.ESSIETILGE.TPY--.-Q..SL.P.SRGRYV.K.D..--..-.-.-.-TLVAECLDDper..................................mqaLVK......ELDNMDGNVGA......-------................---..-----.---.--....-------.VCH...ALTEVLA....QLCR..N.K..ETMSLKNLCSQ..L.-SR...R...PL.....SLDVI.LLFEK...P.T.AILQPLCDL......LD-DW................K......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSVLLLLLAFTYRYNL...T..A.SD...I...GAR...........SP....---....--DSFVAK..FL.S.QGHL..------.----..SRSSEELSDLEKS..HLGGWI.HGLFd......qEA..G.....GLTDDLI......S.SCPPQEF..YLLIPTLFQNVMT.....AF...A...T...........G......HL-....S..........EES.LKGGVE............Y................L....VDTFLLPS.LVTAITYLANS......LW.VER.H.N..Q....-.-.....-..--.-N....TI.I.RVL..HL.V.L.....Q..P.S..A.I...S..EE...........AKTMLS..SVL....NIVAKPLEHSLRASQRQD..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------pkdqkidlllsvlkdniplsrrtggadhneletwtstqgeglatalrhtmqgfvqwsxxx............................................................................................................................................................................................
A0A074RVP2_9AGAM/473-688               ........................................................................................................................................................................................................................leslahlsrllythsdvldiigqrvpptefvaaglafledvegagvgdpqsalgqygdvllllqllvtryelksgtlkhgdrvldasyltsswavyhv--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..----SDLTEPERT..LINDWV.KAAFd......sNS..F.....GIDDNTW......R.STNPRVL..LKLSATLFTEAIR.....KC...A...Ae.........pE......GA-....G..........MEI.LRNGVS............Y................F....EGPLLNWT.L-RGVIWA---......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------laneaerhghaaqthldilqllvlangcpa..........................................................................................................................................................................................................................
A0A225ACE7_9EURO/2-294                 .......................................................................................................................................................................................................................................................................................................................kpi---EQWRKLLHGCVSRRVEVQTFRKLVKILLRRAPLPQ....................A---...........................----------...........--------SLV---.....---...-.....EV...LLDS..RSITADV.......FPY...DPL..IPRy..aTVLRRLGVIR.....TSTFLDGVRKR.SFIGytgtdhdkq...............................................................adqkraaksSTLM.TDTR.IVQD.AI.T.S.LS..ST.N.LSLS.......................................................--..-..-......-T.HE.VH...SL..F..T..VAAEWILA..V..V.RWHTSN....Isddhq...........................sgglfsSSNAL.AL.F.E.SL....GI.......L....LVA.LS...T..T.E.KGLEalssd...................dtqgfkIMLGQ.A.LTAYL.S.SS.TT.-.---............ISLNL..RNR...LDSL.Qkgyqlygepap...............kdldvqmidgmnMNAL...Q..FEASvl..........dgPVI.N.SRAGL......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------yiyinalgqqe.............................................................................................................................................................................................................................................
A0A448YRQ4_BRENA/339-741               ......................................................................................................................................................................................................................................................................................................................itsl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.-----LKNLVSMKLVK.VEQFSKLFPD.PSAI-.--..--.-.-TPANS.S.R..SL..E.E.L.NHAYTSIFHT........................................NNP......EFVSME-----......------E................SGV..AEFIK.SVS.ES....--TSQTEmFAK...LVFESID....TLIA..N.H..DSTRLRRLLIS..L.TLN...R...-E.....ILDYV.LLQGS...P.Y.NMARLLIAY......LEEEI................E......T......Kp.......dsE.......G.......K....R....NQflq....dnnaD..fMdl....dlaE.....D...D...S....S.N...........AQD..........FFTD.FGTVLIFIQFIVFRFNM...N..L.WK...F...EKD...........KQ....---....-----ALQ..LL.N.NAST..VNS---.-NNY..LEKVQDPDSELNS..IINDWI.GSLFd.....niNT..D.....GISDDLV......K.RCSLKDY..HFIMPRVIEEAVS.....AF...S...L...........S......LI-....D..........EDS.LMGGLE............Y................F....YQPFLINN.LTSIFRYL---......VN.ASW.S.R..E....N.Q.....N..DI.IT....-V.T.KIL..RK.L.S.....V..A.D..E.M...S..GE...........VKLLHS..MIM....EIVNDDLYVALKNLNSLP..QV....E--------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------eylsklkapdeaevdlgalvsyvndgv.............................................................................................................................................................................................................................
G7E9R4_MIXOS/485-595                   ..............................................................................................................................................................................................................................................................................................................liarlpapatal--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..-AGDYA.ISSE..VVSPSSLDAVDQE..ALNAWI.AALF........GS..E.....GISDDLT......N.TTKPTRL..LGLGTVIVQQALL.....AY...E...R...........G......KL-....S..........LES.AKSGLS............Y................F....SQHPLV--.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------hllpsvtrflv.............................................................................................................................................................................................................................................
A0A2P5A128_9HYPO/13-897                ...................................................................................................................................................................................................................................................................................esvkywssfvskcltkrldastfedyvqlvqskhrlppe--------------------------------------....................----...........................----------...........--------------.....---...-.....--...IIAD..FFIRPMKs....ncVSP...DPR..IPPy..vSVLTKLRYTD.....AVSILRALYRY.SSLHalipeqsqhegdgang................................................egatrqdaqqapslrwkSSSW.LEEV.MF--.--.Y.H.VI..KL.L.VEGS.......................................................-A..F..K......DS.RT.AL...EL..I..H..ISSKWMVL..F..T.TASNSM....Tadmlggslqdpq..............vrhemetawgalVPLVL.RL.V.D.NA....AF.......V....---.--...-..-.-.---Kvvsqp...................sakgarKVFSE.S.LASFV.Q.VI.QQ.S.PQ-............-LPQF..QQF...INKL.E......................................LFRT...E..VLAPl............dPVD.K.SKQAA......--N.AVMddildst.....vgvdnlviPEVP..I..TN..T..RAGL...YIYLGA..SLV.GRPLI.DDHALFSYLN---NRYQ.GDV..........------QQSAVDLILASF----.DLL.ANA.VFR.N..E.GP..RDAQLLRS---FLINKVPLILAQlcp..........pgfAT.PSAE.........................FCITQALP.....HV.DT-.--..SV..F..P..TAS.LM..F....D..ES....RNNN.PY..T--.-.....-...---.-...ES.VREEFCSACALHGLIE.REHVERILGE.SSM--.--..--.-.--GYEP.S.Q..EK..Y.S.K.EKLVQSCLSDpek..................................iqaLIR......DMDKMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALVELLR....QLCH..S.K..ETMSLKLLCSQ..L.-AQ...K...PQ.....SLDIL.LLFEK...L.P.TILEPICQL......LD-SW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.FGAILLLVLAFAYRYSL...T..P.AD...I...GII...........SP....---....--DSNVAK..II.G.RAHI..-S----.----..-RELGELSEQENG..HVGGWI.QGLFd......sDA..G.....GLGDDLM......S.SCPPADF..YLLIATLFQNIVI.....AY...T...Q...........G......FLT....D..........-DA.LRSGVE............Y................L....IDTFLLPS.LIPAIRFLSDY......LW.VEQ.K.E..-....-.-.....-..--.QK....SI.I.KIL..QL.I.L.....L..P.T..S.I...S..GE...........ATTMLA..SVK....GIVAKPLEHSLRSYQRQD..PK....N--------.----..-----.-...----.....-......--.....QD.IE.P.LL.RVLK.DS...L.P.F...............S.R............R...TG.AA..EH..Q.ELE.......LW.A.TS...S..........S...S..G....LSGAAKHLIQGLv....qWC.VHTDet............ampTSYT..HR..Q.VIATL..KIVG...ASRL...LRVILEEI.RHQTLA--....---.---..---...-.....GNGSVVYDVA.TALICAPN.VS.N...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------elppts..................................................................................................................................................................................................................................................
W4KNM5_HETIT/535-692                   .........................................................................................................................................................................................................................................................................................................lgektldpgflrvtdnv--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-RRIEDLSSEQAA..AFNSWF.KALFd......kNS..E.....GIEDGVL......R.STRPKML..LMMAATLCSHAIT.....AC...T...E...........H......KI-....D..........VDV.LANGFS............F................F....TGPLLSWT.LVGVVKTL---......VR.EMK.Q.T..R....Y.Q.....S..--.-P....HH.L.NIL..RT.L.I.....L..S.P..T.C...P..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------rsvlrlcghdilrllsdpqlaaf.................................................................................................................................................................................................................................
A0A1V6Q811_9EURO/8-1007                .......................................................................................................................................................................................................................................................................................................................spp---EQWQTFLNQCLSNRIDIDEFTTLSKLMLSRIPLK-....................----...........................----------...........--------------.....---...-.....EN...TLFD..LLLRSRAd....ahIAW...DPL..LPLy..vDGLCRIGLVK.....VSGVLRGLLRH.SSILdsssssnssssqek....................................................aeadaptknggdsprSTLM.TDIK.IIQD.IM.M.S.IS..TG.TqIPKS.......................................................--..-..-......-T.TE.AG...DI..Y..S..ATVDWILA..L..V.DWHSRS....Qggdvst.........................qsgglmdEPDAV.SL.F.E.SL....GI.......L....LAA.LS...G..T.A.KGLEalsgd...................fdrplkGKLGT.A.LAAYL.P.LC.VD.-.---............VSLPL..RHR...LEEL.QkgfglfpeaagggngnaansdgnpkaldhsgnvidgmnVRAL...Q..FEAGvm..........dgPVV.N.TRAGL......---.---....................----..-..--..-..----...YVYINS..MVV.GRPLV.DDTILINYLT---NRYQ.GHN..........------EVLIEEIITAAF----.DVL.SNG.VYR.N..E.SS..RTMFLFRS---FLVNKLPVFFAA................IS.AA-Smvp..................ismeMCISQALS.....HL.NP-.--..NA..F..P..SFS.QM..F....S..--....MQGS.SV..L--.-.....-...---.-...SD.ARQEFLFACASHKLIQ.ESSIEQLLGE.NPM--.--..--.-.--QTLP.G.G..GP..Y.V.K.DDLISQINSNher..................................aeqLIG......EIESMEGNAGA......-------................---..-----.---.--....-------.IVG...AVVEVMH....SLCH..E.K..ETMTLKNICNS..L.-SR...R...PQ.....TLDAI.LLFRN...T.K.QVLQPLCSI......LD-SW................K......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........NQP..........VYDE.FGSILLLVLAFKYRYDL...S..P.SD...M...GIS...........SN....---....--DSFLLK..LM.D.RGAS..------.----..TQKLSELSEKQNK..DLGAWI.GALF........IA..E.....GISEETM......S.TCSPHEF..YMLVTTLFDQSLG.....AC...E...S...........G......KL-....D..........FDT.LKGGFE............Y................L....LEPFLLPS.LVVALTWLGNH......IW.EAE.D.P..-....T.I.....P..--.--....--.I.KTL..HS.L.V.....K..P.N..S.I...S..GE...........AQAIHQ..TVL....NITARPLEEQLKNVRTRH.qSR....T--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DALE.PY...L.S.F...............R.R............V...GS.SH.rTE..L.--D.......TW.T.SH...T..........A...N..G....LVGSIRTTMQSLi....lWS.ANPTan............aapTPYT..HR..Q.ILAGI..RILG...ATRV...LAAIIDEV.KHQSET--....---.---..---...S.....NSGHVSLDIA.TTIICAPT.TE.S...-..-...F.AV.D...Q.NNYHP---ID.........A......MKESP..PRCPILTLR.....................................DALTLAHEIVPkLSEKDPLRAEVivr......................lwrrVNLLMAPPSQV-..................-----......-..S.....NIDVSNIIHNM..HLGVE.GHDRM......DLEP.SA-A.D.V..AG.NTVGEDDPDNINQMLDKAA---aa......................................................................................................................................................................................................................................................
A0A5Q4C4B2_9PEZI/49-956                ........................................................................................................................................................................................................................................................................................................pvavadlflrpqphnhes--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......--L...DPR..VPRy..lQVLSNLNYID.....TPSILKALFRY.STSRahsrdaaqpad..........................................................gdvqrpnmlhwgSSYA.AEEV.MFYR.LT.K.S.VA..QG.T.AIQNtgs................................................gleiAS..I..M......AK.WI.AL...FT..D..A..ATAFTVDV..M..G.QLHNSQ....V......................................REEME.SA.R.A.AF....VA.......L....LLG.VC...E..N.Q.VVLKamskp...................eaqgtrKALSE.S.LANFV.P.TI.MQ.S.AGP............IATRL..DMF...RTST.Lag..................................fePVDE...Q..KNKSna.........eieDLF.D.STVAL......ENF.VIS....................ELPI..V..N-..S..RAGL...YIYLNA..ALV.GRPLI.DDHAIFNYLN---NRYQ.GDV..........------QTTTVDLILASF----.DVL.ANA.ASR.N..E.GH..QAAHLLRS---FLMNKLPILIES................-L.SKHMygp..................vnaeYCITEALG.....RV.DT-.--..TT..F..P..TLS.SM..F....D..ET....RSNN.-P..F-T.D.....-...---.-...-S.VREEFCWACCLHGLVR.ESSIETLLGE.TPY--.--..--.-.--QSLP.A.G..GR..Y.L.K.ENLVAECLADper..................................mqaLIG......ELDNKDGNAGA......-------................---..-----.---.--....-------.VCQ...ALTEVLG....QLCR..N.K..ETMSLKLLCSQ..L.-AQ...K...PL.....SLDVM.LMFEK...P.A.TILHPLCDL......LD-SW................K......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLVMAFAYRYGL...S..A.SD...M...GVA...........SS....---....--ESFVAR..LL.G.QGHQ..------.----..SRPIDELSDQEKG..HLNGWI.HGLFd......sEA..G.....GLGDELM......S.SCPPQDF..YLLVSTLFQNIVL.....AF...S...T...........G......HL-....A..........EES.LRGGIE............Y................L....VDTFLLPS.LVVAIAYLANS......LW.VER.S.E..-....-.-.....-..-C.QK....AI.V.RVL..SS.V.L.....A..P.T..S.I...S..NE...........AQAMLT..SVM....NIVAKPLEHSLRAYQRSD..PK....S--------.----..QEVEP.L...----.....-......--.....--.LK.A.IK.DSIP.LS...R.R.T...............-.-............G...AA.DH..TE..L.--D.......--.-.AW...S..........L...G..G....FSNSIRQTLQQLv....qWS.IHPTmd............rmpPAYT..HR..Q.MLVAL..KLLG...AKRL...LQLLYEDI.RQQTDT--....---.---..---...-.....GSGSIIYDVV.TAIVCAPD.VV.N...-..-...T.PS.N...P.VNFLDN----.........S......GNVPV..PTQRKLTLR.....................................EVLKSDAEDCKrLQKTDMNLAEIavrl.....................yrkvESQMAVSQAQ--..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------aiqadtmlqsdlglsld.......................................................................................................................................................................................................................................
MED5_USTMA/578-854                     .......................................................................................................................................................................................................................................................................mdaqleglalntlfetriptdhpvellqrvasdpgthfifarqlvlqvqgw--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....--LE..Q.H..DLESIARWCKA..L.TEN...A...CEg..gaMLDTI.MIYID...P.A.QMLDPLASI......LD-HQ................D......-......L..........G.......Q.......T....-....--...........-...S.........D.....-...-...-....-.-...........---..........EPST.LSDILLFVQLLCYRYSTpitR..I.SR...Y...TVS...........NH....DMD....TVDSS-AP..LH.R.SMPP.fLATHLA.TSSV..SYPLSVLSEEDRG..LVSRWI.HALF........GN..E.....GISDDLI......S.ASPPTTL..LRLSPLLFSQSIS.....AC...Q...H...........G......II-....D..........LET.LRGGLS............Y................F....LQDLLSFA.LPGALVWL---......LS.EIS.R.T..P....L.Q.....P..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ildflse.................................................................................................................................................................................................................................................
A0A1E4TBI0_9ASCO/354-732               ....................................................................................................................................................................................................................................................................................................gvtdsqiaeveplislfdssms--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----DINSIM......--DNAPN................ADL..EEALC.SLN.AY....ALPNQSL.ITQ...GISYGIE....SYIA..K.N..DYARLHWICQL..L.AAN...P...--.....VLLDI.WTLNQ...P.AsKYIAMIINF......LD-NW................P......-......-..........-.......-.......-....-....--...........E...N.........D.....Q...D...D....L.L...........YQE..........KYTY.FGSILLFIATIRRRYNV...N..F.RA...L...NIS...........E-....---....--NSYVIN..VI.S.SSGN..------.----..SVDLNTADTLFSE..RIGKWI.VALF........GT..E.....GIGDELL......G.SISVKEF..IKMVPYIFDQIIL.....AA...T...L...........N......AI-....D..........LET.IKGGLE............Y................F....MQPFLLPY.LYFALTWVNSE......LW.RLS.S.I..Q....D.S.....A..P-.LG....--.-.HIC..GV.L.V.....M..Q.N..P.T...E..G-...........-QSIHR..AVL....NATASTLMETLDVLDA-Q..GI....S---VTSSH.SPSS..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------glflafkqvlspiadlsitcptvniqhatasnvlaqvrsltswganttsivnilsq................................................................................................................................................................................................
A0A2H0ZW05_CANAR/172-1003              ..............................................................................................................................................................................................................................................................................qlqrlnatdklayfekksrnlldtinvahclhpgaaavefkrek--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..--VS..............PTP.V.KKAFA......LNQ.HSK....................KYLK..L..NR..L..K--N...FLWLNE..RFK.SWNI-.-DGLMESYIA----FFN.VDV..........---AKHDECVKQLIEILFSGIS.KAV.KLQ.---.-..-.ES..PYVLF--NWKNFIVSRFPAFIKE................SR.PKNN.........................N---EANS.....NL.ESV.IV..KT..V..V..GFS.DA..Y....I..--....---T.EM..FIG.G.....R...SSH.P...FD.LRKVFLRSCMYEDLVT.VSNYTKTFPE.DSESI.TW..SH.I.THEKNV.L.N..HT..D.H.L.KSEFNSKLLN........................................INT......EFTSLAESKF-......------I................NFL..EELAS.TDI.QF....SPTKQEQ.LCS...LVMSSLE....KFIR..D.K..SNEKLVRLVLG..L.SLC...L...--.....PITNY.IFFTDprgP.W.SIIDQLISY......TD---................-......-......-..........-.......-.......-....N....DS...........F..gA.........D.....A...D...E....S.N...........FQE..........TISY.FGILTTGVIAMTKFFGI...D..L.VS...V...TLG...........SS...yTIE....FISNFYHR..SC.S.KFTP..-----R.VEPA..TNNDTDMMNRYND..LLSEWA.NALFd......vNN..D.....GLSDDLI......R.SVDVKQI..YKLVFIIFQSGIT.....AN...I...A...........G......SL-....A..........SPN.LSNGID............Y................L....AQDFLTAS.SAELIHWIISN......IG.PLQ.R.N..-....-.-.....-..--.SD....MF.L.QIL..WK.I.I.....Q..S.N..F.G...E..NKee......gleTNYTFR..LVL....NLVGKELLEAVYAFRNWE..NK....E--------.----..-----.I...MLKL.....V......RV.....V-.--.-.--.----.--...K.Q.T...............V.D............E...EY.NRvdRP..M.LIQ.......HE.R.HT...D..........G...D..S....MVSTIRNALQTF......LN.EDES.................TLEQsvWK..T.IHNMW..KVTE...SE--...--EILSVL.LSEISL--....CHG.SKA..GTS...A.....EDSKLIVNFM.AFLIILTS.ES.A...V..D...M.SD.A...E.LKSTFNEIKP.........R......GKSSM..QFGTSFSLNikdhyssilgd...............slkdsngmsepAEIKEPKDDLMmDFEMDDLFNDKgdd.......................lfgDTSEQ-------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------vssrpdsspakvgdmyneiisstsvlrrilnqlsqdlethkhdaeilkivlaqqmeqfls............................................................................................................................................................................................
A0A3G2S799_9BASI/462-763               .................................................................................................................................................................................................................................................................................................................aqalqeprl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....----QLV.IAN...EFSHLFT....DWSE..S.LtpDLAHVHAVCLM..L.EPH...V...PH.....VLDML.HLYID...K.Q.KMAHALVRV......LSR--................-......-......-..........-.......-.......I....E....QR...........M...W.........Q.....D...H...S....-.-...........---..........ELAS.IGRVILFLQYLSYYI--...-..-.DQ...T...GIP...........SS....---....---GYAYI..FMtR.NMSS..INM---.----..----HAFPEQSLS..LITRWC.RCLV........EG..Q.....AITDDLL......A.VSPPWTM..YRITPTILSLLLE.....AH...M...Y...........S......LL-....D..........DSA.LFKACS............Y................F....LQVPLAYN.VPCAVQWLVQF.....aSS.TLA.K.S..Q....Y.D.....A..KL.LS....HV.V.MYV..RV.I.H.....K..L.L..T.S...T..SD..........vFSPLYR..SIL....AHTVLPLL----------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------tnerlilvlstsefnlpsfimalesmveprltkyewi...................................................................................................................................................................................................................
A0A4Q7JQW5_METCM/13-947                ...................................................................................................................................................................................................................................................................................esmdywsrfvdkciskrlstedfdefvrliqakhplppf--------------------------------------....................----...........................----------...........--------------.....---...-.....--...LIAF..LFLRPMPd....ndVSL...DPR..IPPy..iQVLSKLGYID.....APSILKVLYKF.SSLHtqlkastqngtqsegkdn............................................kdshdsngndkkqsprrwrSSSW.AEEV.MF--.--.Y.H.VI..KT.I.VEGT.......................................................-A..F..R......DS.RA.VL...EL..V..Q..VISKWMEL..F..T.SVSSAF....Atdvmge..........................lqnsqaRDDMD.VA.R.A.AF....VP.......L....LLR.LV...E..V.P.ALVKaisnp...................nvkairQHLSN.S.LAGFI.H.TL.QP.A.PGF............VERLD..IFR...TETL.Dr...................................ldPIDK...K..SQAA..............ANA.A.MDELL......ETT.VGVd.................nfAIPD..LliTN..T..RSAL...YVYLNA..TLV.GRPLI.DDNVLISYLQ---NRYQ.GAT..........------QPSAIELIIASF----.DIL.ANA.VFR.N..E.GP..RDAHLLKS---FLVNKVPLLLCH................LF.SHEPtfdt.................nsteYCITAALN.....QV.DT-.--..SV..F..P..TAS.LM..F....D..ES....RSNN.PY..T--.-.....-...---.-...ES.VREDFCTACALHGLVQ.REHVERILGE.TSMS-.--..--.-.---YEP.S.L..EK..Y.S.K.EKLVQDCLADaek..................................vqgLIR......ELEKMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALVEVMR....QLCN..N.K..ETMSLKLLCSQ..L.-AQ...K...PQ.....TLDIL.LLFEK...L.P.TVLDPLCQL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........IYEE.FGSILLLVLAFAYRYNL...T..S.AD...I...GIM...........SP....---....--DSSIAK..IL.S.RAHI..-SR---.----..--ERDELTEQEKG..HMSGWI.HGLFd......tES..G.....GLGDDLM......S.SCPPQDF..YLLVASLFQNIVV.....AY...T...Y...........G......YL-....N..........DET.LKGGVE............Y................L....VDTFLLPS.LVPALRFLADY......LW.VEQ.K.E..Q....-.-.....-..--.-K....AV.I.KVL..QL.I.L.....L..P.S..S.I...S..GE...........ASTMLS..SVR....NLVAKPLEHSLRTYQRQD..PK....---------.---N..QDIEP.L...LRA-.....-......--.....--.--.-.LK.DSLP.LS...R.R.T...............-.-............G...GA.DH..NE..L.--E.......SW.T.NA...S..........S...N..G....LAGALRHTVQGLf....qWS.FHQAtgn...........slpTSYT..HR..Q.LIAAV..KIMG...AKRA...LRLLLDEV.RTHSEA--....---.---..---...-.....GTGPLVYDVV.GAMICAPN.VT.N...E..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------lppnsqmmdpagnlppaiqqpltlrealrfeaescrklqktdpvlaevvvrlhr..................................................................................................................................................................................................
A0A084FXD0_PSEDA/281-968               ..................................................................................................................................................................................................................................................................................................................isnsragl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...YIYLNA..CFV.GRPLL.DDHALFAYLH---NRYQ.GDV..........------QTTAVDLILASF----.DVL.ANA.VFR.N..D.GH..KTAHLLRS---YLINKLPLLLVAl..............gHS.---Lfpp..................ttpeFCITEALS.....QV.DT-.--..NT..F..P..TLS.SM..F....D..DS....-RNN.NP..L--.-.....-...---.T...DN.VREEFCFACCLHNLMP.QSHIETLLGE.NSY--.--..--.-.--QTLP.S.G..GR..Y.V.K.DDLVRDCAADpek..................................iqsLIG......ELDNMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALTEVLG....RLCA..N.K..ETMSLKTLCSQ..L.-AR...K...PQ.....SLDVM.LLFAK...P.A.TILQPICDL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLLLAFAYRYNL...T..P.AD...I...GIR...........SR....---....--DSFVAK..LL.T.QGHL..------.----..SRPLGDLTEQEKG..HLDGWI.HGLFd......tDA..G.....GLGDELM......S.SCPPQDF..YLLIPTLFLNIAL.....AF...G...S...........G......RL-....T..........EET.LKGGLE............Y................L....VDTFLLPS.LVTAIRFLSDY......LC.NDR.Q.E..E....Q.K.....-..--.--....AI.I.KIL..QL.L.L.....A..P.N..A.I...S..TE...........ASTMLS..SVL....NLVAKPLEHSLRAYQRRD..PN....---------.---N..AQIEP.L...LRTL.....-......--.....--.--.-.-K.DSLP.LS...R.R.T...............-.-............G...GA.EH..NE..V.--E.......SW.S.ST...A..........S...G..G....LTMSIKHTMNGFv....qWS.LQPAsvn...........ampTSYT..HR..Q.VLCGL..QMLG...ASRM...LRIILDEV.QQQSEA--....---.---..---...-.....GNASIVYDVA.TALICAPD.VS.N...D..P...P.PP.P...N.MQTLD---ES.........G......NV-PP..VPQRQLSLR.....................................EALKTEAENFRkLHKKDPALAEI.............................VVRLHRKVEAQMt................pSQAQI......L..-.....-----------..-----.-----......----.----.-.-..--.----------------------qadlgasidtsdvvhqaaanaaaaaavaatgag.......................................................................................................................................................................................................................
A0A427XNZ1_9TREE/572-719               .......................................................................................................................................................................................................................................................................................................aicaqfelplpdllydarr--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..ATNLADLPEVELN..HLNGWI.KALF........GS..D.....GIDDEIV......M.TTSPQNL..CRFSSTIVQQSVV.....AA...M...S...........G......QI-....D..........LDT.LHSGLS............Y................Y....AQPLLSWC.LGSVVGWL---......CA.EIE.R.Q..G....L.L.....S..--.-G....MH.L.NVL..QT.L.V.....L..D.S..S.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------fpepllrvnakain..........................................................................................................................................................................................................................................
A0A0C3E374_9AGAM/558-730               ..........................................................................................................................................................................................................................................................................................................tkfrissptlkkgdkv--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..LRTDFL.RSSR..VYNADDLPAEAKF..VFAGWF.KAIFd......sSN..E.....GIDDTIL......R.STTPKTL..LQMSPTLFAQACI.....AR...Q...D...........N......RI-....D..........IDV.LHSGIS............Y................F....LEPLLNWT.LVGVVHAM---......LF.EIQ.Q.R..G....F.A.....A..-T.HQ....--.L.EVL..HS.L.L.....L..A.P..T.C...P..--...........-----P..IVL....RLCSPNLLRIM-------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------askraqivnpsnh...........................................................................................................................................................................................................................................
W9W8D9_9EURO/380-707                   ......................................................................................................................................................................................................................................................arflhvcalhhlipaqvaaqlvgsedllkglnkglyakddlvaqvnvnhirgpklveeltrsdgsagf--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.ISQ...AVVEIMH....IYCQ..N.K..ETQYLRDLANA..I.-LR...R...PA.....AINCI.ALFVR...P.S.FFLGPLCGL......LD-EW................R......-......-..........-.......-.......-....-....--...........-...W.........D.....E..iH...E....G.E...........AQP..........VYDD.FGAVFLLILISRARLAL...S..N.SS...L...GIR...........KK....---....--DGFLAQ..YL.E.QENN..------.----..EESLESLSEEKKS..HLGNWI.NALY........LA..E.....GLSDELF......I.NCSPHDF..YLLIPTLLRQSMT.....AH...Q...Q...........G......KL-....T..........HDS.LQAGLD............Y................L....LEPFLLPS.LISAMNWA---......AE.VFR.H.E..P....T.V.....A..--.--....--.G.KVL..EV.L.I.....K..P.P..-.G...S..VE...........SRDIHH..TIL....AMCAPRLKMRLKAAGS--..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------qdtnad..................................................................................................................................................................................................................................................
A0A094H9C9_9PEZI/22-757                .............................................................eqfakvlstksplatpliaelllrpsesrnygldpqvslyvqallridildvpsvlrallrhstsrpvdatkeeqevasgsqtrwtksygheerlvyglskivaagdrpkstqealgtanaltewmrllvmsnaaddmmreigagndthnqetmavrvavgallvalaenatvndalknrcpkdtlkgfsqslanftpllingssmfaerlelytktlvalepmdkkaqkagaeidqiidsamalgmdnipvv--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................EIPT..M..NS..R..A-GL...YVYLNS..LLT.GRPMV.DDNQLLNFLH---NRYQ.GDI..........------QTTCIDLIVSSF----.DIL.ANA.IFR.S..E.SP..QTTFLLRS---FLINKVPLLIS-................-M.ISAPmfpp.................lspeLCITEALS.....HV.DT-.--..NA..F..P..TFS.SM..F....D..DT....--SA.GD..MFS.D.....S...---.-...--.VRQDFCFSCCLHGLIP.EESIERLLGE.IPM--.--..--.-.--QTLP.A.G..GR..Y.T.K.DEVLEQCLSDsek..................................ieaFTD......ELEHMDGNVGA......-------................---..-----.---.--....-------.VSQ...AITELLR....RLCE..S.K..DTMALKSLCAH..L.-AR...K...PS.....SLDVL.LIFDK...P.L.TILPPICQL......LD-AW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...D...Q....G.E...........YQP..........VYEE.FGSILLLVLAFVYRYDL...S..A.TE...L...GVQ...........TP....---....--DSFIAK..LL.V.RGST..------.----..ARLLDDLSSVESS..QLDGWI.KGLFn......aEG..G.....GLGDEPM......A.LCPPQDF..YLLVPTLFSQIVL.....AS...Q...H...........G......HLT....D..........-DV.LRGGLE............Y................L....LDPSLLPS.LIPALLSL---......AS.NIL.T.A..P....P.P.....S..--.--....--.-.SLL..QA.L.I.....L..P.Q..S.I...S..AE...........ASLLHN..AIL....PIPAPHLSRSLRALQRSV.pTR....T--------.----..-DLDS.L...IAAL.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------rphlhfsrsa..............................................................................................................................................................................................................................................
A0A4U0TXJ4_9PEZI/257-860               ..................................................................................................................................................................................................................................................................................................pvingqqilesvtelpiaqtragl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...YIWLSA..CLC.GRPLT.DDATMLGYLQ---TRYN.GDN..........------QTLAVHLLVASF----.DVL.TNA.HLR.S..D.SP..QRIKLIRS---FLCNKVPSLLAIma...........aflAP.MTAE.........................QCIQMAFT.....DI.SM-.--..DA..L..P..PLE.AG..S....A..KV....---R.EK..L--.-.....-...---.-...VE.ARLAFFQACALHHLVS.EASISSITQE.SVRL-.PK..IP.R.FTKEGL.A.N..--..-.Q.C.NSNVSQLESF........................................LIH......P-SMMQGNAGA......-------................---..-----.---.--....-------.IAG...CVVEVIN....NLCM..N.K..DSMSLKTLCNV..L.-IR...H...IE.....EMEIV.LQYAQ...P.A.DLLQPLCTL......LN-DW................V......-......-..........-.......-.......-....-....--...........-...H.........D.....Q...E...Q....S.E...........FTP..........AYEE.FASILLLTLGIIYRYGI...S..Q.VE...V...GLA...........SN....---....--GNFVFE..LV.G.DISS.sIPR---.----..----SELSEEQSA..QLSKWT.EGLFatd..eqgET..S.....GISDEVM......R.QCPPQAF..YKLVPTLFEQSAL.....AC...K...S...........G......VL-....S..........VDA.LKGGLE............L................L....LEPFLLPS.LVGGLAWV---......VK.HSW.E.D..H....G.D.....T..DI.L-....--.L.HLL..EK.F.L.....R..P.S..S.S...S..QE...........VQAMHS..VIL....DMIAPPLVRSLQELSRKR.pDK....---------.----..-----.-...----.....-......-K.....AA.IG.L.IE.LLQP.HV...V.Q.R...............-.Q............T...MH.AY.aAE..L.--H.......EW.A.AT...S..........D...G..A....LTRAVRNNVRDL......VS.WASSvgp...........nppTRYS..HR..T.FLAVC..QLLG...QERV...LQALAAEV.QEHTAA--....---.---..---...-.....GLGSQALDVC.VALVCA--.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------pstpaitsianvrds.........................................................................................................................................................................................................................................
A0A2J6TNR1_9HELO/25-958                ..............................................................................................................................................................................................................................................................................................esyvqilstkhplsasrtsdlflrptet--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-----NA.......ISL...DPR..VVRy..vQVLLELKLVS.....VPSVLRALWKV.SSFRdqnghqdgqqkvaigge...............................................tgektagktrddgkrwnNSYI.AEET.LFYR.LT.K.Y.IS..SG.T.VPHN.......................................................--..-..-......-T.QE.AV...EL..V..M..VCVQWMRT..V..I.SVQHAA....Qemlg.............................laqthTAEMT.AQ.N.M.AL....GT.......L....IIA.VV...E..N.G.RVLHalgkgs..................vpkpvrKELKD.T.LANFV.P.LL.LQ.S.SP-............QSAAR..LEL...FRTQ.Tilaie...........................pvdkkeR---...-..---Aad..........keIEE.I.LEEGM......ALG.VESmv................vgDMPT..M..NS..R..A-GL...YVYLNS..LLV.GRPLI.DDNAIFAYLH---NRYQ.GDI..........------QSTLIDLILAAF----.DVL.ANA.TFR.N..E.RA..KSITILRS---FLINKIPLLLAT................-L.SASLfpp..................ltseYCVTEALG.....HV.DT-.--..NA..F..P..TLS.VM..F....D..ES....--ST.NN..MFS.D.....S...---.-...--.VRQDFCFACCLHGLIE.ESSIETLLGD.VPM--.--..--.-.--QSLP.A.G..GR..S.L.K.EDLVQQCLSDper..................................tegLID......ELERMDGNVGA......-------................---..-----.---.--....-------.VSQ...AITEVIT....RLCA..N.K..ETMSLKSLCSQ..L.-AR...K...PS.....ALDVM.LLFDK...P.I.SILQPLCEL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGLILLLVLSFTHRYGL...S..V.VD...L...GIR...........TQ....---....--DSFVAK..LL.N.QGHL..------.----..SRAMDDLTEQEQS..HLDGWI.RGLF........EV..G.....TLGDELM......S.SCPPQDF..YLLVPTLFHHIVL.....AC...S...T...........K......NLT....D..........-DG.LKSGLE............Y................L....VEPFLIPS.LIPGITWLSSH......LW.ESR.G.D..-....-.-.....-..--.AN....AC.V.AIL..TA.L.V.....T..N.S..S.S...N..TE...........ASQMLT..AIL....NIVAKNLEHSLRWLQRAE.pSR....Q--------.----..-----.-...----.....-......--.....-D.VE.P.LS.KALR.PS...L.G.W...............E.R............R...GA.SD.hTE..L.--E.......SW.T.SS...P..........G...G..G....LVVAVKQTIANLv....qWS.LNPGin............inpANYT..HR..Q.ILVGV..KMLS...AKRI...LATIIEEV.KSQTET--....---.---..---...-.....GNGSIALDVA.SALICAPD.PQ.S...W..D...N.GA.P...G.IDVLG-----.........-......-TEPR..PLQRRMNLR.....................................EALKNEAEAAPkTQKNDAFHAETvvrl.....................yrkvEAQLQMPQQTL-..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------mshdaldinqaldsaaldg.....................................................................................................................................................................................................................................
A0A4U0WBH9_9PEZI/548-746               ....................................................................................................................................................................................................................................................................................................................vgavtr--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.--YTK...L.S.NLMQPLCQL......LD-DW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........HQP..........AYEE.FAAVLLLVLAIVHRYNL...T..V.LD...I...GIS...........SP....---....--NSFVAK..VL.E.QGST..------.----..SQPNSTLSKEQSR..CLNGWV.LGLFetd..etgET..K.....GISDDTM......S.LCSPQDF..YLLVPTLFDQTVN.....AC...M...V...........R......VL-....H..........VDT.MKEGLE............F................L....LEPFLLPS.LIGALTWLTRH......SW.EDH.G.N..-....-.-.....A..NI.V-....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------mqvidklslvl.............................................................................................................................................................................................................................................
A0A1E1LQH8_9HELO/59-960                ..........................................................................................................................................................................................................................................................................................................dplvlqyvqillssgk--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....--------VN.....VPTLLRGLWKV.SSFRdlvdggdeaqkeg......................................................aeeavekkatgrwkSSYT.TEET.LFYR.IT.K.N.IS..TG.T.APRD.......................................................--..-..-......-L.QE.TV...EL..I..S..ICIQWMDT..V..L.AASQTA....Htmln.............................lsqahAAEMN.AQ.H.M.AL....GT.......L....VIA.VV...E..N.A.RVVHalgrra..................vprparKKLGK.A.LEGFV.P.LL.LQ.S.NG-............PAAAR..LEV...FRAD.Tlvalepieikepkag.......aekdiediladglqlgVDSM...V..VEEM..............PVI.N.TRAG-......---.---....................----..-..--..-..---L...YVYFNS..LLV.ARPLI.DDNAIFAYLH---NRYQ.GDI..........------RSTMIGIILAAF----.DIL.ANA.QFR.N..E.RA..STSIL-RS---FLINKIPLLLSS................LS.S--Slfpp.................ltpeYCITEALS.....HV.DT-.--..NA..F..P..TIS.NM..F....D..ET....PSSN.--..IFS.D.....S...---.-...--.VRTDFCFACCLHGLIE.ESNIVELLGD.EPM--.--..--.-.--QSLP.A.G..GR..Y.V.K.DDLIQQCLSDper..................................aerLID......ELQLMDGNVGA......-------................---..-----.---.--....-------.ASQ...AIVEVIA....RLCS..N.K..ETMSLKGLCSK..L.-VR...I...PS.....SLDVI.LLFDK...P.A.SFLQPICDL......LD-NW................S......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLVLSFANRYNL...S..T.VD...I...GIR...........NQ....---....--DSFVAR..LL.N.QGHL..------.----..SRKMEILPETEQT..HLDGWI.KGLF........DNesG.....GLGDELM......S.SCPPQDF..YLLVPTLFHEIVL.....GV...S...T...........K......NL-....S..........EEA.LKGGLE............Y................L....VDTFLLPA.LVPGITWLAAH......LW.ESR.E.S..-....-.-.....-..--.SK....AV.L.QIL..SA.L.I.....T..S.S..T.SisnN..TE...........ASQMLN..SIL....NIVAKKLEHSLRWLQRAE.pSR....Q--------.----..-----.-...----.....-......--.....-D.IE.P.LS.KIVR.DN...L.N.W...............E.R............T...GA.AG.hTE..L.--E.......SW.T.AQ...A..........S...G..G....LAVSVKTTLAGLv....lWG.VNPTln............sspANYT..HR..Q.ILAAV..KMLT...AQRV...LGALIEEL.KAQTAT--....---.---..---...-.....GNGSVALDAA.CAIVCAPE.AA.S...-..-...-.--.-...W.ETGMQ-TDIM.........G......ASTIT..PLQRRMTLR.....................................EALKIAADGTPkMHKTDPFTAET.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ivrlyrkveaqmimpmpqhdalgalglstsieeavdaman................................................................................................................................................................................................................
A0A5B0RDQ2_PUCGR/108-413               .................................................................................................................................................................................................................................................................................................................hpnlvlghh--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......---SDLD................LGI..HPLLD.SLG.KS...sKETPISE.LAV...KLHQSIV....TATK..S.F..DLSTCITLTEA..L.-SS...L...-D.....SLSTL.FLWIE...P.R.KLLGPVRDL......LD-HW................N......D......I..........R.......N.......N....V....NQ...........LvnnS.........D.....N...D...E....S.S...........SGS..........EFEK.FGRLLGWLQGVVGRFSL...M..S.-N...L...SY-...........--....HLG....ATTGFTIH..HL.S.NPST..---SYP.IS--..-----SLPASHQS..TLSSWI.EALY........GS..S.....GIPDDLL......G.HTDPRIF..FSISASLFKQSFD.....AL...T...I...........G......LI-....D..........LQT.FRDGLS............Y................F....EHKLLVAGcAVGVVGWLLNE......LT.RVG.R.I..-....S.A.....S..SY.PT....AL.L.EIL..QS.I.L.....L..S.D..A.I...T..P-...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------talhlvsarslavlrafdanfsr.................................................................................................................................................................................................................................
A0A0A2VHG7_BEABA/14-722                ...................................................................................................................................................................................................................................................................................................eavkywsdfvarcivqrldsnrf-----------------------LDFVQLVHARHPLP-....................----...........................----------...........--------------.....---...-.....PV...LVAD..LFLRPQPs....nrVSL...DPR..IPPy..vRILAQLRYVD.....APSILRVLYKY.SALHahdrpplplpsslpenggdget....................................mkkeeeeeekgaaggggvmrqdkMVRW.QE--.-SAW.AE.E.V.LF..YH.V.IKTMf....................................................egTA..F..T......DA.KT.GL...EL..V..D..ITCKWMDL..F..V.HASSEL....Aadmlan..........................khdrqaRDEME.TV.R.A.AL....VP.......L....LLR.LV...D..N.H.ELLRi...........................isKPFAK.G.GENVL.A.S-.--.H.GCI............TVQPP..PLY...IERL.E......................................IFRT...Q..TLAQl............dPID.E.KKKAA......NAA.--Meelldstvg..sdnfvipeiLISN..S..RA..A..L---...YVYLNA..ALV.ARPVL.DDSMLYAFLS---NKYQ.ENQ..........------QASAVDLIVASF----.DVL.ANA.VFR.N..E.GP..RDAHLLRS---FVVNKLPLLLCQlch..........pefSA.ASAE.........................FCITEALS.....RV.DT-.--..GI..F..P..TAS.LM..F....D..ES....RNNN.PY..M--.-.....-...---.-...DS.VREEFCAACALHGLIE.RDHVDRILGE.TSMS-.--..--.-.-YD--P.S.L..ER..A.N.R.DRLVSDCLSDsgr..................................iqnIIS......QLDRVDGNVGA......-------................---..-----.---.--....-------.VAH...AIVELIR....QLCN..N.K..DTTSLKLLCLQ..L.-SQ...K...PQ.....SLDII.LLFDK...V.T.SVLEPVCTL......LD-NW................N......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.YGAILLLVFAFTYRYNL...S..P.LD...I...GIQ...........SA....---....--DSHVAK..II.A.KSHM..LRP---.----..---LEDLNEQEAE..HVAGWI.TGLFd......nET..G.....GLGDDLM......S.SCPPHEF..YLLVAPIFQSIIT.....AY...T...Y...........G......YI-....N..........DES.LKGGVE............Y................L....VDTFLLPS.LVPAI------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------rffs....................................................................................................................................................................................................................................................
A0A4U0VGJ6_9PEZI/270-940               ....................................................................................................................................................................................................................................................................................................................qsragl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...YIWLNA..CLC.GKPMM.DDLGMLGYLQ---TRYN.GDN..........------QMLTVHLLHASF----.DVL.TNR.VLS.A..R.PA..HEVKVVRS---FTCNKLPLLLAL................LT.SFMGqg....................ileTCIQSAFL.....S-.--S.VM..DP..I..P..PIS.AG..S....L..AV....---T.DM..L--.-.....-...---.-...KR.TRLEFLQACILHGVVS.ESTIGMILQE.SPS--.--..--.-.---GLP.K.V..PK..Y.T.K.ENLLNQCTNNvgr..................................lesLTA......ELQSMRGNAGA......-------................---..-----.---.--....-------.VSL...CIVYLIG....SLCA..S.K..DTMSLKSVCNI..L.I-K...H...VE.....NMDIV.MQYTQ...P.A.TLLGPLCML......LK-DW................V......-......-..........-.......-.......-....-....--...........-...H.........D.....Q...D...Q....S.E...........FTP..........AYEE.FASILLFTLAVLHRYQL...T..P.ED...L...GMS...........GL....---....--DVFLFD..IL.D.ESST..------.----..STSLSDLGHEQNQ..QLAKWL.EGLFatd..dqgET..S.....GISDEVM......R.QCPPQAF..YKLVPTLFLQSVM.....AC...K...A...........N......HL-....S..........PTI.LKNGLE............L................L....LEPFLLPS.LVGGLKWV---......IG.RSW.E.D..H....N.E.....V..--.-E....II.L.QIL..EK.L.L.....R..P.S..S.S...S..AE...........TQAMHR..AVM....VIVAEPLEHSLQDLLRQR..--....P--------.----..-----.-...-EKT.....V......AA.....GL.SA.L.LR.QYVD.ST...G.S.S...............-.-............T...-S.YK..AE..I.--E.......KW.A.AA...-..........-...G..D....MTHDMRHVVRGLi....tWA.ANGTpt.............apPQYQ..HQ..M.IVAMH..DISG...PQRI...MNALLSLM.RE-TE-Y-....---.---..---...-.....SAMAIALDVC.TSVICAPS.SV.S...N..T...L.RQ.Q...L.ALEVSDTDSL.........L......KR---..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------smsqastlvrlhlsvesrlvvhqleipfplpqqqstdqlmqdlglsgpvigadvgqvdnpaqalqmtdddlqaameq...........................................................................................................................................................................
A0A1B8EV06_9PEZI/22-757                ....................................................eqfakvlstksplatpliaelllrpsesryydldpqvslyaqallrtdvldvpsvlrallrhstsrpvdaakeeqevasgsqarwiksygheerlvyglskivaagdrpksaqealgtanaltewmrllvmanaaddmmreigagndthnqetmavrvavgallvalaenatvnetlrnrcpkdtlkgfsqslanftpllingssmfaerlelytktlvalepidkkaqkagaeidqiidsamaigmdnipvvdiptmnsra--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..--GL...YVYLNS..MLT.GRPMV.DDNQLLNFLH---NRYQ.GDI..........------QTTCIDLVVSSF----.DIL.ANA.IFR.S..E.NP..QTTFLLRS---FLINKVPLLIS-................-M.ISAPmfpp.................lspeLCITEALS.....HV.DI-.--..NA..F..P..TFS.SM..F....D..DT....--SA.GD..MFS.D.....S...---.-...--.VRQDFCFSCCLHGLIP.EESIERLLGE.IPM--.--..--.-.--QTLP.A.G..GR..Y.T.K.DEVLEQCLSDsek..................................ieaFTD......ELEHMDGNVGA......-------................---..-----.---.--....-------.VSQ...AITELLR....RLCE..S.K..DTMALKSLCAH..L.-AR...K...PS.....SLDVL.LIFDK...P.L.TILPPICQL......LD-AW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...D...Q....G.E...........YQP..........VYEE.FGSILLLVLAFVYRYDL...S..A.TE...L...GVQ...........TP....---....--DSFIAK..LL.V.RGST..------.----..ARLLDDLSSVESS..QLDGWI.KGLFn......aEG..G.....GLGDEPM......A.LCPPQDF..YLLVPTLFSQIVL.....AS...Q...H...........G......HLT....D..........-DV.LRGGLE............Y................L....LDPSLLPS.LIPALLSL---......TS.NIL.T.T..P....P.P.....-..--.--....--.A.SLL..QA.L.I.....L..P.Q..S.I...S..AE...........ASLLHN..AIL....PIPAPHLSRSLRALQRSV.pTR....T--------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------dldpliaalrphlhfsrta.....................................................................................................................................................................................................................................
A0A316URE4_9BASI/564-662               ...................................................................................................................................................................................................................................................................................................................pdpsand--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-----------PV..LLSRWI.RELF........DS..D.....GVSDELI......K.DSPPRILlsSSLVPTLFSQAIH.....AA...Q...L...........G......MI-....D..........EET.LKSGLS............V................F....LQDILSFA.LPSGLRWL---......IR.ELA.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------asltlde.................................................................................................................................................................................................................................................
G3JCY3_CORMM/485-909                   ....................................................................................................................................................................................................................................................................................................................vahavv--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.E..DTMSLKLLCTQ..L.-AQ...K...PQ.....SLDII.LLFDK...V.T.SILEPVCSL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.YGAILLLVFAFSYRYNL...S..P.LD...I...GIH...........SA....---....--DSHVAR..II.T.KSHI..LRP---.----..---LDELSEQESE..HVTGWI.NGLFd......nEA..G.....GLGDDLM......S.SCPPHEF..YLLVAPIFQSIIT.....AY...T...Y...........G......YI-....N..........DES.LKGGVE............Y................L....VDTFLLPS.LVPAIRFLSDY......IW.IDQ.K.E..-....-.-.....-..--.QK....SI.V.KAL..QL.L.L.....T..P.S..S.I...S..GE...........ASTVLS..AVK....NLVAQPLEHALRTYQRQD..PR....N--------.----..QDIEP.L...LRSL.....K......EN.....LP.LS.R.--.----.--...-.R.S...............-.-............G...GA.AH..HE..M.--E.......LW.A.NS...S..........S...S..G....LSGAIRHTIQGLv....qWS.AQPGvn............vmpASYT..HR..Q.LIAGL..RIIG...PSRL...LRLVMEEI.RQQSEL--....---.---..---...-.....GNASVVYDVA.AALIAATD.ST.N...E..A...P.AS.T...Q.H---------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------lldtagtmqvrrrglrdalktaaegykrlqkhdpflaeatvrlh............................................................................................................................................................................................................
A0A2H3IVN7_WOLCO/479-732               ....................................................................................................................................................................................................................................................................................................................vslhhp--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..DLDSLSHICKI..L.-SR...H...-E.....LAVDI.VSLHH...PlT.DMVTHALKL......VE-DY................D......-......-..........-.......-.......-....-....--...........-...-.........C.....E...T...V....G.D...........PQT..........AVSH.LGDVVLFLQETVVRYNF...N..H.ST...L...NLG...........DQ....---....---RLNLS..LI.C.SVST..VHT---.----..---TRELSSEDTS..AVQAWA.KALFd......kHS..E.....GIEDTIL......R.NTRPRTL..LHIAATLFSHAIM.....MC...D...E...........G......KM-....E..........KDV.LSDGIS............Y................F....MGPLLNWT.LVGVVKSL---......LS.EIQ.R.R..G....L.N.....A..-P.LH....--.L.EVL..QT.L.L.....L..S.Q..S.C...P..QT..........vIRLSAA..SVL....RLSTSKLQQHVVRF----..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------dwtalqsv................................................................................................................................................................................................................................................
A0A2J6PQP3_9HELO/25-959                ............................................................................................................................................................................................................................................................................................esyvqllsakhplpasrisdlflqpteynd--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......ASL...DPR..VVRy..vQVLVHLGLVT.....VPSVLRAMWKC.SSFRdqdgggarsaplvdnns..............................................gngeaeklgkmeegkrwsNSYI.AEET.LFYR.LT.K.Y.IS..SG.A.APRD.......................................................--..-..-......-T.QE.AV...EL..V..L..SCVQWMRT..V..V.SVQQAA....Qemlg..............................laqtHTAEM.NA.Q.NmAL....GT.......L....IVA.AV...E..S.G.RVLHalgkgn..................vpkhvrKELKD.T.LASFV.P.LL.LQ.S.SPQ............-SAGR..LEV...FRTQ.Tmla...............................iepvDKKE...K..AA-Ak............eIED.I.LEEGMa....lGVE.--Smv................vaEMPT..M..NS..R..A-GL...YVYLNS..LLV.GRPLI.DDHAIFAYLH---NRYQ.GDI..........------QSTIIDLILAAF----.DVL.ANA.TFR.N..E.RA..QSITILRS---FLINKIPPLLAT................-L.SASLfpp..................ltseYCITEALN.....HV.DT-.--..NA..F..P..TLS.GM..F....D..ES....--ST.ND..MFS.D.....S...---.-...--.VRQDFCFACCLHGLIE.ESSIETLLGD.LPI--.--..--.-.--QSLP.A.G..GR..Y.L.K.DDLVQQCLTDpar..................................tegLID......ELEHMDGNVGA......-------................---..-----.---.--....-------.VSQ...AITEVVR....RLCA..N.K..ETMSLKSLCSQ..L.-AR...K...PS.....SLDVM.LLFDK...P.I.SILQPLCEL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGLILLLVLSFAQRYGL...S..V.VD...L...GIR...........TP....---....--DSFVAK..LL.N.QGHL..------.----..SRAMDDLTEQEQS..HLDGWI.RGLF........ET..G.....TLGDELM......S.SCPPQDF..YLLVPTLFHHIVL.....AC...S...T...........K......NLT....D..........-EG.LKSGLE............Y................L....VEPFLIPS.LIPGITWLSSH......LW.ESR.G.D..-....-.-.....-..--.AN....AC.V.AIL..TA.L.I.....T..N.S..S.N...N..TE...........ASQMLT..AIL....NIVAKNLEHSLRWLQRAE.pSR....Q--------.----..-----.-...----.....-......--.....-D.VE.P.LS.KALR.PS...L.G.W...............E.R............R...GA.SD.hTE..L.--E.......SW.T.SS...P..........G...G..G....LVISIKNTIANLv....qWG.LNPGin............inpANYT..HR..Q.ILVGV..KMLG...AKRI...LTAIIEEV.KSQTEN--....---.---..---...-.....GNGSVVLDIA.TALICAPD.PQ.S...W..D...N.GV.P...G.IG-ID----G.........L......GAEIR..PLQRRMTLR.....................................EALKNEAEAAPkAQKTDAFHAETvvrl.....................frkvEAQAQMPQQA--..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------lmshealnihqaldeaal......................................................................................................................................................................................................................................
W9WJK5_9EURO/445-708                   .......................................................................................................................................................................................................................................................................................................................agf--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.ISQ...AIVEIMH....SYCQ..S.K..ETQYLKELANA..I.-IR...K...PA.....AINCV.ALFIR...P.S.FFLSPLCSL......LD-DW................R......-......-..........-.......-.......-....-....--...........-...W.........D.....E...I...H....G.E...........AQP..........VYDD.FGAIFLLILVTKARLDL...P..N.SG...L...GIR...........KK....---....--GGFLSE..YL.R.HENY..------.----..EHSLDDLSEEKKS..HLGNWI.NALY........LA..E.....GLSDELF......T.SCSPHDF..YLLIPTLLRQSVT.....AY...Q...Q...........G......KL-....T..........HDA.LKAGLD............Y................L....LEPFLLPS.LISALGWAGEV......F-.--H.Q.D..-....-.-.....S..AV.IG....KV.L.DVL..TK.-.-.....A..P.G..-.-...T..IE...........SRDIHH..TIL....AMCGPRLKL---------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------rlttsaskdsnigsv.........................................................................................................................................................................................................................................
A0A5N6YXG2_9EURO/2-967                 .........................................................................................................................................................................................................................................................................................................................t-SSEQWGTFLHQCLMHRIDATDFKNLSKLLYRRYPIA-....................----...........................----------...........--------------.....---...-.....EG...TLLG..VLLEIRLa....tgIKW...DPL..LPLy..iDCLCKMGKVQ.....TSTVLTSLLKY.SSIHdkpqssgse..............................................................qgqigktpkcYTLM.TDIR.VIQD.AI.L.S.VS..TG.S.TPKT.......................................................--..-..-......-L.AE.AV...RI..F..S..ATVDWIQA..V..V.AWHTNH....Idpsqq...........................agglmsSPDAV.SL.F.E.SL....GI.......L....LTA.LS...E..T.G.KGIEvlssd...................shaalkVKLGQ.A.LSAYL.P.LC.ME.-.---............VSLPL..RNR...LDSL.Qkgfnlygepps................kslqsmmdnvnVNAL...Q..FEASvm..........ngPVL.N.SRAGL......---.---....................----..-..--..-..----...YIYINA..MLV.GRPLV.DDSMLLNYLT---NRYG.GHY..........------DVLVEEVITATF----.DVL.SNA.LYR.N..E.SS..RTMFLFRS---FLVNKLPSFLAA................-M.LAASmvs..................lpmeLCISHALS.....RL.DP-.--..NT..F..P..SFS.QM..F....A..--....MQGN.TV..L--.-.....-...---.-...SE.VRPEFLFACASHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTPP.V.G..--..Y.N.K.DDLVSQINSNler..................................aeqLIN......EIESTEGNAGA......-------................---..-----.---.--....-------.IVA...AITEVMH....NLCN..Q.K..ETMTLKSICNS..L.-SR...H...PQ.....ALDVI.LFFRS...A.K.HVLQPLCTL......LD-SW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQP..........VYDE.FGSILLLVLTFKYRYDL...R..P.YD...L...GIL...........SN....---....--DSFILK..LL.D.RGSC..------.----..SQKLDDLSDKQNK..NLGAWI.TALF........IA..E.....GISEETM......S.SCSPQEF..YLLVTTLFNQSLA.....AC...E...A...........G......KL-....E..........FDT.LKGGFE............Y................L....LEPFLLPS.LVVALTWLGNH......IW.ETE.S.D..P....T.I.....P..--.--....--.L.KAL..QS.L.V.....N..P.S..S.I...S..GD...........AKEIHR..TVL....NITARSLDEQLKDIRSRH.sNR....T--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DALE.PC...L.S.F...............Q.R............T...GS.CH.rSE..L.--D.......SW.T.TH...S..........P...G..G....LLGSIRSTFQGLv....lWS.TGPGvs............mapHSYT..HR..Q.LVTGI..RMLG...ATRV...FASIVDEL.KIQTET--....---.---..---...-.....GNADLALDIA.ATMICAPL.AE.S...-..-...F.AM.E...Q.SNYHP---VD.........P......NKEPL..PRCPILTLR.....................................DALNLQHENVPkLSEKDPLRAEV.............................VVRLYRRVNALM..................TPTSQ......M..P.....NLDMSNIIQNM..QLGV-.---ED......HGQM.DLEP.A.V..AG.HGVGDDDAANLNRMLDNA----aaa.....................................................................................................................................................................................................................................................
A0A0C4F777_PUCT1/6-155                 ....................................................................................................................................................................................................................................................................................................yhldtqtgftlhyitspstaya--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..---TSELPATHES..VMRVWI.EALY........GS..S.....GIPDALL......G.STDPRIF..FATAATIVKQSFD.....AL...A...V...........G......RI-....D..........LQT.FRDGLS............Y................F....EHKLLIGGaAVGVVGWILDE......LT.RLG.P.F..S....P.T.....-..DY.PT....AL.L.EIL..QA.I.L.....L..S.D..A.I...S..P-...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------talrlvg.................................................................................................................................................................................................................................................
A0A180GP09_PUCT1/455-589               ..................................................................................................................................................................................................................................................................................................................tpstayat--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..----SELPATHES..VMRVWI.EALY........GS..S.....GIPDALL......G.STDPRIF..FATAATIVKQSFD.....AL...A...V...........G......RI-....D..........LQT.FRDGLS............Y................F....EHKLLIGGaAVGVVGWILDE......LT.RLG.P.F..S....P.T.....-..DY.PT....AL.L.EIL..QA.I.L.....L..S.D..A.I...S..P-...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------talrlvg.................................................................................................................................................................................................................................................
A0A545VBL2_9HYPO/18-975                .......................................................................................................................................................................................................................................................................................datrywskfvarcissrlesdrfrsfvrhvhaqhp-----------------------------------LP-....................----...........................----------...........--------------.....---...-.....AL...IVAD..LFLRPQPa....nrVSL...DPR..VPPy..mTVLTQLGFTD.....APSILRVLYKY.SALHtyaarakppmladggdvk.............................................kkegekgeggegeakqekTVRW.QESS.WAEE.VM.FyH.VI..KT.-.---Mf....................................................egIA..F..N......DA.KT.GL...EL..V..S..VTCKWMDL..F..V.NASSAF....Avdvlan..........................khdrqaREEME.TV.R.A.AL....VP.......L....LLR.LV...D..N.A.TLLRiisrp...................fakgvrKHLSE.S.LGNFI.Q.TF.QP.P.PLY............VERLE..IFR...TQTL.Aql..................................dpI---...-..DENKraan......aamdELL.D.STVGL......ESF.VIAd..................iPISN..S..RA..A..L---...YVYLNA..ALV.GRPVL.DDAMLYAFLN---NKYQ.ENQ..........------QASAVDLIVASF----.DVL.ANA.VFR.N..E.GP..KDAHLLRS---FVVNKLPLLLCQlch..........pefSA.TSAE.........................FCITEALS.....RV.DT-.--..SI..F..P..TAS.LM..F....D..ES....RNNN.PY..M--.-.....-...---.-...DS.VREEFCAACALHGLIE.RDHVDRILGE.TSMS-.--..--.-.-YD--P.S.L..ER..A.N.R.DRLVSDCLSDsgk..................................iqnIIS......QLDRVDGNVGA......-------................---..-----.---.--....-------.VAN...AIVELIR....QLCI..N.K..DTMSLKLLCTQ..L.-AQ...K...PQ.....SLDII.LLFDK...I.T.SILEPVCTL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.YGAILLLVFAFTYRYNL...S..P.LD...I...GIQ...........SV....---....--DSHVAK..II.T.QSHI..LRP---.----..---LDELSEQESG..HVTGWI.NGLFd......nET..G.....GLGDDLM......S.SCPPHEF..YLLVAPIFQSIVT.....AY...T...Y...........G......YI-....N..........DES.LKGGVE............Y................L....VDTFLLPS.LVPAIRFLSDY......IW.VDQ.K.E..-....-.-.....-..--.QK....SI.V.KAL..QL.L.L.....T..P.S..S.I...S..GE...........ASTVLS..AVK....NLVAQPLEHALRSYQRQD..PR....N--------.----..QDIEP.L...----.....-......--.....--.--.-.-L.RSLK.ES...L.P.L...............S.R............R...TG.GA..EH..H.EMG.......SW.A.NS...S..........N...S..G....LSGAIRHTVHGLv....qWS.VQPGvn............vmpASYT..HR..Q.FITGL..RIIG...PSRL...LRLLMEEI.RQQSDL--....---.---..---...-.....GNATVVYDVA.AALVSATD.ST.N...E..Ap.pP.AP.P...V.ANLLD-----.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------tagsmqappqrpqslrdalktaaegyrrlqkhdpflaeavvrlhrrvemllvvpqaqailqtad........................................................................................................................................................................................
A0A3M7LV32_9PLEO/246-1224              ........................................................................................................................................................................................................................................................................................................................sm--VEEWKVFLHRCIASRIPPDVFATAVAQLHAKSPLP-....................----...........................----------...........--------------.....---...-.....GR...KLAA..LVLLRRT.......ASI...DPR..SLAi..lEQLLALRKID.....ASDVLTVTFLH.SKDRrsintgde................................................................ktpkdaqwsNPPE.LEEI.IFHR.LH.R.A.FS..SE.E.RPIN.......................................................--..-..-......-N.TE.GL...RT..L..I..IVTRWMQA..M..V.TSHTSD....Tmiqam...........................agiqqpHQQSI.NA.R.E.GL....AM.......L....VIG.VI...E..N.S.KILVilsnp...................kgkdirKHFVQ.S.LCSFI.P.FL.HN.N.SAGs..........qTSLSL..ANR...LEMS.Q......................................KQHD...F..FEKL.............pDVN.G.EKNES.....tGLE.VAAlql.............davmELPQ..V..N-..T..RAGL...YVFLNA..LLV.ARPLT.DDFTIISHLH---SRYK.LEA..........------QNMATDLITAAF----.DIL.ANA.MYR.N..E.QT..QTLFYFKS---FLANKVPILLTQ................-L.SGSVfpm...................tveMCITQALS.....HV.DP-.--..HA..F..P..SFS.QG..F....D..DI....MGSN.NS..L--.-.....-...---.-...SD.VRQDFLNACALHGLIT.ASTVERLLGE.APM--.--..--.-.---QGP.P.A..KR..Y.E.R.KELLDQCKTNfdk..................................vslYID......ELENLDGNAGA......-------................---..-----.---.--....-------.IVA...AVTDFIS....HLCE..T.Q..TTMYLKQLSCL..I.-FR...K...PQ.....AMDVM.LQFVS...P.P.SILRPLCQF......LD-DW................H......-......-..........-.......-.......-....-....--...........-...Y.........D.....S...D...Q....G.E...........HQP..........VYDE.FGAILVLIMTFMYRYDL...T..Y.HD...I...GVG...........R-....---....--DSFIAK..LM.E.RGHH.gM-----.----..--LPDELTEEQGK..HLGDWL.KGLYd......sDK..E.....GLSNDVF......T.SCRPQEF..YLIVPTLFRQTVV.....AC...S...T...........G......VL-....S..........FET.VKGGLE............Y................L....GETFLLPS.LIGGLTWMASY.....aLL.QTH.N.D..-....-.-.....-..--.LD....AM.I.RIF..NE.V.I.....L..S.T..P.T...S..GD...........AQAMHS..TIV....AMVSSRLEKCFRTLQRRE.pNR....T--------.----..-----.-...----.....-......--.....-T.LE.P.FI.QAIK.AH...S.H.Y...............E.R............T...AY.AT.lKE..L.--D.......QW.T.NV...P..........H...S..T....LNTSLRHTVQQLs....qWA.STASlq............pnpPSYT..HR..Q.IYASL..KLLG...ATRT...LRAIVEEV.KNQTDA--....---.---..---...-.....GNGAAALDIG.ISIICAPM.VE.D...S..P...V.SV.D...W.VG-------S.........P......IPSPA..PKRTRMNLR.....................................EILKQEFDSAAnLVATDALTAETivrlhrrv.............eahfaslgETGLQAPPINIP..................-----......-..-.....----SVHIADM..QSQTI.SDDLN......RAID.DAAA.A.S..IV.DDISNMDNKALQRSMDEL----tase....................................................................................................................................................................................................................................................
S7ZKI7_PENO1/5-953                     ........................................................................................................................................................................................................................................................................................................................ms-SVDQWKTFVKRCLARRVDVEEFQDLTQLMQRRVPLK-....................-ENE...........................----------...........--------------.....---...-.....--...-LLD..LLFETRSt....vnVTW...DPL..LPVy..vEGLCKARQVK.....AASALKRLLAH.STIRkgpe........................................................................skcktSTFM.TDIK.VIQD.VM.L.S.IS..TG.A.IPRV.......................................................--..-..-......-I.PE.AA...EL..Y..D..ATAEWILA..V..V.EWYNQT....Aseqn.............................ggattSADAL.SL.F.E.SL....GI.......L....LAA.LS...G..T.N.KGLEmlssd...................hykdlrTKLGR.A.LTAYI.P.LC.VE.-.---............VSLPL..RQR...LDAL.Qkefnlfgdqts...............kqldqssmqsinVTSL...Q..FEASvm..........dgPVI.N.TRAGL......---.---....................----..-..--..-..----...YVYLNS..MLV.GRPLV.DDALLVNYLT---NRYE.GHQ..........------EVLVVELTTAAF----.DVL.CNG.VNR.N..E.SS..RTMFLFRS---FLVNKLPAFFAA................-M.IAASmvp..................ipmeMCVTQALS.....RL.DP-.--..NS..F..P..SFS.QM..F....S..--....MQGS.SI..L--.-.....-...---.-...SD.ARQEFLFACASHRLIQ.ESSIERLLGE.NPM--.--..--.-.--QTVP.V.G..GP..Y.Q.K.DDLVSQINNSpgr..................................aeqLIG......EIESMEGNAGA......-------................---..-----.---.--....-------.IVG...AITEVML....NLCN..Q.K..ETMTLKNICNS..I.-SR...R...PQ.....TLDVI.LLFRT...T.K.QVLQPLCAL......LD-SW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........NQP..........VYDE.FGGILLLVLVFKYRYNL...T..P.AD...M...GIS...........SS....---....--DSFILK..LL.D.RGSC..------.----..SQRLNELNEKQNK..DLGAWI.GALF........IA..E.....GISEETM......S.ACSPQDF..YMLVATLFDQSLG.....A-...-...-...........-......---....-..........---.------............Y................L....LEPFLLPS.LVVALIWLGNH......IW.QSE.I.E..P....E.I.....P..--.--....--.L.KAL..YS.L.V.....K..P.S..S.I...S..GE...........AQAIHK..TVL....NITARPLEEQLKDVRTRH.qAR....Q--------.----..-----.-...--NI.....D......KI.....SN.IK.P.IL.DALD.PY...L.S.F...............R.R............V...GG.CS.rSE..L.--D.......TW.A.AP...A..........T...G..G....LLGSIRGTLQSLt....mWS.ASSDin............lqpQPYT..HR..Q.LLAGI..NLLG...TTRI...LNTLVEEL.KHQAQA--....---.---..---...-.....GSGDFALDIV.ATMVCAPI.PE.S...F..A...V.EQ.N...V.VH-----SVD.........P......AKEAM..PRCAILTLR.....................................DALSILHQNVPkTSEKDPLTAEIivr......................lwrrVSLLSAPPSRVS..................-----......-..-.....NIDVSNIIQNM..EL---.-----......----.----.-.-..--.----------------------gvdgqnrmdldmtggtvdnngggehdpgnidrmldnaa..................................................................................................................................................................................................................
A0A165CWQ1_9BASI/634-769               ................................................................................................................................................................................................................................................................................................................alltpsrphp--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..---LRTLTEDERS..LLARWL.KALF.......sPN..E.....GIDDPML......R.ATDPAML..LRLTTTFFHQAIL.....AR...S...L...........D......VI-....D..........SET.LHNGVG............Y................F....LSGLLSWT.LVGIVQYL---......-A.AEA.E.R..Q....G.P.....Y..SS.LH....--.F.EIL..QM.I.L.....V..S.E..S.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------cpkpvlavtgasv...........................................................................................................................................................................................................................................
G3YA07_ASPNA/2-985                     .........................................................................................................................................................................................................................................................................................................................t-SSEQWGTFLQQCLLHRIDAAEFKNLTRLLMQRYPIA-....................----...........................----------...........--------------.....---...-.....EA...QLLD..VLLETRLa....tgIKW...DPLppLYI....DCLCKMGLVR.....TSTMLNSLLKH.SSIHdklqspggse.............................................................avqgkqkrkcYTLM.TDIR.VVQD.AM.L.S.VS..TG.T.AFKT.......................................................--..-..-......-F.AE.AL...SI..F..A..SIVDWIQA..V..V.AWHNSH....Ldtshq...........................tgglmsSPDAV.SL.F.E.SL....GI.......L....LAA.LS...G..T.A.KGLEvlsadsheg............ftdglialkIKLGQ.A.LSAYL.P.LC.VE.-.---............VSLPL..RNR...LDSL.Qkefnlfgepps...............kaldvsmmenvnVNAL...Q..FEDSvm..........dgPVI.N.SRAGL......---.---....................----..-..--..-..----...YVYINA..MLV.GRPLV.DDSMLLNFLS---NRYG.GHY..........------QVLIEELITASF----.DVL.SNA.SYR.N..E.SS..RTMFLFRS---FLVNKLPTFIA-................AM.LAASivsl................plpmeLCISHALS.....RL.DP-.--..NT..F..P..SFS.QM..F....A..--....MQSN.TV..L--.-.....-...---.-...SD.VRQEFLFACASHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTLP.V.G..GP..Y.N.K.DDLVSQINANper..................................aeqLIN......EIESMEGNAGA......-------................---..-----.---.--....-------.IVG...AITEVMH....HLCN..Q.K..ETMTLKNICNS..L.-SR...R...PQ.....ALDVI.LLFRS...L.K.QVLQPLCAL......LD-AW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQP..........VYDE.FGSILLLVLTFKFRYDL...R..P.QD...M...GIG...........GS....---....--NSFVLR..LL.E.NGFC..------.----..SQKLDDLSEKQNK..NLGSWI.NALF........MA..E.....GISEETM......S.ACSPQEF..YLLVTTLFNQSLG.....AC...E...A...........G......KL-....D..........FDT.LKGGFE............Y................L....LEPFLLPS.LILALNWLGNH......IW.ESE.S.D..P....S.I.....P..--.--....--.L.KAL..HS.L.I.....S..P.S..S.I...S..GE...........AKEIHR..TVL....NITARSLEEQLKSVRARQ..PD....D--------.----..-----.-...----.....-......--.....-T.IK.P.IL.EALD.PH...L.S.F...............Q.R............S...GS.TH.rSE..L.--E.......SW.T.AH...T..........P...G..G....LLASIRSTFQSLi....lWS.TSPDms............mapQSYT..HR..Q.FIAGI..HIQG...SMRV...LCALIDEL.KLQATT--....---.-SP..TNA...T.....GSSDLALDIA.ATMICAPL.AD.S...F..A..vD.QN.T...Y.SPHHHMDPTN.........T......NKEIP..PRNPILTPR.....................................GALYQLHESVPkICEKDPLRAEIivr......................lwrrVNAALTPPSQLD..................--MNN......-..-.....------II---..-----.-----......----.----.-.-..--.----------------------qnmqlgvgvggpgqmdldtsgaggheeestinqmldnav.................................................................................................................................................................................................................
A0A2H3C2I6_9AGAR/446-694               ................................................................................................................................................................................................................................................................................................eahtlfdrickeaathsafasvvmkr--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-----FI....SLST..S.F..DVEALSRLCKA..L.YLR...H...-R.....ILDII.SLHVK...I.D.ELLYQTVSL......VD-SY................D......-......-..........-.......-.......-....-....CE...........T...I.........G.....D...P...-....-.-...........-QT..........AVSH.LGDIVMFSQYTLAHFNL...D..A.KM...F...VQG...........D-....---....--RTVSGL..FL.Q.SATQ..VFS---.----..---HESLSGEDAQ..AFNAWF.KTLFd......sGS..E.....GIEDTIL......R.SSRPKTL..LKIASTLFSSAIN.....AR...I...E...........G......KI-....D..........GDT.LNNGIS............F................F....TGPLLSWT.LVGVVRSL---......LQ.EIY.R.K..G....F.M.....A..--.-P....VH.I.EVL..QT.L.L.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------lspscpk.................................................................................................................................................................................................................................................
A0A1Y2W8S8_9PEZI/309-998               .....................................................................................................................................................................................................................................................................................................................sragl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...YIYLNA..ALI.GRPLI.DDNALFTYLH---NRYQ.GDI..........------QSTTIDLILASF----.DVL.ANA.VFR.N..E.NQ..QSSHLLRS---YLINKLPLLLAT................LS.TSMYppl...................saqFCITEALS.....QV.DT-.--..NA..F..P..TLS.AM..F....D..DT....HNNN.T-..-FT.D.....-...---.-...-S.VRQDFCFACCLHGLIP.ESSIEGLLGE.ITY--.--..--.-.--QTLP.Q.A..GR..Y.V.K.EQLVEECMNDper..................................iprLIN......ELDNMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALAEVIG....RLCH..N.K..ETMTLKLLCGQ..L.-AK...K...PL.....SLDVM.LLFEK...P.F.TMLNPLCEL......LE-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.FGSVLLLVLAFIYRYNL...S..P.TD...I...GIR...........Y-....---....--DSFVAD..VL.N.----..IHQNFK.T---..---NEELTTQEDT..HLGGWI.RGLFd......tES..G.....GLADELL......R.SCPPRDF..YKLVPTLFNQIIM.....GF...S...S...........G......KI-....D..........DES.LKTGVE............Y................L....VNTFLLPS.LVPAILYMSNQ......LW.I-E.I.G..P....N.N.....-..--.-R....SV.L.RIL..QL.I.L.....L..T.K..Q.G...S..TE...........AQIMLS..SVL....NIIARPLEYGLRSYQRYD..PK....S--------.----..QAVEP.L...LKAM.....R......DN.....LR.LS.-.--.----.--...-.-.R...............-.R............T...AS.AA.nNE..L.--E.......TW.S.ST...A..........N...G..G....LAMSIRHILHGFi....tWS.AHPNln............vmpTNYT..HR..H.ILTAL..KLHG...AKSF...LYTILDEV.KAKTEA--....---.---..---...-.....GHGSIAHDVA.TALICAPD.VT.N...M..P...P.PP.E...L.APVMS----S.........S......NHPVA..PPQLRTSLR.....................................AALRDEAEDCKiIQKTDPLMAEIivrl.....................yrkvEAQMLEPPPT--..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------esmlqgqlanlglsednaavlgdalaaaaqsdgldaddgnms..............................................................................................................................................................................................................
A0A2I2GNC4_9EURO/2-966                 .........................................................................................................................................................................................................................................................................................................................t-SSEQWGTFLHQCLMHRIDAAEFKNLSKLLLQKCPIG-....................----...........................----------...........--------------.....---...-.....ET...PLLN..VLLETRLa....tgIKW...DPL..LPLy..vDCLCKMGQVQ.....TSTVLHSLLKY.SSIHdrpfsadset.............................................................aanpkkpskcYTFM.TDIR.IIQD.AM.L.S.IS..TG.H.APKS.......................................................--..-..-......-L.AE.AV...GI..L..A..AIVDWMQA..V..V.SWHNNH....Ldasqq...........................aegllsSPDAV.SL.F.E.SL....GI.......L....LAA.LS...G..T.T.RGLDvlssn...................shealkVKLGQ.A.LSGYL.P.LC.ME.-.---............VSLAL..RNR...LDSL.Qkefnlygephs...............ksleesmmdnvnVNAL...Q..FEASvm..........dgPII.N.SRAGL......---.---....................----..-..--..-..----...CIYINA..MLA.GRPLV.DDTMMLNFLT---NRYG.GHN..........------EVLIEEIITAAF----.DVL.SNA.MYR.N..E.SS..RTMFLFRS---FLVNKLPGFFAA................-M.LAASvvs..................lpmeLCISHALS.....RL.DP-.--..RI..F..P..SFS.QM..F....S..--....MQGS.TV..L--.-.....-...---.-...SD.VRQEFLFACASHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTVP.V.G..--..H.N.K.DHLVSQINMHper..................................teqLIG......EIESTEGNAGA......-------................---..-----.---.--....-------.IVG...AITEVMF....NLCN..Q.K..ETMTLKNICNS..L.-SR...R...PQ.....ALDVI.LLFRS...P.R.QILQPLCAL......LD-SW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQP..........VYDE.FGSILLLVLTFKYRYDL...K..P.YD...L...GIG...........NN....---....--DSFVLK..LL.E.RGSC..------.----..SQKLEDLNEKQNK..NLASWI.GALF........IA..E.....GISEETM......S.ACSPQEF..YLLVATLFDQSLG.....AC...E...A...........G......KL-....E..........FET.LKGGFE............Y................L....LEPFLLPS.LVVALAWLGNH......IW.ESE.N.D..P....S.I.....P..--.--....--.L.KAL..HS.L.V.....S..P.S..S.I...S..GE...........AKEIHR..TVL....NITARPLEEQLKDIRTRQ.qSR....T--------.----..-----.-...----.....-......--.....-D.LK.P.IL.DALE.PC...L.S.F...............Q.R............T...GS.CG.rSE..L.--D.......GW.T.-Q...A..........P...G..S....LLGSIRSTFQALm....lWS.TSPDvs............mtpSAYT..HR..Q.LIAGI..RILG...SVRV...LGALIEEL.KLQTEA--....---.---..---...-.....GNGPLTIDIA.ATMICSPL.AE.S...-..-...F.AV.E...Q.SHYHP---VD.........P......SKEAL..PRCPILTLR.....................................DALLIQHENVAkMSEKDPLRAEI.............................VVRLQRRVNALT..................APTTQ......M..P.....NLDMSNIIQNM..QLG--.-----......----.----.-.-..--.----------------------vegpgqmdlepsgagpevgeddatnltrimgnaa......................................................................................................................................................................................................................
A0A1R3RTF0_ASPC5/2-945                 .........................................................................................................................................................................................................................................................................................................................t-SSEQWGTFLRQCLLHRIDATEFKSFTQLLLQRSPIT-....................----...........................----------...........--------------.....---...-.....EA...PLLD..VLLETRLa....tgIKW...DPL..LPLy..iDCLCKMGVVQ.....TSTVLNSLLKY.SSIHdkppspnqe..............................................................mvqskqrrkcYTLM.TDIR.VVQD.AM.L.S.VS..TG.S.APKT.......................................................--..-..-......-F.LE.AI...GI..F..T..SIVDWVQA..V..V.AWHNSH....Mdanhq...........................tgglmsSPDAV.SL.F.E.SL....GI.......L....LAA.LS...G..T.A.KGLQvlsads..................hegtlkIKLGQ.A.LSAYL.P.LC.VE.-.---............VSLPL..RNR...LDGL.Qkefnlfgepss...............kaldvsmmdnvnVNAL...Q..FEDSvm..........dgPMI.N.SRAGL......---.---....................----..-..--..-..----...YVYINA..MLV.GRPLV.DDSMLLNFLS---NRYG.GHY..........------QVLIEEIITATF----.DVL.SNA.SYR.S..E.SS..RTMFLFRS---FLVNKLPAFIAA................-M.LAASmvs..................lpmeLCISHALS.....RL.DP-.--..NT..F..P..SFS.QM..F....A..--....MQSN.TV..L--.-.....-...---.-...SD.VRQEFLFACASHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTLP.V.G..GP..Y.H.K.EELVSQINANper..................................teqLIN......EIESMEGNAGA......-------................---..-----.---.--....-------.IVG...AITEVMH....HLCD..Q.K..ETMTLKNICNS..L.-SR...R...PQ.....ALDVI.LLFRS...A.K.QILQPLCAL......LD-AW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQP..........VYDE.FGSILLLVLTFKFRYDL...R..P.HD...M...GIG...........GS....---....--NSFVLR..LL.E.NGFC..------.----..SQKLDDLSEKQNK..NLGAWI.NALF........MA..E.....GISEETM......S.ACSPQEF..YLLVSTLFNQSLG.....AC...E...A...........G......KL-....E..........FET.LKGGFE............Y................L....LEPFLLPS.LILALNWLGNH......IW.ETE.S.D..P....S.I.....P..--.--....--.L.KTL..QS.L.V.....N..P.S..S.I...S..GE...........AKEIHR..TVL....NITARSLEEQLKGIRARQ..PE....---------.----..-----.-...----.....-......--.....-D.IK.P.IL.DALE.LC...L.S.F...............H.R............S...GS.CH.rSE..L.--E.......SW.T.SH...A..........P...G..G....LLASIRSTFQSLv....lWS.TSPGms............mapQTYT..HR..Q.LLAGI..QIQG...SARV...LTTIIEEL.KLQTEA--....---.---..---...-.....GSGDLALDVA.ATMICAPL.AE.S...-..-...F.AV.D...Q.NSYSH-HPVD.........P......SKEPL..PRCPILTLR.....................................GALFIQHENVPkLSEKDPLRAEVivr......................lyrrVNALMTPPSQVP..................-----......-..-.....NLDMNNIIQNM..QL---.-----......----.----.-.-..--.----------------------gvggpgqmdle.............................................................................................................................................................................................................................................
L8FUP4_PSED2/57-761                    ......................................................................................qvslyaqallrtdildvpsvlrallrhstsrpvdaakeeqevasgsqtrwtksygheerlvyglskivaagdrpksaqealgtanvltewmrllvmsnaaddmmreigagndnhnqeamavrvavgallvalaenatvnealknrcpkdtlkgfsqslahftpllingssmfaerlelytktlvamepidkkaqkagaeidqiidsamalgmdnipvveiptmnsrag--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..---L...YVYLNS..LLT.GRPMV.DDNQLLNFLH---NRYQ.GDI..........------QTTCIDLIVSSF----.DIL.ANA.IFR.S..E.NP..QTTFLLRS---FLINKVPLLIC-................-M.ISAPmfpp.................lspeLCITEALS.....HV.DT-.--..NA..F..P..TFS.SM..F....D..DN....--SA.GD..MFS.D.....S...---.-...--.VRQDFCFSCCLHGLIP.EESIERLLGE.IPM--.--..--.-.--QTLP.A.G..GR..Y.S.K.DEVLEQCLSDsek..................................ieaFTD......ELEHMDGNVGA......-------................---..-----.---.--....-------.VSQ...AITELLR....RLCE..S.K..DTMALKSLCAH..L.-AR...K...PS.....SLDVL.LIFDK...P.L.TILPPICQL......LD-AW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...D...Q....G.E...........YQP..........VYED.FGSILLLVLAFVYRYDL...S..A.TE...L...GVQ...........TP....---....--DSFIAK..LL.V.RVST..------.----..ARLLDDLSSVESS..QLDGWI.KGLFn......aEG..G.....GLGDEPM......A.LCPPQDF..YLLVPTLFSQIVL.....AS...Q...H...........G......HLT....D..........-DV.LRGGLE............Y................L....LDPSLLPS.LIPALLSL---......AS.NIL.T.A..P....P.P.....P..--.--....--.-.SLL..QA.L.I.....L..P.Q..S.I...S..AE...........ASLLHN..AIL....PIPAPHLSRSLRALQRSA.pTR....T--------.----..-DLDP.L...I---.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------aalrphlhfsrttidit.......................................................................................................................................................................................................................................
A0A1E4T1X3_9ASCO/386-835               ....................................................................................................................................................................................................................................................................................mskdeflsaydqkfhqmnpefvsieeaeihsfinqine--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....ALSLKSV.LSE...QVNSSIS....NFIK..E.N..DSLRLRRLLIS..L.TLN...E...-E.....ILEYV.LLNES...P.Y.EFILPLVAY......LNKNL................N......ElpearnS..........K.......Q.......E....A....QD...........De.mM.........E.....DldmSggeS....T.N...........VQD..........FYTD.FGSILIFLKLITMKFNL...N..L.LQ...V...PGN...........YA....---....-----SLQ..LI.N.NWDS.tKNDTYL.TNVQ..E-----QGSQLNN..MIDEWI.LSLFd.....ssNT..D.....GLSDDLI......K.ACSINDY..YYMLPDILKEAVI.....SC...S...L...........H......LI-....D..........DDS.LLSGLE............Y................F....HQPFLISN.MASILKSL---......LC.FTW.A.N..N....K.E.....A..DI.AI....-L.V.KVL..NQ.L.C.....-..H.A..D.L...S..GE...........VQILHT..LIM....KIMNEDLTKALTPYKDNT..DVasflSKLEPLDSN.VSNG..TDLNN.L...ITYV.....IdptfqeAK.....FE.LS.M.IF.KIAD.SY...S.S.N...............V.-............D...WF.YN..KL..L.FLL.......ES.E.HT...K..........Q...A..D....LAEILSYEVISLl....iVN.YASS................kPTSN..LK..Y.WRSVL..N---...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------aaseks..................................................................................................................................................................................................................................................
A0A2C6A4A7_9HYPO/41-952                ..............................................................................................................................................................................................................................................................................................................lvfanhslpplf--------------------------------------....................----...........................----------...........--------------.....---...-.....--...-VAD..LFLKPQPt....ndVSL...DPR..IPPy..iQILSQLDIVD.....APSILHTLYRY.SSLHsqlrhppnahgrqdaasqkh.........................................epqrrwrssswaeevmfyhvI---.----.----.--.K.M.VV..EG.S.V---.......................................................-F..R..D......MR.S-.AL...VL..V..K..IICKWMNL..F..T.SVSAAF....Aadalgd..........................vqnsqvRDEMD.VA.R.A.AF....VP.......L....LLR.LV...E..T.P.ALVKaisrp...................vaknvrRELSE.S.LAGFM.H.TL.QP.A.PGF............VERLE..IFR...SETL.Ar...................................ldPLDK...K..SEAA..............ANA.A.MDELLe....pSVS.LANf.................viPEIP..I..SN..T..RAGL...YVYLNA..TLV.GRPLI.DDTVLLSFLH---NRYQ.GET..........------QSSAIDLILASF----.DIL.ANT.VFR.N..E.GP..KDAHLLRS---FLINKVPLLLCQlfs..........pqfST.TSSE.........................FCITEALN.....QV.DT-.--..SV..F..P..TAS.LM..F....D..ES....RSNN.PY..T--.-.....-...---.-...ES.VREEFCTACALHGLVQ.REHVERILGE.TSMS-.--..--.-.---YEP.S.L..EK..Y.S.K.DKLVQTCLSDpek..................................iqgLIR......ELDKMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALVELMR....QLCN..S.K..ETMSLKLLCSQ..L.-AQ...K...PQ.....SLDIV.LLFEK...L.P.AVLEPLCQL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...D...Q....G.E...........YQP..........IYEE.FGAILLLVLAYAYRYNL...T..A.AD...I...GIT...........SP....---....--DSCVAK..IL.S.RAHS..------.----..SRQLNELTEQENG..HIGGWI.HGLFd......sET..G.....GLGDDLM......S.SCPPQEF..YLLVATLFQNIVV.....AY...S...H...........G......YL-....N..........DES.LKSGIE............Y................V....VDTFLLPS.LVPAIRFLADY......LW.VEQ.R.E..-....-.-.....-..--.QK....SI.I.KIL..QL.I.L.....L..P.S..S.I...S..GE...........ASTMLT..SVK....NLVAKPLEYSLRSYQKQD..PK....---------.---N..QDIEP.L...LR--.....-......--.....--.--.A.LR.DSLP.LS...R.R.T...............-.-............G...GA.EH..NE..M.--E.......SW.S.NS...S..........S...S..G....LAGAVKYTVQGLv....qWS.MHHGin............vmpTSYT..HR..Q.MIATC..RVVG...TSRV...LRMMLEEI.RHQSEA--....---.---..---...-.....GGASAVYDVV.AALVCAPD.VT.N...E..P...P.AT.A...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------glldatgnvgagarrrltlrdvlkseamdcrkihkkdatlaemvvrlhrrveaqmvlpqpqailqaq.....................................................................................................................................................................................
A0A2T3A1P9_9PEZI/240-1004              ...............................................................................................................................................................................................................................sytksvrralskslanfvpalvqgssqetqgtaqiaaklemfrtqtlagfepvdkknqaaneemnelfdetiglqnvvlqpldiarsragl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...YIYLNA..ALI.GRPLL.DDASLYSYLH---NRFE.GDI..........------QSTAIDLILASF----.DVL.ASA.IFR.N..E.GQ..RSAHLLRS---YLINKVPLILAS................FA.ATASpmyp.................fnseLCITNALS.....RV.DT-.--..NT..F..P..TLS.SL..F....E..SG....--EN.NP..F--.-.....-...---.T...ES.VRSDFVTACCLHGLVP.ESSIDKLLGD.YAY--.--..--.-.--QTLP.A.G..GR..Y.V.K.DKLVQECVADhdr..................................mlrLIT......ELEKMEGNAGA......-------................---..-----.---.--....-------.VCQ...AMTEMLS....RLCS..N.K..ETMTLKQLCSQ..L.-AR...N...PL.....NLDVL.LLFDK...T.H.TVLTPVCEL......LD-NW................G......-......-..........-.......-.......-....-....--...........-...Y.........E.....D...D...Q....G.E...........YQP..........VYEE.FGSVLLLLLAFVYRYNL...S..A.SD...L...ALR...........SP....---....--DSFIAK..LL.G.KGQV..------.----..SRSLEELSEQERS..NLDGWI.HGLF........DNdgG.....GLADELL......S.SCPPQNL..YILIPTLFHHIVL.....AF...S...T...........G......YL-....T..........EES.LKTGIE............Y................L....VEPFLLPS.LVTAIIYLSNC......LW.TDR.S.E..E....-.-.....-..--.NK....AI.I.KIL..QL.I.L.....K..P.T.qK.L...S..PE...........SSDMLN..SVR....NIVAKPLENGLRNYQRQN..PK....---------.----..-----.-...----.....-......-S.....LD.VE.P.LL.SVLK.DN...I.E.L...............S.R............R...TG.AA..GV..Q.EVE.......TW.S.NS...S..........S...G..G....LLANIKHTVHNLt....mWS.MQQTa..............mtASYA..HR..Q.ILLGL..KLLG...AKRV...LYAIFEEL.KSQTEA--....---.---..--N...S.....GSALYGYDVA.VALVCAPD.VT.N...T..V...D.SA.P...P.VSSLEDAAAQ.........-......-VTRV..PPQRRLSLR.....................................DALKWEAEGWKkIQKKDPVIAEI.............................VVRLYQKV----..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ekqmapaaiampsldtaaaiadalvvddataaavma....................................................................................................................................................................................................................
A0A4V3XC21_9AGAM/454-705               ..............................................................................................................................................................................................................................................................................................................ledipnhplial--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...MIQKRFD....NLCQ..Q.H..DVEGLGILCKV..L.--N...L..hDL.....ALDIV.SLHVK...V.T.DILAYILAF......VE-EF................-......-......-..........-.......-.......-....D....CE...........F...V.........G.....D...P...Q....-.-...........--T..........AVGH.LGNVVLFLQATLVKYQL...S..S.HV...F...MLG...........DR....---....---LLATD..YL.L.STST..---VYR.----..---MSQLGGEDIS..AMAAWP.KALFd......kNS..E.....GIEDNIL......R.TTKPKTL..MKLAASLIMQASN.....AC...A...D...........R......RL-....E..........AET.LSNGVS............Y................F....TGPLLNWT.LVGVIKAL---......LR.DIL.E.K..N....F.K.....A..--.-P....VH.L.DVL..QT.L.I.....E..S.T..S.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------cpqtvllltahglla.........................................................................................................................................................................................................................................
A0A1Y2AUX0_9TREE/616-732               .................................................................................................................................................................................................................................................................................................................rralslgdw--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------EQTQRG..LLNGWI.KALF........GS..D.....GIDDQIL......S.ATSLQDF..YRLAPSLIQQAIA.....AR...A...A...........G......QI-....D..........IDT.LYSGLS............Y................F....SQDLLSWS.LGGIVAWL---......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ceetvrngpvsglhlqvlqrlvlgda..............................................................................................................................................................................................................................
A0A5C2SPC3_9APHY/558-693               ..........................................................................................................................................................................................................................................................................................................rqlnpeflrtagmnvr--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..---ADALTGDEPG..AFTSWI.KALFd......pGS..E.....GIEDTIL......R.ATRPKTL..LKIAPFLFAHAIH.....QM...T...E...........S......KIK...mD..........KDV.LNNGIS............Y................F....LGPLLNWT.LAGVIRFL---......LS.DIQ.R.R..G....Y.M.....A..-P.VQ....--.L.DVL..KT.L.L.....T..S.P..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------scppt...................................................................................................................................................................................................................................................
A0A2N6NKW8_BEABA/524-882               .....................................................................................................................................................................................................................................................................................................................haive--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...PQ.....SLDII.LLFDK...V.T.SVLEPVCTL......LD-NW................N......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.YGAILLLVFAFTYRYNL...S..P.LD...I...GIQ...........SA....---....--DSHVAK..II.A.KSHI..LRP---.----..---LEDLNEQEAE..HVAGWI.TGLFd......nET..G.....GLGDDLM......S.SCPPHEF..YLLVAPIFQSIIT.....AY...T...Y...........G......YI-....N..........DES.LKGGVE............Y................L....VDTFLLPS.LVPAIRFLSDY......IW.IDE.K.E..-....-.-.....-..--.QK....SI.V.KAL..QL.L.L.....T..P.S..S.I...S..GE...........ASTVLS..AVK....NLIAQPLEHALRTYQRQD..PR....N--------.----..Q----.-...----.....-......--.....-D.IE.P.LL.RSLK.EN...L.P.L...............S.R............R...TG.GP..EH..H.EMV.......SW.A.NN...S..........N...S..G....LSGAIRHTIQGLv....qWS.LQPGvn............vmpTSYT..HR..Q.LITGL..RIIG...PSRL...LRLIMEEI.RQQSEL--....---.---..---...-.....GNASIVYDVA.AALIAATD.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ptneap..................................................................................................................................................................................................................................................
A0A167V6B5_9AGAM/454-575               ......................................................................................................................................................................................................................................................................................................................iyta--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..----EEFTGENAT..AFSAWF.KALFd......sSS..E.....GIEDTIL......R.STKPWTL..LLIAPTLFSHAIA.....AR...A...A...........G......KI-....D..........ADV.LNNGVS............Y................F....TGPLLNWT.LVGVIKAL---......LG.EIQ.Q.R..G....A.S.....A..--.-G....TH.L.DVL..QA.L.L.....L..T.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------atcpqpv.................................................................................................................................................................................................................................................
A0A2A9PH30_9HYPO/99-853                .................................................................................................................................................................................nlftaasaafatnvlaqvqysqarddmevsraaflplllrlvetpalveamshpfakdvrkdlsqsltgfmhtlqpapgfierldmfrsetlarldppfkkkqadastamdellepalrldnfvvpdmpisnsragl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...YVYLNA..ALV.GRPLI.DDVLLLAFLH---NRYQ.GET..........------QSGAIDLILASF----.DIL.ANT.VFR.N..E.GP..KDAHLLRS---FLINKLPLLLCQlfa..........sqfST.ASSE.........................FCITEALN.....QV.DT-.--..SV..F..P..TAS.LM..F....D..ES....RSNN.PY..T--.-.....-...---.-...ES.VREEFCTACALHGLVQ.REHVERILGE.TSMS-.--..--.-.---YEP.S.L..EK..Y.S.K.DKLVQSCLSDpdk..................................iqgLVR......DIDKMDGNAGA......-------................---..-----.---.--....-------.VCQ...ALVELMR....QLCV..S.K..ETMSLKLLCVQ..L.-AH...K...PQ.....SLDIV.LLFER...L.P.TVLEPLCQL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....D...D...Q....G.E...........YQP..........IYEE.FGAILLLVLAYAYRYNL...R..A.AD...I...GIV...........SP....---....--DSCVGK..IL.N.RAHI..-SR---.----..--PLGDLTEQEKS..HINGWI.HGLFg......sET..G.....GLGDDLM......S.SCPPQDF..YLLVASIFQYIVV.....AY...T...H...........G......YL-....N..........DES.LKSGIE............Y................V....VDTFLLPS.LVPAIRFLADY......LW.VEQ.R.E..Q....-.-.....-..--.-K....SV.I.KIL..QL.M.L.....L..P.S..S.I...S..GE...........ASTMLF..SVK....NLIAKPLEYSLRSYQKQD..PK....---------.---N..QDIEP.L...LR--.....-......--.....--.--.A.LR.DSLP.LS...R.R.T...............-.-............G...GA.EH..NE..L.--E.......SW.S.SS...S..........S...S..G....LSGAVRHTVQGL......VQ.MHHGln............vmpTSYT..HR..Q.MIAAC..RVVG...TRRV...LRAMLDEV.RYQSVA--....---.---..---...-.....GAASVVYDVV.AALVCAPD.VT.I...E..P...P.AT.S...S.L---------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------lgnearasqrrltlrevlkseaegchklhnkdatlaem..................................................................................................................................................................................................................
A0A5J5EGD5_9PEZI/270-829               ..................................................................................................................................................................................................................................................................................................................pvvwtrah--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..---L...FVWLDS..LLC.GRPHV.DDETILGYLY---NRYK.DDA..........------NTMVMDFITAVI----.DVI.SNA.LVR.G..E.PP..STLFLLRS---FLCNKVPLIINR................-I.SPSPmm.....................ssYAISQSFL.....RT.DVT.AL..MN..LptP..QFD.PL..R....N..SS....NSGT.DA..LFG.D.....I...---.T...ID.LRQDFLFACALHGVIG.EQDIQGILGE.LPL--.--..--.-.---GAM.P.S..GR..Y.N.Y.REIQGQCAADprr..................................vdqLLE......EIEGVEGNSGA......-------................---..-----.---.--....-------.VVR...ALYEIMK....GMCV..S.R..ETMPLRNICSF..L.-VR...K...PS.....SIDVM.LLFFK...P.A.EILEPLCDL......LD-TW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.FGYILLLVLTMVQRYSL...T..V.SD...L...ACT...........HS....--P....NNSGFVPQ..LL.H.QYST..------.----..AQRLENLSSDRHA..QLGGWI.KELY........ED..E.....GISDGLM......A.SCLPQEF..YRLVPTLFSQSLL.....AV...K...Y...........G......VL-....D..........LDS.VKGASS............F................L....LAPFLLPS.VISGLVWLTHH......LW.SNL.D.T..N....P.A.....P..--.--....-T.L.SVI..AS.L.I.....A..T.-..P.E...N..TE...........TAETHR..TVV....AIVARPLDAVLRELLRRQ..NL....S--------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------pdtahmvqqlhqqlrhyhgfhrnaissreeveswahavghgglaialanaynsllmwsggggqyttrllvaswkllgarkvveiilqe................................................................................................................................................................
A0A2B7YPD5_9EURO/10-954                .....................................................................................................................................................................................................................................................................................tllqwrkfieqclsertdvasfrelsklmidrhpipg--------------------------------------....................----...........................----------...........--------------.....---...-.....-K...RLVD..IVLDGRSv....tnVPW...DPL..IPLy..vDALHRLGRAK.....VHDILTSLLEH.SSLAetarrsslq...............................................................dvpnkdkpvSTLM.TDFR.IFQD.II.M.A.VT..TG.H.APKT.......................................................--..-..-......-S.ND.AN...KT..L..A..TIADWMSA..L..L.AWTSNG....Egangq...........................paylthSADIQ.GI.F.E.SI....GI.......L....FAA.LA...G..S.E.KIVNslstq...................gnkgqrIKLGQ.A.LSGYI.P.LC.AE.-.---............ISIPL..RSR...LDAL.Qkefelyghegg...............ksledtlmegvnVSTV...D..FESNim..........dgPAI.A.SKAGL......---.---....................----..-..--..-..----...YIYLNS..LLV.GRPLV.DDSMFINFLN---NRYG.GHH..........------MALIEELIAAAF----.EVL.SNG.MYR.N..E.SN..RTMFLFRS---FLVNKLPAFLAE................IS.ASSMdpi...................pmeLCIGRALS.....RV.DP-.--..NA..F..P..SFS.EM..F....S..--....MQGN.SV..L--.-.....-...---.-...SD.VRQEFLFACALHKLIP.EASIERLLGE.NPM--.--..--.-.--QTLP.V.G..GQ..Y.T.K.ENLVSQINNSper..................................aeqLLN......EIDSMEGNAGA......-------................---..-----.---.--....-------.IAK...AITEVMH....SLCS..R.K..DTVTLKSICNS..L.-SR...R...PQ.....SLDIM.LLFIS...P.A.TILQPLCAL......LD-TW................K......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....GsE...........SQP..........VYDE.FGSILLLVLAFKYKYDL...S..P.HD...L...GIS...........NP....---....--DSFVLR..LL.E.RGSS..------.----..SQRLEDLSEKQTQ..NLGAWI.TALF........IA..E.....GISDESM......S.SCSPQEF..YLLVATLFSQSLA.....AC...E...A...........G......KL-....E..........FET.LKGGFE............Y................L....LEPFLLPS.LVMALTWLSNH......IW.ESE.N.D..L....T.T.....A..--.--....--.L.RIL..NV.L.I.....R..P.S..S.I...S..GE...........AQEIHR..TVL....FITARSLEEALKHMRSRH.pTR....Q--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DALE.PY...H.S.F...............Q.R............T...GA.AY.hTE..L.--E.......SW.S.IH...S..........G...G..G....IIASIRNIFSSLv....lWS.QNPDls............mtpPSYT..HR..Q.LLAGI..RILG...SVRV...LHGLIEEL.K--ITE--....---.---..---...P.....GCMDVGIDVA.ATVICTPL.AE.S...-..-...F.AA.E...Q.AAYHP---LD.........S......SKGPP..PKYPILTLR.....................................DALALEQESMGkLIETDTLYAELivr......................lrrrVDALTAV-----..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------pqitqevsnldvgkimqdmdleneqmgmggves.......................................................................................................................................................................................................................
M3J8T6_CANMX/362-668                   ....................................................................................................................................................................................................................................................................................................................datplh--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.V.RENFNEKLLN........................................INS......EFTSLE-----......------E................SGL..IEFVK.KLS.SVh..qSEQIQKE.ITK...TILDIVD....ELSY..A.R..DFEKLNRLLLA..V.MGN...I...--.....ELVNI.VLFNS...N.Y.SLLYKLIDL......VD-SL................-......-......-..........-.......-.......-....-....-D...........F..kT.........D.....D...D...D....E.N...........FQE..........YYSY.CGIIILSILNIVETFNI...D..F.SK...I...ALR...........NS...fIIE....YLNKFYYR..LC.D.NLTS.dVPL---.--NN..EEEDNIIIANYQN..LENEWI.NALFd......dKN..E.....GLSDDLI......K.SLNIKQI..YKLVPLIYKQAIM.....AT...N...Q...........G......RI-....S..........WEI.LNNGLE............Y................L....SQPFLTVI.SPIIIKYL---......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------vrdaaidnelkqkiikelisdttnlsvkmvinicgndlvkl...............................................................................................................................................................................................................
A0A423WRF5_9PEZI/57-536                ..................................................................................................................................................................................................................................................................................................vadlllrpatwnrytldprvplym--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....QTLLDLKYID.....TPAILKALYRY.STCHvladrknaeqkqneaegg............................................dktsdkqhkdgnkevtrwqSSFS.SEEV.IFYR.LT.K.A.VA..QG.A.AIKN.......................................................--..-..-......-S.RD.SL...EV..S..T..VMAQWMVL..F..T.AASAA-....Fppeedvmmgga...............ggarrdkvsqqsKDDME.NS.R.A.AF....VM.......L....LLG.VC...E..N.H.VVLEalskp...................sakgarKALSQ.S.LASFV.P.SI.MQ.N.ASQ............IATRL..ELF...RTGM.Lagfe.............................pidkkKEAD...N..AEMD..............ELL.D.ETIGL......-QN.V--....................AIPD..L..HI..TpsRAGL...YIYLNA..ALV.GRPLI.DDASLYNYLH---NRYQ.GNI..........------QLTAIDLILGSF----.DVL.ANA.IFR.N..E.GQ..KSAHLLRS---YLINKVPLVLAS................FA.ASATpmyp.................fnseLCITNALS.....RV.DT-.--..NT..F..P..TLS.SL..F....E..NG....LSSN.PF..T--.-.....-...---.-...ES.VRSDFVAACCLHGLVP.ETSIDKLIGD.YTY--.--..--.-.--QTLP.A.G..GR..Y.V.K.DTLVQECLADpahe................................rvqrLIG......ELDNMDGNVGA......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------vcqaltelldn.............................................................................................................................................................................................................................................
F0U503_AJEC8/477-941                   .......................................................................................................................................................................................................................................................................................................................iaa--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.AITEPLCAL......LD-AW................K......-......-..........-.......-.......-....-....--...........-...W.........G.....E...E...Q....G.E...........SQP..........VYDE.FGSILLLILAFKHKYGL...S..H.YD...L...GIS...........NP....---....--DSFVLR..LL.N.HGSS..------.----..SQRLEDLDEKQKN..NLGAWI.TALF........IA..E.....GISDDSM......S.SCSPQEF..YFLVATLFSQSLA.....AC...E...T...........G......KL-....E..........FET.LKGGFE............Y................L....LEPFLLPS.LVTALTWLGHH......IW.ESE.S.D..L....A.T.....S..--.--....--.L.KLL..LA.L.V.....K..P.S..S.I...S..GE...........AQEIHR..TVL....LITAKPLEDQLKGVRTRH.pSR....N--------.----..-----.-...----.....-......--.....-D.IK.P.VL.EALE.PY...H.S.F...............Q.R............R...ST.AR.yGE..V.--E.......GW.A.AN...P..........A..gG..G....IVASIRNTFSSFv....fWS.TSPEis............mtpPSYT..HR..Q.IVAGI..RLVG...AVRV...LRGIIDEL.KLQAET--....---.---..---...-.....GSGDLALDIA.ATLICAPL.AE.S...-..-...F.AV.E...R.AA---FHPVD.........P......SKDSV..PHCSILTLR.....................................DALSLERESIPkLVNSDTLRAELivr......................lnrrVDALAAIPQMS-..................QEVSN......I..-.....DVGNIMQDINL..EEESM.GMTNQ......-RHD.QGGE.Q.A..GQ.QDQVADDAGDLNDM--------ldaavaa.................................................................................................................................................................................................................................................
A0A395I9N3_ASPHC/2-946                 .........................................................................................................................................................................................................................................................................................................................t-SSEQWRVFLHRCLLHRIDAAEFKSLSRLLLQRCPIS-....................----...........................----------...........--------------.....---...-.....EA...LLLD..VLLETRLa....tgVKW...DPL..LPLy..iDCLCKIGLVQ.....TSTVLNALLKY.SSIHdkpqstste..............................................................assgkknrqcYTLM.TDIR.VVQD.AM.L.S.VS..TG.S.VPKS.......................................................--..-..-......-F.SE.AI...SI..F..N..AIVDWVQA..V..V.AWNSNH....Angshq...........................tpglisSPDAV.SL.F.E.SL....GI.......L....LAA.LS...G..T.T.KGLEvlsad...................sqealkVKLGQ.A.LSAYL.P.IC.VE.-.---............VSLPL..RNR...LDGL.Qkefnlygeppt...............kpldvsmmdnvnVNAL...Q..FEASvm..........dgPVI.N.SRAGL......---.---....................----..-..--..-..----...FVYINA..MLV.GRPLV.DDSILLNYLS---NRYG.GHY..........------EVLIEETITAAF----.DVL.SNA.SYR.S..E.SS..RSMFLFRS---FLVNKLPAFFAA................-M.LAASmvt..................lpmeLCISHALG.....RL.DP-.--..NT..F..P..SFS.QM..F....A..--....MQSN.TA..L--.-.....-...---.-...SD.VRQEFLFACASHKLIP.ESSIERLLGE.NPM--.--..--.-.--QTLP.V.G..GP..Y.N.K.DDLVNQINANper..................................aeqLIG......EIESLEGNAGA......-------................---..-----.---.--....-------.IVG...AITEVMH....NLCI..Q.K..ETMTLKNICNS..L.-SR...R...PQ.....AMDVV.LLFRS...T.K.QVLQPLCSL......LD-AW................H......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........SQP..........VYDE.FGSILLLVLAFTFRYDL...R..A.QD...L...GLG...........GS....---....--DSFVLR..IL.K.SGSC..------.----..SQKLDVLSDKQNK..NLGAWI.TALF........IA..E.....GISEETM......S.ACSPQEF..YFLVATLFSQSLG.....AC...E...A...........G......KL-....E..........FDT.LKGGFE............Y................L....LEPFLLPS.LVLALTWLGNH......IW.ETE.S.D..P....S.I.....P..--.--....--.L.KAL..HS.L.V.....N..P.T..S.I...S..GE...........AREIHR..TVL....NMTARGLEEQLKDVRTRH.pSR....T--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DALE.PC...L.T.F...............Q.R............S...GS.CH.rSE..L.--D.......AW.T.SH...S..........P...G..G....LLGSLRSTFQSLv....lWS.TSPDvs............vapHSYT..HR..Q.LVTSI..LLFG...STRV...LAALVEEL.KLQTET--....---.---..---...-.....GSGDTALDIA.ATLICAPM.AE.Y...-..-...F.AI.D...Q.NN-HSHQPLD.........P......SKESF..PRCPILTLR.....................................SALLLLHDNIPkISEKDPLRAEVivr......................lyrrVNALMTPPSQVP..................-----......-..-.....NLDMNNIIQNM..QL---.-----......----.----.-.-..--.----------------------gvggpgqmdld.............................................................................................................................................................................................................................................
E3KAK2_PUCGT/425-725                   ................................................................................................................................................................................................................................................................................................................phpnlvlghh--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......---SDLD................LGI..HPLLD.SLG.KS...sKETPISE.LAV...KLHQSIV....TATK..S.F..DLSTCITLTEA..L.-SS...L...-D.....SLSTL.FLWIE...P.R.KLLGPVRDL......LD-HW................N......D......I..........R.......N.......N....V....NQ...........LvnnS.........D.....N...D...E....S.S...........SGS..........EFEK.FGRLLGWLQGVVGRFSL...M..S.-N...L...SY-...........--....HLG....ATTGFTIH..HL.S.NPST..---SYP.IS--..-----SLPASHQS..TLSSWI.EALY........GS..S.....GIPDDLL......G.HTDPRIF..FSISASLFKQSFD.....AL...T...I...........G......LI-....D..........LQT.FRDGLS............Y................F....EHKLLVGGcAVGVVGWLLNE......LT.RVG.R.I..-....S.A.....S..SY.PT....AL.L.EIL..QS.I.L.....L..S.D..A.I...T..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ptalhlvsarslaviraf......................................................................................................................................................................................................................................
I2H078_TETBL/1113-1262                 ...........................................................................................................................................................................................................................................................................................................nnnnnnnnnnnnnnn--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----NNNNEI.........V......SNEPQ..NSENIKQET.....................................QQTQLNSDPIL.DDDFDMLFGEN.............................DTSMHGQDDDLGlqqdtldeenpiemikdeAEKPN......L..E.....VTNQSSNYVML..KKDTF.GWILY......ELKM.AQDE.I.N..DS.SKMEVTQKEKISKYYDKYLDML........................................................................................................................................................................................................................................................
A0A0D2A9N5_9EURO/433-702               ...............................................................................................................................................................................................................................................................................................................eelirsdgsag--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....------S.ISH...ALVEIMH....NYCS..S.K..ETQYLKDLSNA..V.-IR...K...PA.....AVNCI.ALFVP...P.S.FWLGPICTL......LD-EW................R......-......-..........-.......-.......-....-....--...........-...W.........N.....E...I...H....G.E...........AQP..........VYDD.FGAAFLLVQVCKARLGL...C..E.TD...L...GIR...........KK....---....--DGFLSE..FF.N.NADA..------.----..DIDLERLSEERKI..HLGNWI.NALY........LA..E.....GLSDELF......T.NCSPHDF..YILIPTLLRQSIT.....AY...Q...Q...........E......KM-....T..........QES.LKAGLD............Y................L....LEPFLLPS.LSSALNWI---......-T.KVL.Q.E..G....T.F.....E..--.--....--.V.SCI..LD.V.F.....T..K.V..P.G...S..PD...........SRDIHG..TIL....SMCAGSLQEQIQS-----..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------kqghdhir................................................................................................................................................................................................................................................
A0A163K4D3_ABSGL/675-1044              ............................................................................................................................................................................................................................................................snklkkqyssfslldddmmddldqesdsgekpdalaqvdeniqqrikairstltkasvteli--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.HLG.IV....SLIHWRR.IVD...FLLEVLN....DSVQ..E.D..RLADLVCVCDA..L.-ND...C...PA.....AIDLI.LQLYP...P.T.TLLAPLETV......CN-TW................N......P......T..........E.......N.......Y....MdvddGN...........S..sV.........D.....G...D...D....M.D..........gLQT..........WYFK.FGKVWMLVLLVMSKSDV...A..G.NI...F...ADK...........QG....---....----MCYR..YF.M.TGPV..IYG---.----..-----TCDSEVED..VVNRWL.SAM-........GG..D.....GISDELL......R.TTKVQML..LQAVPTLIDRLLT.....IH...E...A...........G......RL-....-..........-TS.LTDVMS............Y................F....CKQFLHFL.LIPGVTST---......IC.EAL.L.N..R....-.-.....-..DD.GS....TV.L.ICM..SH.L.F.....L..H.P..-.-...-..--...........--SFHD..AAI....QLCGPQVLSSLYAYTERQ..-R....QYKRLYPST.P---..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------qqqtneqvnelerffitnldlqqvg...............................................................................................................................................................................................................................
A0A0K6G6W4_9AGAM/426-704               ...............................................................................................................................................................................................................................................................lsldlplsdklelidravvdpethaclctvlhkvstlsphptpgmiyplaastqhlspa--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..TLESLAHLSRL..L.YS-...H...SA.....VLDIV.GLRVP...P.T.ELVAAGLAF......LE-DW................E......-......-..........-.......-.......-....-....GA...........G...V.........-.....-...-...-....G.D...........PQS..........ALGQ.YGDVLLLLQLLVTRYEL...K..S.GT...L...KHG...........DR....VLD....ASYLTSSW..AV.Y.HLSD..LND---.----..---------SERT..LINDWV.KAVF.......dPN..S.....GIDDNIL......R.STNPRVL..LKLSATLFTEAIR.....KC...A...Ae.........pE......GA-....G..........MEI.LRNGVS............Y................F....EGPLLNWT.L-RGVIWA---......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------laneaerhghaaqthldilqllvlangcpapvie......................................................................................................................................................................................................................
H1UX95_COLHI/50-957                    .........................................................................................................................................................................................................................................................................................................aavadlflrpqphnhes--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......--L...DPR..VPRy..lQVLSNLNYID.....TPSILKALFRY.STSRahsrdaaqpad..........................................................gdvqrpnmlhwgSSYA.AEEV.MFYR.LT.K.S.VA..QG.T.AIQNtgs................................................gleiAS..I..M......AK.WI.AL...FT..D..A..ATAFTVDV..M..G.QLHNSQ....V......................................REEME.SA.R.A.AF....VA.......L....LLG.VC...E..N.Q.VVLKamskp...................eaqgtrKALSE.S.LANFV.P.TI.MQ.S.AGP............IATRL..DMF...RTST.Lag..................................fePVDE...Q..KNKSna.........eieDLF.D.STVAL......ENF.VIS....................ELPI..V..N-..S..RAGL...YIYLNA..ALV.GRPLI.DDHAIFNYLN---NRYQ.GDV..........------QTTTVDLILASF----.DVL.ANA.ASR.N..E.GH..QAAHLLRS---FLMNKLPILIES................-L.SKHMygp..................vnaeYCITEALG.....RV.DT-.--..TT..F..P..TLS.SM..F....D..ET....RSNN.-P..F-T.D.....-...---.-...-S.VREEFCWACCLHGLVR.ESSIETLLGE.TPY--.--..--.-.--QSLP.A.G..GR..Y.L.K.ENLVAECLADper..................................mqaLIG......ELDNKDGNAGA......-------................---..-----.---.--....-------.VCQ...ALTEVLG....QLCR..N.K..ETMSLKLLCSQ..L.-AQ...K...PL.....SLDVM.LMFEK...P.A.TILHPLCDL......LD-SW................K......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLVMAFAYRYGL...S..A.SD...M...GVT...........SS....---....--DSFVAR..LL.G.QGHQ..------.----..SRPFDELSDQEKG..HLNGWI.HGLFd......sEA..G.....GLGDELM......S.SCPPQDF..YLLVSTLFQNIVL.....AF...G...T...........G......HL-....A..........EES.LRGGIE............Y................L....VDTFLLPS.LVVAIAYLANS......LW.IER.S.D..-....-.-.....-..-C.QK....AI.V.RVL..SS.V.L.....A..P.T..S.I...S..NE...........AQAMLT..SVM....NIVAKPLEHSLRAYQRSD..PK....S--------.----..QEVEP.L...----.....-......--.....--.LK.A.IK.DSIP.LS...R.R.T...............-.-............G...AA.DH..TE..L.--D.......--.-.AW...S..........L...G..G....FSNSIRQTLQQLv....qWS.IHPTmd............rmpPAYT..HR..Q.MLVAL..KLLG...AKRL...LQLLYEDI.RQQTDT--....---.---..---...-.....GSGSIIYDVV.TAIVCAPD.VV.N...-..-...T.PS.N...P.VNFLDN----.........S......GNVPV..PTQRKLTLR.....................................EVLKSDAEDCKrLQKTDMNLAEIvvrl.....................yrkvESQMAVSQAQA-..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------mqadtmlqsdlglsldp.......................................................................................................................................................................................................................................
A0A423VEZ0_9PEZI/56-1003               ....................................................................................................................................................lvadlllrpspwnrytldprvplymqtlldlqyidlpailralyrystchvladrrdtenhkenaadrsgdkaqarqkdgkeiirwqssfsaeevifyrlikgvqgtaiknsrdslevtaamaqwmilftaasaafqpdedvmmggaggarrnqasqqskddmens--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.R.A.AF....VM.......L....LLG.VC...E..N.H.VVLEalskp...................vakgarKALSQ.S.LASFV.P.ST.LQ.N.ASP...........iAARLE..DFR...TGIL.S......................................RFEPi.dK..NKEA..............DNA.E.MEELL......DET.--Igl...............qnaAIPD..L..HV..T..RS-RaglYIYLNA..ALV.GRPLI.DDASLYRYLH---NRYQ.GDI..........------QTTAIDLILGSF----.DVL.ANA.IFR.N..E.GQ..KSAHLLRS---YLINKVPLVLAS................FA.ASATpmyp.................fnseMCITNALS.....RV.DT-.--..NT..F..P..TLS.SL..F....E..NG....LSSN.PF..T--.-.....-...---.-...ES.VRSEFVAACCLHGLVP.ETSIDKLIGD.YTY--.--..--.-.--QTLP.A.G..GR..Y.V.K.DTLVQECLADpahe................................rmqrLIG......ELDNMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALTEMLG....RLCT..N.H..ETMSLKTLCSQ..L.-AR...N...PL.....NLDVL.LLFDK...T.A.TILSPLCQL......LD-DW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....D...D...Q....G.E...........YQP..........VYEE.FGSILLLLMAFVHRYTL...S..A.TD...L...GIR...........SA....---....--DSFVAK..LL.G.KGQL..------.----..SRPIDELSDQEKN..QLNGWI.HGLFd......tDG..G.....GLTDELL......S.SCPPQDL..YLLIPTLFHNIVL.....AF...S...T...........G......YL-....T..........EES.LKTGIE............Y................L....VEPFLLPC.LVTAIIYLSN-......--.CLW.T.D..R....P.E.....E..--.NK....AI.I.KIL..QL.I.L.....K..P.S.qK.M...S..LE...........SSEMLN..SVK....NIVAKPLEIGLRTYQRQN..PK....S--------.----..-----.-...----.....-......--.....QE.VE.P.LL.QVIK.DN...I.E.L...............S.R............R...TG.AT..GD..K.ELE.......QW.T.SS...G..........N...V..G....LTTTIKHTIQNLt....mWS.LHPGv..............mpTPYA..HR..Q.MLVGL..RLLG...AQRL...LNAILEEL.KQLTET--....---.---..---...-.....GNGSTAYDVA.IGLVCAPD.AT.T...T..S...D.TP.P...S.I---------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------ldeaghspapqqrrlslrevlrwkaegwkkiekndpamaetvvrlyqkveaqmapaaiaplahgadeeamnamvdnvaaaaaasqlgmd...............................................................................................................................................................
A0A2N3NE69_9PEZI/21-969                ...................................................................................................................................................................................................................................................................................smkawddfldkclfkrlsiskfqsfvphlrskypippda--------------------------------------....................----...........................----------...........--------------.....---...-.....--...-LAD..LLLRPRA.......GNSdclDPR..IPLy..lQTVLELEYVD.....APAILKALYRY.STSHsqsqsgve.................................................................klppvrwrSSYS.TEEV.IFYR.LT.K.A.VV..HG.S.AVKT.......................................................-P..S..D......AL.SM.-M...DI..I..A..KWMALFTA..A..F.TTFAAD....Vmgql.............................gnagpREEME.SA.R.A.AF....VA.......L....LLS.VC...E..N.P.VLMGtvgr......................piakKARKC.M.LDSLV.N.FV.PT.L.QNA...........sIAERL..ELF...RSTL.S......................................SFEP...A..EKPK..............DGA.E.SKSLDd...vlDSS.--Vgldtv..........ilpelHITN..S..RA..G..---L...YIYLNA..CFV.GRPLL.DDHALFAYLH---NRYQ.GDI..........------QTTAIDLILASF----.DVL.ANA.VFR.N..D.GR..NTAHLLRS---YLINKLPLLLVTl..............gHS.M--Fppt...................tpeFCITEALS.....QV.DT-.--..NT..F..P..TLS.SM..F....D..DS....-RNN.NP..L--.-.....-...---.T...DN.VREEFCFACCLHNLMP.QSHIETLLGE.NTY--.--..--.-.--QTLP.S.G..GR..Y.V.K.DDLVRECAADpek..................................ipsLIG......ELENMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALTEVLG....RLCA..N.K..ETMSLKMLCSQ..L.-AR...N...PV.....SLDVM.LLFSK...P.A.SILQPICDL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLLLAFAYRYNL...T..A.AD...I...GIR...........SR....---....--DSFVAK..LL.S.QGHL..------.----..SRSLDELTEQEKG..HLNGWI.HGLFd......tDA..G.....GLGDELM......S.SCPPQDF..YLLIPTLFHNIAL.....GF...G...S...........G......CL-....A..........EET.LKGGLE............Y................L....VDTFLLPS.LVPAIRFLSDY......LC.NDE.K.E..E....Q.K.....-..--.--....AI.I.KIF..QL.L.L.....T..P.T..A.I...S..TE...........ASTMLT..SVL....NLVAKPLEHSLRAYQRRD..PK....N--------.----..-----.-...----.....-......--.....VQ.ID.P.LL.RTLK.DN...L.P.L...............S.R...........rT...GG.AE.hNE..V.--E.......SW.S.GA...A..........A...G..G....LTASIKHTVTGFv....qWS.LHPGin............vmpTSYT..HR..Q.MLCGV..KMLG...AVRM...LRIILDEV.LQQSAT--....---.---..---...-.....GNAGIVFDVA.TALICAPD.VT.N...D..P...P.PT.S...L.QTLDESGNVP.........P......LP---..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------qrqlslrealkaeaegfrklhkkepalaeavvrlyrkveeqmtpsqaqilqadlgtsldaseavqaaanaaaaaa.............................................................................................................................................................................
A0A3F2Y4K9_DEKBR/122-717               ............................................................................................................................................................................................................................................................................cheeflkalgsflesfptfqrsldndtkfilmltkfvanilssgsk--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.--IF..............................PQFTQ.D.ILNYL.E.YL.KK.N.GFN............--SSY..EYL...NASF.S......................................DYNL...X..AVKK..............GYN.T.LTASQ......N-G.R-Q...................gSLES..A..KL..L..KMRK...ILWLSQ.qFIV.KYSPV.NEKLIRVFKRVL---NL.SSV..........TTAATNTSIAYEFTTSMFDCL-.-LL.STK.---.-..-.--..RTRDV---WINAITNKLPLVMKL................-L.KISQ.........................AKLATXLQ.....NI.SD-.--..--..-..-..--A.SN..V....D..H-....---N.RQ..---.-.....-...---.-...--.VFIKFLKXLITLDLVK.PEHLQRIVTN.APS--.--..TL.-.---AMK.N.I..KT..E.E.V.XATYNNIFHK........................................SNP......EFSSIE-ESGA......-------................---..---LN.FMK.TVs..qSILYMQT.VSK...LILDSIR....TFIT..E.K..DNLRLRRILIS..L.ASE...K...-S.....VLDYV.LLERS...P.Y.DFIQKLLSY......LDQLV................D......T......RpgtetksdqfM.......R.......E....N....NE...........D..fM.........DldlgsD...D...A....S.N...........AQE..........FFTD.LGTVLIFVQYAVYRYNM...N..L.WK...F...EKN...........--....---....---DITLQ..LL.N.NAST..INS---.-NDY..LEKLQDPSSELNK..IMNKWI.SSLFn.....sdNT..D.....GISDDLI......K.MCSLRDY..HFIMPRILEEAIM.....AY...S...S...........C......LI-....D..........EDS.LIGGLE............Y................F....YQPFLINN.LTTIFRYL---......VN.ASW.E.K..E....G.Q.....N..SI.IT....-L.T.KIL..EK.L.S.....K..P.G..E.M...N..DE...........ARILHS..MVM....E-----------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------nvndvvftalenlsglpqveny..................................................................................................................................................................................................................................
A0A395T478_9HYPO/499-950               ......................................................................................................................................................................................................................................................................................................tekiqglvreldkmdgnvga--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..----ICQALVE..L.-AA...K...PQ.....SLDVI.LLFEK...L.P.NILEPLCQL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........VYEE.FGAILLLVFAFTYRYNL...N..A.VD...I...GIA...........TP....---....--DSWVAK..II.G.RGHV..------.----..GRQGDELTQRENE..HINGWV.HGLFd......tEA..G.....GLGDELM......S.SCPPQEF..YLIVAPLFQSIVV.....AY...T...Y...........G......YL-....N..........DES.LKGGIE............Y................L....VDTFLLPS.LVPAIRFLADY......LW.IDQ.K.E..-....-.-.....-..--.QK....SI.I.KIL..QL.I.L.....L..P.S..S.I...S..GE...........ASTMLS..SVK....NLIAKPLEHALRTYQRRD.pKN....Q--------.----..-----.-...----.....-......--.....-D.IE.P.LL.RILK.ES...I.P.L...............SrR............T...GG.TD.lNE..L.--E.......SW.T.AT...P..........P...S..G....LSSAVKLTIQGLv....hWS.IHPAmn............smpTSYT..HR..Q.ILAGL..KILG...PKRL...LHVILEEV.RQYTEA--....---.---..---...-.....GSANIVYDVA.ASLICAPD.VV.K...D..A...S.AT.G...M.LDANG-----.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------nilppvqrqrtlrdilkvevegcrklqkedpvlaehvvrlyrrveaqmiipqpqgmlq..............................................................................................................................................................................................
A0A067MZ61_9AGAM/559-697               ...............................................................................................................................................................................................................................................................................fgdvvlflqrclyryqlfsfdfhvgerhfsaeylrstfmvygl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..----DALPQEERK..IVNDWL.KAVFd......sQS..E.....GIDDQIL......R.STNPKML..LKLSATLFSEGIA.....GS...T...K...........F......ETP....D..........RDT.LLGGVS............Y................F....LGPLLNWT.LVGVLRGL---......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------aneirrqg................................................................................................................................................................................................................................................
A0A3M7MQ16_9EURO/1011-1241             ..............................................................................................................................................................................................................................................................................................ddvvaqvnsghtrptqlidqladadgsa--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-----AA.IAQ...AIVEIIL....TYCQ..N.K..ETHHLRDLAHA..I.-IR...K...PA.....AVNAL.ALFIR...P.S.YWLSPLCSL......LD-EW................R......-......-..........-.......-.......-....-....--...........-...W.........D.....E...I...Q....G.E...........SQP..........LYEE.FGAILLLLLMARTRLSL...T..K.AD...M...GVT...........TS....---....-PRGFVST..YL.D.HEGT..------.----..ETGLRDLSPDSHR..HLGEWI.NALY........VV..E.....SLNDELT......T.ACSPQHF..YPLVPTLLSQSLL.....AL...Q...C...........G......KL-....G..........PDS.LRGGLE............F................L....LEPFLLPS.LVSAM------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------a.......................................................................................................................................................................................................................................................
B2W0U4_PYRTR/1-996                     .....................................................................................................................................................................................................................................................................................................................mesvv---DEWKAFLSRCIASRIPPDVFAAAVAQLHAKSPLP-....................----...........................----------...........--------------.....---...-.....GR...KLAA..LVLLPRA.......AGI...DPR..SIAi..lEQLLALKKVD.....ASDVLTVTFLH.SKDRrpintgde................................................................kapkdaqwsNPPE.LEEI.IFHR.LH.K.A.FA..SE.E.RPVN.......................................................--..-..-......-N.TE.GL...RT..L..I..VVTRWMQV..M..V.TSHTSD....Tmiqam...........................agiqqpHQQSI.NA.R.E.GL....AM.......L....VIG.VI...E..N.P.RILAilsnp...................kgkdvrKNFVQ.S.LSSFI.P.FL.HN.N.SAGs..........qTSLSL..ANR...LEMS.Q......................................KQHD...F..FEKL..............PNV.N.GERNEs....tGLE.VAAlql.............davmELPQ..V..N-..T..RPGL...YVFLNA..LLV.ARPLT.DDFTIISHLH---SRYK.VGYplgi.pqgsdLQQLEPQNMATDLITAAF----.DIL.ANA.MYR.N..E.QS..ETLFYLKS---FLINKVPILLTQ................-L.SGSIfpm...................tveMCITQALS.....HV.DP-.--..HA..F..P..SFS.QG..F....D..DI....MGSN.NS..L--.-.....-...---.-...SD.VRQDFLNACALHGLIA.AGTVERLLGE.APM--.--..--.-.---QGP.P.A..KR..Y.E.R.KELLNQCKTNfdk..................................islYID......ELENVDGNAGA......-------................---..-----.---.--....-------.IVA...AVTDFIA....HLCE..T.Q..TTMYLKQLSCL..I.-FR...K...PQ.....AMDVM.LQFTS...P.P.SILRPLCQF......LD-DW................H......-......-..........-.......-.......-....-....--...........-...Y.........D.....S...D...Q....G.E...........HQP..........VYDE.FGAILVCIMTFMYRYDL...T..Y.HD...I...GIG...........H-....---....--DSFVAK..LM.Q.RGHH.gM-----.----..--LPDELTEEQGK..HLGNWL.KGLYd......sDK..E.....GLSNEVF......A.SCRPQEF..YLTVPTLFRQTVV.....AC...S...T...........G......VL-....S..........FET.VKGGLE............Y................L....GETFLLPS.LIGGLTWMASY.....aLL.QTH.N.D..-....-.-.....-..--.LD....AM.I.RIF..NE.V.I.....L..S.S..P.T...S..GD...........AQAMHS..TII....AIVSSRLEKCFRTLQRRE.pNR....T--------.----..-----.-...----.....-......--.....-T.LE.P.FI.QAIK.AH...S.H.Y...............E.R............T...AY.AT.lKE..L.--D.......QW.T.NV...P..........H...S..T....LNTSLRHTVQQLs....qWA.STASlq............pnpPSYT..HR..Q.IYASL..KMLG...ATRT...LRAIVEEV.KNQTDA--....---.---..---...-.....GNGAAALDIG.ISIICAPM.VE.D...S..P...V.SV.D...W.VA-------S.........Q......IVAPA..PQRTRMNLR.....................................EILKQEFDCAAnLVATDPLTAETivrlhrrv.............eahfaslsETGLQAPPINIP..................-----......-..-.....----SVHIGDM..QSQTI.SDDLN......RAID.DAAA.A.S..IV.EDISNMDNKALQRSMDEL----tase....................................................................................................................................................................................................................................................
A0A4U0XED2_9PEZI/254-868               ....................................................................................................................................................................................................................................................................................................eqilqtlaqegdssavrcragl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...YIWLSA..CLC.SRPMT.DDLSMLGYLQ---TRYN.GDN..........------QTLIVQLLHASF----.DLL.INR.VLS.A..Q.PA..HDVKIVRS---FICNKLPLLLAL................LA.S--Fvgq..................vileTCIQSAFL.....SI.VM-.--..DP..V..P..PIS.AG..S....L..EV....---T.EM..L--.-.....-...---.-...KR.TRLEFLQACALHGILS.ESTIGSVLQE.PPM--.--..--.-.---GLP.K.V..PK..Y.T.K.EGLLNQFTNNigr..................................ldgLSA......ELQGMQGNAGA......-------................---..-----.---.--....-------.VSL...YIVDLIG....NLCA..S.K..DTMSLKSACNI..L.-IK...H...VR.....NMDVV.MHYTQ...P.A.TLLVPLCML......LK-DW................V......-......-..........-.......-.......-....-....--...........-...H.........D.....Q...D...Q....S.E...........FTP..........AYEE.FASILLFTMAVLHRYRL...T..S.ED...L...GMA...........GM....---....--GVFVFE..IL.S.ESST..------.----..STALSELDPEQNQ..HLAKWL.EGLFatd..dqgET..S.....GISDEVM......R.QCPPQAF..YRLVPTLFEQSVM.....AC...K...S...........G......HM-....S..........LST.LKSGLE............L................L....LEPFLLPA.LVGGLSWL---......IG.RSW.E.D..H....N.D.....V..DV.--....-L.L.QIL..DK.L.L.....R..P.S..S.S...S..AE...........TQAMHR..AVL....GIIAEPLECSLQDLLRKR.pDK....S--------.----..-----.-...----.....-......--.....-V.AH.G.MS.ALLR.QY...A.D.S...............T.R............S...GC.SR.kAE..-.-IN.......KW.A.AT...-..........-...G..N....VTHDLRHAVKDLi....sWA.ANATpt.............apPQYQ..HQ..M.IITMC..DLLG...PQ-A...VIEVFLCL.MREAMY--....---.---..---...-.....PATAIALDVC.TSIVCAPS.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------pvsqllqqhlalemsdsrnlldksvgea............................................................................................................................................................................................................................
Q7S824_NEUCR/50-1029                   ..............................................................................................................................................................................................................................................................................................pivianlllrptkqssysldprrlqylt--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....-ILLNQKLVN.....PQSVLKVLHHY.STSQakiqsehdagttneaata............................................tkggqgqqgdkkpkrvfwqNSYN.DEEV.IFLR.LS.K.V.IT..HG.Q.GIRH.......................................................-A..S..D......AY.EM.AT...NL..S..K..WTTLFIDV..I..A.AFSRDT....Fgtiq..............................nmrtKQDME.TS.L.Q.AF....SL.......L....LVN.FL...G..N.Q.RVVSafsrp...................eakshrKRLAS.S.IDQLI.P.YL.LQ.N.PNT...........sGIAER..LEF...SRGQ.Al...................................agEESS...D..LKDA..............AVA.E.MHSYM......DNM.IGLd.................twQIPD..M..PI..VnsRAGL...YIYINA..ALV.GRPLI.DDHSLYTYLH---NRYQ.GDL..........------QTTAIHLILASF----.DVL.ANA.VFR.E..G.SK..TGHLL-KS---YVVNKVPLILGN................FA.ASSThmyp.................fdaeFCISQALG.....QV.DT-.--..NV..F..P..TLS.NM..F....D..--....MSNT.SS..SFQ.D.....S...---.-...--.VRQDFCFACQLHGLLS.ASAIETLLGE.ITY--.--..--.-.--QTLP.D.E..GR..Y.V.K.ETLVQACLEDfer..................................sqrLIG......ELDNMNGNVGA......-------................---..-----.---.--....-------.AAQ...AIVEVIG....TLCR..N.K..ETMTLKQLCSQ..L.-AS...K...PS.....SLDIL.LLFDK...P.Y.KILHPLCEL......LD-DW................G......-......-..........-.......-.......-....-....--...........G...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLLLAFVHRYSL...T..P.TD...L...AIR...........SP....---....--HSFVGK..LL.G.RGQL..------.----..SRPLDELSDQEKS..HLNGWV.HGLFd......sEA..G.....GLGDDLM......S.SCPPQDF..YLLMPTLFDQIVM.....AL...S...T...........G......CLN....D..........Y-L.LRSGLE............Y................L....LDTLLLPS.LVPALLFLANN......--.-LR.T.D..K....Q.P.....G..--.QG....AV.I.KIL..QL.I.L.....R..P.N..S.I...S..NE...........ASTMLS..SVL....NIVAKPLELSLRSYQR-Q.vP-....---------.--AS..QEVEP.L...LRAL.....K......EN.....LA.VS.SrTG.GADH.SE...L.E.N...............-.-............-...-W.T-..--..-.GTH.......HN.G.SG...S..........V...G..G....LYGAIRHTVQNLv....qWA.QHSPgn............gvpATYT..HR..Q.VLVAL..QICG...AKRL...LSALLKEL.KTQTEA--....---.---..---...-.....GNGSVAYDVV.TAIICAPD.VH.N...T..P...V.TD.D...NdPSSARGGGDA.........A......NHTIT..KKQRRITLR.....................................EALKFEAEEFKkIQKSDPLMAET.............................VVRLHRRVEAQMalpp.........pppppAQH--......-..H.....HHHHQQTMLQP..ELSAL.GVVAG......DAMG.DSMM.N.A..AA.VQVS------------------gsdhhhpmdams............................................................................................................................................................................................................................................
A0A0B2WL20_METAS/39-955                ............................................................................................................................................................................................................................................................................................tglfeefvpliqeqhplppfliallflrpq--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..------Py....nvVSL...DPR..IPPy..iQALSQLGHVD.....APSILKVLYKF.SSLH................................................................................sHSQL.KTST.SPQD.GP.E.S.AS..NG.S.YPGNaalhsndkrkrprrwkssawve..........efmfyhvikiivegtafrdprvlLE..M..V......QViSK.WM...EL..F..T..SVSRVFVAdvM..G.DLQSSQ....A......................................RLDME.TA.R.A.AF....VP.......L....LLR.LV...E..V.P.ALVKaisss...................haknirKSLSI.N.LAGFI.Q.TL.QP.A.PGF............VERLE..MFR...TEIL.A......................................KLDPidkN..NQAA..............ANA.A.MDELL......GAS.VALd.................sfAIPDllI..SN..T..RSAV...YVFLNA..SLV.GRPLI.DDNVLISYLQ---NRCQ.DAT..........------QSSAIELIVGSF----.DIL.ANA.VFR.N..E.GP..KDAHLLKS---FLVNKVPLLLCHlflr........epafDT.SASE.........................FCITEALS.....QV.DT-.--..SV..F..P..TAS.LM..F....D..ES....RSNN.PY..T--.-.....-...---.-...ES.VREEFCTACALHGLVQ.REHVERILGE.TSM--.--..--.-.--SYEP.S.L..EK..Y.S.K.EKLVHDCLADaek..................................vqgLIR......ELEKMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALVEVMR....QLCT..N.K..ETMSLKLLCSQ..L.-AQ...K...PH.....ILDIL.LLFEK...L.P.AIMDPLCQL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........IYEE.FGSILLLVLAFAYRYNL...T..A.AD...I...GIT...........SP....---....--DSSVAK..IL.S.RAHI..-G----.----..-RDRDDLTEQEKG..HMSGWV.HGLF.......tES..G.....GLGDDLM......S.SCPPQDF..YLIVASLFQNIVV.....AY...T...Y...........G......YL-....S..........DET.LKGGVE............Y................L....VDTFLLPS.LVPALRFLADY......LW.VEQ.K.E..-....-.-.....-..--.QK....AI.I.KVL..QL.I.L.....L..P.S..S.I...S..GE...........ASTMLS..SVR....NLVAKPLEHSLRTYQRQD..PK....---------.---N..QDIEP.L...LR--.....-......--.....--.--.A.LK.DSLP.LS...Q.-.-...............-.R............T...GG.AE.hNE..L.--E.......SW.T.NG...S..........S...T..G....LAGALRHTIQGLv....qWS.MHPSvs............smpTPYT..HR..Q.LIAAQ..RILG...AKRT...LRLLLEEV.RAHSET--....---.---..---...-.....GSANIVYDVA.AAIVCAPN.VT.D...E..P...S.PS.S...Q.L---------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------mdasgnvpplvqrplslrealrleadgcrrlhkadpvfseivvrl...........................................................................................................................................................................................................
A0A2H3E418_ARMGA/449-694               ..................................................................................................................................................................................................................................................................................................tlfdrickeaathsafasvvmkrf--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...------I....SLST..S.F..DVEALSRLCKA..L.YLR...H...-R.....ILDII.SLHVK...I.D.ELLYQTVSL......VD-SY................D......-......-..........-.......-.......-....-....CE...........T...I.........G.....D...P...-....-.-...........-QT..........AVSH.LGDIVMFSQYTLAHFNL...D..A.KM...F...IQG...........D-....---....--RTVSGV..FL.Q.SASQ..VFS---.----..---HESLSGEDAQ..AFNAWF.KTLFd......sGS..E.....GIEDTIL......R.SSRPKTL..LKIASTLFSSAIN.....AR...I...E...........G......KI-....D..........GDT.LNNGIS............F................F....TGPLLSWT.LVGVVRSL---......LQ.EIY.R.K..G....F.M.....A..--.-P....VH.I.EVL..QT.L.L.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------lspscpk.................................................................................................................................................................................................................................................
A0A1J9PQD4_9EURO/9-983                 .........................................................................................................................................................................................................................................................................................................................s-SSAQWKNLFHRCLSQRTDTSEFRDFAKLMLNRYSIP-....................----...........................----------...........--------------.....---...-.....AR...RLLD..LLLASRSv....tnVPW...DPL..IPLy..vDTLHRLESVR.....TEDILESLLAH.STVSqkqvsaqn.................................................................gsaakepvSTLM.TDYC.IIHN.AT.I.A.AT..SG.Y.APKT.......................................................--..-..-......-V.AD.AV...NT..F..S..ALAKWIFA..L..L.SWNSSH....Kpvgdp...........................vgsltkSPDAL.AV.F.E.SL....GI.......L....FAA.LV...S..T.E.KSVSalsap...................rskgwrNKLGQ.A.LSEYI.P.LC.AG.V.SIP............LRDRL..EVL...RKDF.N......................................LYDH...D..SEKS..............LED.T.MMENV......NIS.ALEf.................esNVLD..G..SI..InsRAGP...YIYVNA..LLF.GRPLV.DDNMMVNYLN---NRYG.GDR..........------MTLIEDLITAAF----.DVL.SNG.MYR.N..E.PN..RTMFIFRS---FLVNKLPPFFAE................MC.AS-Aidp..................ipmeLCITRALS.....RI.DP-.--..NA..F..P..SFS.EM..F....A..--....MQGN.SI..L--.-.....-...---.-...SD.VRQEFLFACALHKLIP.EASIERLLGE.NPM--.--..--.-.--QTLP.V.G..GQ..L.R.R.EDLVAQINNSper..................................aeqLIN......ELESMEGNAGA......-------................---..-----.---.--....-------.IAG...AITEVMH....SLCS..R.K..ETMTLKNICNS..L.-SR...R...PL.....SLDVM.LLFIS...P.S.TILQPLCAL......LD-AW................K......-......-..........-.......-.......-....-....--...........-...W.........G.....E...E...Q....G.E...........SQP..........VYDE.FGSILLLVLAFKHKYVL...S..H.YD...L...GIS...........NS....---....--DSFVLR..LL.Q.HGSS..------.----..SQRLEDLDEKQKN..NLGAWI.TALF........IA..E.....GISDESM......S.SCSPQEF..YLLVATLFSQSLA.....AR...E...T...........G......KL-....E..........FET.LKGGFE............Y................L....LEPFLLPS.LVMALTWLGHH......IW.ESE.S.D..L....T.T.....S..--.--....--.L.KLL..LC.L.V.....K..P.S..S.I...S..GE...........AQEIHR..TVL....LITAKSLEDQLKSIRIRH.pSR....N--------.----..-----.-...----.....-......--.....-D.IK.P.IL.EALE.PY...R.S.F...............Q.R............R...ST.AR.yGE..V.--E.......GW.A.AN...P..........A..gG..G....VVASIRNTFSSFv....fWS.TSPEis............mtpPSYT..HR..Q.IVAGI..RLVG...AVRV...LRGIIDEL.KLQAET--....---.---..---...-.....GSGDLALDIA.ATLICAPL.AE.S...-..-...F.AV.E...R.AA---FHPID.........P......SKDTV..PRCPILTLR.....................................DALNVERDNIPkLIDSDMLRAELivrlnr................rvdaltaV---TQMSQE--..................-----......V..S.....NIDVGNIMQDI..NLE--.-----......----.----.-.-..--.----------------------gedmemsdqrhhqgdeqpgqpdqgpddaenlndmldaavaa...............................................................................................................................................................................................................
W9C7L9_SCLBF/27-959                    ....................................................................................................................................................................................................................ftdyirilssrnplpssyiceiflrpdkyndtvidprvlryvqillaeglvdcagilrgllkysslwsyrqdghmqneanngvekdkrvkegnkrwkksysa--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.-EEM.MLYR.LA.K.T.VS..TG.V.RPKN.......................................................--..-..-......-V.QE.AV...DL..L..V..VSVQWMDM..V..A.VGMGQG....Aheil..............................dleaHVEEIgMV.G.M.AL....GT.......L....MVA.VV...G..N.A.KILGvlekgr..................cpkgtgMDLGK.A.MAGFV.P.LL.LQ.S.SPQ............NA---..-QR...LDVF.Rnqtlit.........................ilpvdkkE---...-..--RAada........einEIL.D.STIGM......NID.SIV....................-IDD..L..PV..VnsRAGL...YIYLNS..LLV.GRPLI.DDDAIFAYLH---NRYQ.GDV..........------QSTTVDLILASF----.DVL.ANA.TFR.N..E.GQ..QTTTILRS---FLINKVPLLVSTl.............aaS-.---Ffpp..................ltseFCITEALS.....HV.DT-.--..NA..F..P..TLS.TL..F....Q..ES....--SN.ND..MFS.D.....S...---.-...--.VRQDFCFACCLHGLIP.ESSIETLLGD.IPM--.--..--.-.--QSLP.A.G..GR..Y.S.K.QNLVQQCLSDser..................................aegLIS......ELENMDGNAGA......-------................---..-----.---.--....-------.VSQ...AIVEVIK....HMCG..N.K..ETMTLKTLCSQ..L.-AR...N...PS.....SLDIM.LLFNE...P.T.SFLQPICEL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLVVSFTHRYNL...S..T.VD...L...GIK...........SP....---....-AESFVAK..LL.V.QGHL..------.----..SRALEPLAEQDQN..HLDGWI.RGLFe.....peEG..G.....GLGDDLM......S.SCPPQEF..YLLVPTLFHHIVL.....AL...S...T...........E......TL-....S..........EDG.LKGGLE............F................M....VEPFLLPS.LIPGITWLSAH......LW.EAR.P.Q..A....-.-.....-..--.-T....YI.L.QIL..SA.L.I.....K.nP.P..S.I...S..NNm.........eASHLLN..SIL....KIVAKNLEQSLRWLQRAE.pQR....H--------.----..-----.-...----.....-......--.....-D.IE.P.VS.KALE.SN...L.G.W...............E.R............R...G-.AS..KH..T.ELE.......SW.T.AT...A..........G...G..G....LAASIKQTIATLvqcglqWG.RNPGmh............impASYT..HR..Q.ILTGM..KMLG...AKRL...LSTIVDEV.KTQTEA--....---.---..---...-.....GNGSVVFDIA.ISLICAPD.AT.S...-..F...V.SS.P...G.IDILS-----.........-......GNAPQ..PLQRRLTLR.....................................EALKAEAKNMPrVLKTDTFHAET.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------virlyrrveaqlaiqqqllqhddglgaln...........................................................................................................................................................................................................................
A0A284RA81_ARMOS/399-644               ..............................................................................................................................................................................................................................................................................................tlfdrickeaathsafasvvmkrfisls--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....---T..S.F..DVEALSRLCKA..L.YLR...H...-R.....ILDII.SLHVK...I.D.ELLYQTVYL......VD-CY................D......-......-..........-.......-.......-....-....CE...........T...I.........G.....D...P...-....-.-...........-QT..........AVSH.LGDIVMFSQYTLAHFNL...D..A.KM...F...VQG...........D-....---....--RTVSGL..FL.Q.SASQ..VFS---.----..---HESLSGEDAQ..AFNAWF.KTLFd......sGS..E.....GIEDTIL......R.SSRPKTL..LKIASTLFSSAIN.....AR...I...E...........G......KI-....D..........GDT.LNNGIS............F................F....TGPLLSWT.LVGVVRSL---......LQ.EIY.R.K..G....F.M.....A..--.-P....VH.I.EVL..QT.L.L.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------lspscpk.................................................................................................................................................................................................................................................
A0A066XYH0_COLSU/50-969                ........................................................................................................................................................................................................................................................................................................vavadlflrpqphnhesl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...DPR..VPRy..lQVLSDLNYID.....TASILKSLYRY.STSRahsrdttqptt..........................................................geaqrsnlprwgSSYA.AEEV.MFYR.LT.K.S.VA..QG.T.AIQNtg...................................................tgLE..I.aN......IM.AK.WI...AL..FtdA..ATAFTVDV..M..G.QLHNSQ....V......................................REEME.SA.R.A.AF....VA.......L....LLG.VC...E..N.Q.VVLKalskp...................eaqgtrKALSE.S.LANFV.P.TI.MQ.S.AGP............IATRL..DMF...RTST.Lagfepvdeqknk..............snaeiedlfdptVALD...N..FVISe............lPIV.N.SRAGL......---.---....................----..-..--..-..----...YIYLNA..ALV.GRPLI.DDLAIFNYLN---NRYQ.GDV..........------QSTTVDLILASF----.DVL.ANA.ASR.N..E.GN..QAAHLLRS---FLMNKLPILIES................-L.SKHMygp..................vnaeYCITEALG.....RV.DT-.--..TT..F..P..TLS.SM..F....D..ET....RSNN.-P..F-T.D.....-...---.-...-S.VREEFCWACCLHGLVR.ESSIETLLGE.TPY--.--..--.-.--QSLP.A.G..GR..Y.V.K.ENLVAECLADqer..................................mqaLIG......ELDNKDGNAGA......-------................---..-----.---.--....-------.VCQ...ALTEVMG....QLCR..N.K..ETMSLKLLCSQ..L.-AQ...K...PL.....SLDVM.LMFEK...P.G.TILHPLCDL......LD-NW................K......-......-..........-.......-.......-....-....--...........-...Y.........D.....E...D...Q....G.E...........YQP..........VYEE.FGSILLLVMAFAYRYGL...S..A.SD...M...GVV...........SP....---....--DSFVAK..LL.G.QGHQ..------.----..SRPLDELSDQEKG..HLNGWI.HGLFd......sEA..G.....GLGDELM......S.SCPPQDF..YLLVSTLFQNIVL.....AF...S...T...........G......HL-....A..........EES.LRGGIE............Y................L....VDTFLLPS.LVVAITYLANS......LW.VER.S.D..-....-.-.....-..-C.QK....AI.V.RVL..NS.V.L.....A..P.T..S.I...S..NE...........AQAMLT..SVM....NIVAKPLEHSLRAYQRSD..PK....S--------.----..QEVEP.L...----.....-......--.....--.LK.A.IK.DSIP.LS...R.R.T...............-.-............G...AA.DH..TE..L.--D.......--.-.AW...S..........L...G..G....FSNSIRQTLQQLv....qWS.IHPTmd............rmpPAYT..HR..Q.MLVAL..KLLG...AKRL...LQLLYEDI.RQQTDT--....---.---..---...-.....GSGSIIYDVA.TAIVCAPD.VV.N...-..-...T.PP.N...P.VNFLD----N.........S......GNMPA..PVQRKLTLR.....................................EVLKSDAEDCKrLQKTDINLAEI.............................VVRLHRKVESQM..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------avsqaqaiqadtmlqtdlglgldagagslddamaaa....................................................................................................................................................................................................................
A0A0F4Z6U7_TALEM/3-301                 .........................................................................................................................................................................................................................................................................................................................s-SVEEWRKLLHQCLIRRIDANEFKTLAKLLARRAPLA-....................----...........................----------...........--------------.....---...-.....EA...SLLD..VVLESRAv....anAQW...DPL..VPLy..vDTLTKLGTVR.....IPTVLQSLLKH.SSIGeqqqqqqqqqqsaa.....................................................apdnkqksrgqhlsTTLM.TDTR.IIQD.AM.I.A.LS..TG.S.VPIS.......................................................--..-..-......-A.TD.AA...RI..F..T..AVADWILE..V..V.RWHTSH....Vnedqq...........................tgglmgSPDAI.SL.F.E.SL....GI.......L....LAA.LS...A..T.E.KGLEalssd...................nseafkIKLGQ.A.LTAYL.P.LC.AG.-.---............VSVPL..RNR...LDSL.Qkgfelygepns...............ksldvpmmdgvnVNAL...Q..FEASvm..........dgPVI.N.SRAGL......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...-------....----..-.-..-----------..-.---...-...--.....-----.-----...-.-.---------......-----................-......-......-..........-.......-.......-....-....--...........-...-.........-.....-...-...-....-.-...........---..........----.-----------------...-..-.--...-...---...........--....---....--------..--.-.----..------.----..-------------..------.----........--..-.....-------......-.-------..-------------.....--...-...-...........-......---....-..........---.------............-................-....--------.-----------......--.---.-.-..-....-.-.....-..--.--....--.-.---..--.-.-.....-..-.-..-.-...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------yiylnamgh...............................................................................................................................................................................................................................................
A0A1V8SII1_9PEZI/265-748               ...............................................................................................................................................................................................................................................................................................................alrmshtragl--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...FIWLNA..CLC.ARPLT.DDASMRNHVL---VRYS.ENV..........------QEAAAGLIVASF----.DVL.TNA.ILG.G..D.SS..RV---IRS---FVCNKLPLLLQGlf...........sfaKP.NASE.........................AAIQSTLS.....AV.NME.PL..SP..L..T..AGA.TG..A....R..DV....----.--..L--.-.....-...---.-...KK.TRADFLQACVMHTLVS.DTVASAMSPE.PSA--.--..--.-.---TTA.K.A..TR..Y.T.R.EGLMTQCAHNtar..................................leaIIM......ELDGMQGNAGA......-------................---..-----.---.--....-------.IAG...CLIGIVL....NLVT..A.K..DTMTLKSVCNV..L.LRK...I...-E.....LADVL.LQYIQ...P.A.DLLTPLYRT......LD-DW................V......-......-..........-.......-.......-....-....--...........-...H.........D.....E...D...Q....S.E...........FQP..........PYEE.FACILLLVLAIHHRYDL...T..V.LE...A...GAF...........TA....---....--DGFVAK..VL.F.GQWQ..------.----..SYTTAELSEQQIA..QLSKWI.EGLYatd..ehgET..T.....GIGDEVM......S.HCPPQAF..YVLVPTLFEQSIL.....AC...K...S...........G......QM-....S..........VET.ARGGQE............F................L....LEPFLLPS.LVGGLLWI---......VK.RSW.E.D..H....A.D.....G..DI.L-....--.L.QIL..DK.L.L.....R..P.S..S.S...S..QD...........MQVMHK..AIL....AIVATPLIKSLKILV---..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------lqrpdkrkeaesliailtphlhrsrtl.............................................................................................................................................................................................................................
A0A165T053_9APHY/441-708               ..................................................................................................................................................................................................................................................................................................................cshsafaa--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....-------.---...AVHKRFT....SLSQ..P.S..DVESLSHICKV..M.-CR...C...EP.....AVDIV.SIHVS...L.R.ELLSSALAF......VE-GY................D......-......-..........-.......-.......-....-....C-...........-...-.........-.....E...T...V....G.D...........PQT..........AVSH.LGEVVLFLQEMVARHNV...C..V.FHapsL...LTR...........TN....ATT....GDRKLDID..FI.L.PVAT..VYP---.----..---VHELKGEAAA..DFQAWN.KALFd......kNS..E.....GIEDSIL......R.NTRPQTL..LRITASLFANAIN.....LC...L...E...........R......KM-....E..........KEV.LVNGIQ............Y................F....LGNLLNWT.LAGTVKWL---......LA.EIR.M.K..G....Y.N.....A..--.-P....VH.L.EVL..QT.L.L.....L..S.P..S.C...-..--...........------..---....------------------..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------pqavlrlsaptilrlfpwphkqers...............................................................................................................................................................................................................................
E9EEZ5_METAQ/305-920                   ........................................................................................................................................................................................................................................................................................................pdllisntrsavyvflna--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........--SGATQSSAIELIVASF----.DIL.ANA.VFR.N..E.GP..KDAHLLKS---FLVNKVPLLLCLlflr........eptfDT.NASE.........................FCITEALS.....QV.DT-.--..SV..F..P..TAS.LM..F....D..ES....RSNN.PY..T--.-.....-...---.-...ES.VREEFCTACALHGLVQ.REHVERILGE.LSMS-.--..--.-.---YEP.S.L..EK..Y.S.K.EKLVQDCLADaek..................................vqgLIR......ELEKMDGNVGA......-------................---..-----.---.--....-------.VCQ...ALVEVMR....QLCN..N.K..ETMSLKLLCSQ..L.-AQ...K...PH.....ILDIL.LLFEK...L.P.SILDPLCQL......LD-NW................R......-......-..........-.......-.......-....-....--...........-...Y.........E.....E...D...Q....G.E...........YQP..........IYEE.FGSILLLVLAFAYRYNL...T..A.AD...I...GIT...........SP....---....--DSCVAK..IL.G.RAHI..-SR---.----..--DRDELTEQEKG..HLSGWI.HGLF.......aDS..G.....GLGDDLM......S.SCPPQDF..YLLVASLFQNIVV.....AY...T...Y...........G......YL-....S..........DET.LKGGVE............Y................L....VDTFLLPS.LVPALRFLADY......LW.VEQ.K.E..-....-.-.....-..--.QK....AI.I.KIL..QL.I.L.....L..P.S..S.I...S..GE...........ASTMLS..SVR....NLVAKPLEHSLRTYQRQD..PK....---------.---N..QDIEP.L...LRA-.....-......--.....--.--.-.LK.DSLP.LS...R.R.T...............-.-............G...GA.DH..NE..L.--E.......SW.T.NS...S..........S...T..G....LAGALRHTVQGLv....qWS.MHPSvn............smpTSYT..HR..Q.LIAAQ..KITG...AKRT...LRLLLEEV.RTQSET--....---.---..---...-.....GSANIVYDVV.AAIVCAPN.VT.N...E..P...P.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------pnnqmmdasgnvlpaiqrpltlrevlrleaegcnklqkadpvlaeiv.........................................................................................................................................................................................................
A0A0D2BFX2_9EURO/432-705               ................................................................................................................................................................................................................................................................................................................elirsdgsag--------------------------------------....................----...........................----------...........--------------.....---...-.....--...----..-------.......---...---..---....----------.....-----------.----.................................................................................----.----.----.--.-.-.--..--.-.----.......................................................--..-..-......--.--.--...--..-..-..--------..-..-.------....-......................................-----.--.-.-.--....--.......-....---.--...-..-.-.----..............................-----.-.-----.-.--.--.-.---............-----..---...----.-......................................----...-..----..............---.-.-----......---.---....................----..-..--..-..----...------..---.-----.-----------------.---..........----------------------.---.---.---.-..-.--..-----------------------................--.----.........................--------.....--.---.--..--..-..-..---.--..-....-..--....----.--..---.-.....-...---.-...--.----------------.----------.-----.--..--.-.------.-.-..--..-.-.-.----------........................................---......-----------......-------................---..-----.---.--....------S.ISH...ALVEIMH....NYCR..T.K..ETQYLKDLSNA..I.-IR...K...PA.....AINCI.TLFVP...P.S.FWLGPICML......LD-EW................R......-......-..........-.......-.......-....-....--...........-...W.........N.....E...I...H....G.E...........AQP..........VYDD.FGAAFLLLQVCKARLSL...S..E.TD...L...GIR...........KR....---....--DGFLSE..FY.N.NANA..------.----..DIDLEHLSEERRT..HLGNWI.NALY........LA..E.....GLSDELF......T.NCSPHDF..YILIPTLLRQSIT.....AY...H...Q...........E......KL-....T..........KES.LKAGLE............Y................L....LEPFLLPS.LFPALNWI---......TR.VLQ.E.D..T....L.D.....T..--.--....--.S.FIL..DV.L.I.....K..-.V..P.G...S..PE...........SRDIHG..TIL....SMSAGSLGEQIKSKQ---..--....---------.----..-----.-...----.....-......--.....--.--.-.--.----.--...-.-.-...............-.-............-...--.--..--..-.---.......--.-.--...-..........-...-..-....------------......--.----.................----..--..-.-----..----...----...--------.--------....---.---..---...-.....----------.--------.--.-...-..-...-.--.-...-.----------.........-......-----..---------.....................................-----------.-----------.............................------------..................-----......-..-.....-----------..-----.-----......----.----.-.-..--.----------------------mhddgklmais.............................................................................................................................................................................................................................................
A0A1V6NRY9_9EURO/8-986                 .......................................................................................................................................................................................................................................................................................................................aip---EQWRTFLHQCLANRIDIDEFTDLSGLMFARSPVK-....................-ENE...........................----------...........--------------.....---...-.....--...-LLD..LLLEARAs....ssVTW...DPL..LPLy..vDGLCKVGRVK.....SSSALASLLKH.SSIVdasgsgevegeg.........................................................qgspskskkqkpSTLM.TDIK.VIQD.VM.V.F.IS..TG.S.IPKT.......................................................--..-..-......-V.IE.AA...DI..Y..S..ATVDWILA..V..V.AWHNHS....Vdasqq...........................tgglmgSPDAV.SL.F.E.SL....GI.......L....LAA.LS...G..T.S.KGLEvlssd...................fnqalkAKLGQ.A.LSSYL.P.LC.ID.-.---............VSLPL..RHR...LEEL.Qkvfnlypgqps...............kalhgpaidgvnVNAL...Q..FESSvm..........dgPVV.N.TRAGL......---.---....................----..-..--..-..----...YVYINS..MVV.GRPLV.DDTILINYLT---NRYQ.GHN..........------DVLIEEIITAAF----.DVL.SNG.VYR.N..E.SG..RTMLLFRS---FLVNKLPAFFAA................IS.AA-Smvp..................ismeMCISHALS.....RL.DP-.--..NA..F..P..SFS.QM..F....S..--....MQGS.SV..L--.-.....-...---.-...SD.ARQEFLFACASHKLIR.ESSIEQLLGE.NPM--.--..--.-.--QTLP.G.G..GP..Y.V.K.DDLVSQINNNher..................................teqLIG......EIESMEGNAGA......-------................---..-----.---.--....-------.IVG...AVVDVMH....NLCH..Q.R..ETMTLKNICNS..L.-SR...R...PQ.....TLDVM.LLFRT...T.K.QVLQPLCAI......LD-SW................K......-......-..........-.......-.......-....-....--...........-...W.........D.....E...D...Q....G.E...........NQP..........VYDE.FGSILLLVLAFKYRYDL...S..P.SD...M...GIS...........DN....---....--ESFLLK..LL.D.RGAC..------.----..SQKLSDLSEKQNN..DLGAWI.GALF........IA..E.....GISEETM......S.SCSPHEF..YMLVTTLFDQSLG.....AC...E...S...........G......KL-....D..........FDT.LKGGFE............Y................L....LEPFLLPS.LVVALTWLGNH......IW.ESE.T.D..P....T.I.....P..--.--....--.I.KTL..HS.L.V.....K..P.S..S.I...S..GE...........AQAIHQ..TVL....NITGCPLEEQLKNVRTRN.qSR....T--------.----..-----.-...----.....-......--.....-D.IK.P.IL.DALE.PY...I.S.F...............R.R............V...GS.CR.rSE..L.--D.......TW.T.SH...S..........A...G..G....LIASIRTTLQALv....lWS.ANPGis............mapHAYT..HR..Q.VLAGI..RMLG...ATRV...LGAIIDEV.KQQTEA--....---.---..---...-.....GSGHIALDIA.TTMVCAPM.TE.S...-..-...F.AV.D...Q.NNYHP---VD.........T......SKEAL..PRCAILTLR.....................................DALALQHENVPkTSESDPLRAEVvvr......................larrVNMLMAPPSQ--..................-----......V..S.....NIDVSNIIQNM..HLGVE.GQEDR......MDLE.PSTA.G.V..AR.TTDNEDDPDNINQMLDKAA---ada.......................................................................................................................................................................................