#=GF ID   PAV1-137_bromodom-like
#=GF AC   PF22306.2
#=GF DE   PAV1-137, bromodomain-like
#=GF PI   PAV1-137_bromodomain-like;
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF AU   Chuguransky S;0000-0002-0520-0736
#=GF AU   Sanchez-Pulido L;0000-0002-2300-8502
#=GF SE   ECOD:EF18775
#=GF GA   27.00 27.00;
#=GF TC   29.10 257.20;
#=GF NC   25.70 21.00;
#=GF BM   hmmbuild  HMM.ann SEED.ann
#=GF SM   hmmsearch -E 1000 --cpu 8 -Z 90746521 HMM pfamseq
#=GF TP   Domain
#=GF RC   Paper describing PDB structure 4hr1
#=GF RN   [1]
#=GF RM   23533329
#=GF RT   Crystal structure of PAV1-137: a protein from the virus PAV1
#=GF RT   that infects Pyrococcus abyssi.
#=GF RA   Leulliot N, Quevillon-Cheruel S, Graille M, Geslin C, Flament D,
#=GF RA   Le Romancer M, van Tilbeurgh H;
#=GF RL   Archaea. 2013;2013:568053.
#=GF DR   INTERPRO; IPR055115;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This entry represents a Bromodomain-like domain present in
#=GF CC   PAV1-137 protein from PAV1 virus. Its function is unknown and it
#=GF CC   has been suggested that this domain could be involved in
#=GF CC   protein-protein interactions [1].
#=GF SQ   1
#=GS A5Y2E1_9VIRU/18-132  AC A5Y2E1.1
A5Y2E1_9VIRU/18-132             NGAQTVIQKISWLRTAIAFLKGYMETTGATKKELEQVEKLKERVDEIATAVNWDVYAQYARGDFNLLSDDEYKEIQKALLVLEDIKEQIIVEMLRVGLAQGQMGTLKISDYLDSL
#=GC seq_cons                   NGAQTVIQKISWLRTAIAFLKGYMETTGATKKELEQVEKLKERVDEIATAVNWDVYAQYARGDFNLLSDDEYKEIQKALLVLEDIKEQIIVEMLRVGLAQGQMGTLKISDYLDSL
//