#=GF ID   NrS1-1_pol-like_head
#=GF AC   PF22761.2
#=GF DE   NrS-1 polymerase-like head domain
#=GF AU   Chuguransky S;0000-0002-0520-0736
#=GF SE   [1]
#=GF GA   27.00 27.00;
#=GF TC   41.40 198.10;
#=GF NC   24.90 22.10;
#=GF BM   hmmbuild  HMM.ann SEED.ann
#=GF SM   hmmsearch -E 1000 --cpu 8 -Z 90746521 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   32016421
#=GF RT   Structural studies reveal a ring-shaped architecture of deep-sea
#=GF RT   vent phage NrS-1  polymerase.
#=GF RA   Chen X, Su S, Chen Y, Gao Y, Li Y, Shao Z, Zhang Y, Shao Q, Liu
#=GF RA   H, Li J, Ma J, Gan J;
#=GF RL   Nucleic Acids Res. 2020;48:3343-3355.
#=GF DR   INTERPRO; IPR054540;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This entry represents the head domain found in NrS-1 polymerase
#=GF CC   from Nitratiruptor phage NrS-1, the first known phage that can
#=GF CC   infect Epsilonproteobacteria, one of the predominant primary
#=GF CC   producers in the deep-sea hydrothermal vent ecosystems. NrS-1
#=GF CC   polymerase is a multidomain enzyme and is a key component of the
#=GF CC   phage replisome [1]. This domain, together with the helicase and
#=GF CC   tail domains, is responsible for the DNA activity in this
#=GF CC   protein. It has a novel alpha/beta fold [1].
#=GF SQ   2
#=GS POL_BPNNR/304-391     AC M5AAG8.1
#=GS A6Q267_NITSB/304-391  AC A6Q267.1
POL_BPNNR/304-391                EKDPLWLYKVLLTKGIEVWFDIKLEKYGIKRNNRVDYIAKSSLQQIVFEIIGKTPKNIAVPTYIGAYEPSKPEKWEEEGIKYINLFKP
A6Q267_NITSB/304-391             EKDPLWLYKVLLTKGIEVWFDIKLEKYGIKRNNRVDYIAKSSLQQIVFEIIGKTPKNIAVPTYIGAYEPSKPEKWEEEGIKYINLFKP
#=GC seq_cons                    EKDPLWLYKVLLTKGIEVWFDIKLEKYGIKRNNRVDYIAKSSLQQIVFEIIGKTPKNIAVPTYIGAYEPSKPEKWEEEGIKYINLFKP
//