#=GF ID NS7a_deltaCoV_HKU16-like
#=GF AC PF27995.1
#=GF DE Deltacoronavirus, avian coronavirus HKU16-like accessory protein NS7a
#=GF AU Bateman A;0000-0002-6982-4660
#=GF AU Paysan-Lafosse T;0000-0001-5663-0894
#=GF SE IPR044333
#=GF GA 27.00 27.00;
#=GF TC 156.30 156.10;
#=GF NC 24.30 20.50;
#=GF BM hmmbuild HMM.ann SEED.ann
#=GF SM hmmsearch -Z 90746521 -E 1000 --cpu 8 HMM pfamseq
#=GF TP Family
#=GF RN [1]
#=GF RM 29872066
#=GF RT The emergence of novel sparrow deltacoronaviruses in the United
#=GF RT States more closely related to porcine deltacoronaviruses than
#=GF RT sparrow deltacoronavirus HKU17.
#=GF RA Chen Q, Wang L, Yang C, Zheng Y, Gauger PC, Anderson T, Harmon
#=GF RA KM, Zhang J, Yoon KJ, Main RG, Li G;
#=GF RL Emerg Microbes Infect. 2018;7:105.
#=GF RN [2]
#=GF RM 30758768
#=GF RT Whole genome characterisation of quail deltacoronavirus detected
#=GF RT in Poland.
#=GF RA Domanska-Blicharz K, Kuczkowski M, Sajewicz-Krukowska J;
#=GF RL Virus Genes. 2019;55:243-247.
#=GF RN [3]
#=GF RM 29769348
#=GF RT Discovery and Sequence Analysis of Four Deltacoronaviruses from
#=GF RT Birds in the Middle East Reveal Interspecies Jumping with
#=GF RT Recombination as a Potential Mechanism for Avian-to-Avian and
#=GF RT Avian-to-Mammalian Transmission.
#=GF RA Lau SKP, Wong EYM, Tsang CC, Ahmed SS, Au-Yeung RKH, Yuen KY,
#=GF RA Wernery U, Woo PCY;
#=GF RL J Virol. 2018;92:e00265-e00218.
#=GF RN [4]
#=GF RM 22278237
#=GF RT Discovery of seven novel Mammalian and avian coronaviruses in
#=GF RT the genus deltacoronavirus supports bat coronaviruses as the
#=GF RT gene source of alphacoronavirus and betacoronavirus and avian
#=GF RT coronaviruses as the gene source of gammacoronavirus and
#=GF RT deltacoronavirus.
#=GF RA Woo PC, Lau SK, Lam CS, Lau CC, Tsang AK, Lau JH, Bai R, Teng
#=GF RA JL, Tsang CC, Wang M, Zheng BJ, Chan KH, Yuen KY;
#=GF RL J Virol. 2012;86:3995-4008.
#=GF DR SO; 0100021; polypeptide_conserved_region;
#=GF CC This entry includes the accessory protein NS7a from White-eye
#=GF CC coronavirus HKU16, Falcon coronavirus UAE-HKU27, Houbara
#=GF CC coronavirus UAE-HKU28 and Pigeon coronavirus UAE-HKU29, within
#=GF CC the Buldecovirus subgenus of deltacoronaviruses (deltaCoVs).
#=GF CC NS7a proteins in this subfamily have yet to be characterised. In
#=GF CC deltaCoVs, several avian species encode accessory protein NS7a,
#=GF CC which is homologous to Porcine coronavirus (PDCoV) HKU15
#=GF CC accessory proteins NS7 and NS7a. PDCoV NS7a is a 100 amino-acid
#=GF CC polypeptide identical to the C-terminal of NS7; it remains
#=GF CC unclear whether their functions are redundant. The PDCoV NS7
#=GF CC protein is extensively distributed in the mitochondria and may
#=GF CC be involved in various cellular processes such as cytoskeleton
#=GF CC networks and cell communication, metabolism, and protein
#=GF CC biosynthesis [1, 2, 3, 4].
#=GF SQ 3
#=GS A0A896ZID1_9NIDO/1-196 AC A0A896ZID1.1
#=GS A0A0E3KV22_9NIDO/1-196 AC A0A0E3KV22.1
#=GS A0A2Z5XXT4_9NIDO/21-217 AC A0A2Z5XXT4.1
A0A896ZID1_9NIDO/1-196 --MEFRLTPPSNPLKTMAIGCVLADKSQVVLRFLHPMPFIIQAQVREEILNMVNSLLMIPRQQHVLLGSKVRELTLLLSLMLPNATPTILNISCCLSDSQSVMVQLQVSELTPSTHVGDPKSVEVAQDLSLLMPDQpTI.SPGNAMAQRLLRYVVRPSIKLPSGLCPRVKPSLRYLVTVVVRAPMSALLILRRLEWL--ip
A0A0E3KV22_9NIDO/1-196 --MEFRLTPPSNPLKTMATGCVTPDKSQVVLPFLHPMPFIILAQVPEEILSMVNSLLMIPQQPLVLLGLRVRELTLLLNLMLPNATPTILNISCYLSDSQPEMAQLKVSELTPSTLEEDLRSVEVAQDLNLLTPEA.QAiSPGNATNLHQLRYVVRPSIKLPSGLYPRVKPFLRYLATGLVLVPMSALQTLRRRVWLIL..
A0A2Z5XXT4_9NIDO/21-217 VVMEFQLIQPSRPPKTMATGYVSIDRSQVVLQFLHPMPSIIQAQVPEEILNLVSSLLMIPRKTPGSLGLKPREQTLILNLMLPSATPTTQNMHCSLSDFQPETDQRQVLELTLFRPEEEPWNVVLVLDQCLLTPDL.KN.SPNAVTSQLQLLSDARLSTKPQSERFKRAKPFLKCLATVLRAALMLDLLTQRNQVWLTL..
#=GC seq_cons ..MEFRLTPPSNPLKTMATGCVosDKSQVVLpFLHPMPFIIQAQVPEEILNMVNSLLMIPRQshVLLGLKVRELTLLLNLMLPNATPTILNISCsLSDSQPEMsQLQVSELTPSThEEDP+SVEVAQDLsLLTPDt.ps.SPGNATuQ+QLRYVVRPSIKLPSGLaPRVKPFLRYLATVLVtAPMSALLTLRRpVWLhL..
//
