GenomeNet

Database: Pfam
Entry: PF11395
LinkDB: PF11395
Original site: PF11395 
#=GF ID   bCoV_NS7B
#=GF AC   PF11395.11
#=GF DE   Betacoronavirus NS7B protein
#=GF PI   DUF2873; Corona_NS7B;
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF AU   Pollington J;0000-0002-8158-8998
#=GF AU   Finn RD;0000-0001-8626-2148
#=GF SE   Pfam-B_002845 (release 23.0)
#=GF GA   25.00 25.00;
#=GF TC   84.40 84.40;
#=GF NC   22.20 21.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   17037516
#=GF RT   Structure, expression, and intracellular localization of the
#=GF RT   SARS-CoV accessory proteins 7a and 7b.
#=GF RA   Pekosz A, Schaecher SR, Diamond MS, Fremont DH, Sims AC, Baric
#=GF RA   RS;
#=GF RL   Adv Exp Med Biol. 2006;581:115-120.
#=GF RN   [2]
#=GF RM   18632859
#=GF RT   The transmembrane domain of the severe acute respiratory
#=GF RT   syndrome coronavirus ORF7b protein is necessary and sufficient
#=GF RT   for its retention in the Golgi complex.
#=GF RA   Schaecher SR, Diamond MS, Pekosz A;
#=GF RL   J Virol. 2008;82:9477-9491.
#=GF RN   [3]
#=GF RM   17079322
#=GF RT   The ORF7b protein of severe acute respiratory syndrome
#=GF RT   coronavirus (SARS-CoV) is  expressed in virus-infected cells and
#=GF RT   incorporated into SARS-CoV particles.
#=GF RA   Schaecher SR, Mackenzie JM, Pekosz A;
#=GF RL   J Virol. 2007;81:718-731.
#=GF DR   INTERPRO; IPR021532;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This entry corresponds to Human SARS coronavirus (SARS-CoV) and
#=GF CC   similar betacoronaviruses  NS7B protein (also known as accessory
#=GF CC   protein 7b, NS7B, ORF7b and 7b)[1]. It was found to be a 
#=GF CC   structural component of SARS-CoV virions and an integral
#=GF CC   membrane protein. Its transmembrane domain is essential for
#=GF CC   Golgi compartment localization [2][3].
#=GF SQ   6
#=GS NS7B_BC279/1-43       AC P0C5A9.1
#=GS A0A0K1Z050_SARS/1-43  AC A0A0K1Z050.1
#=GS NS7B_SARS/1-43        AC Q7TFA1.1
#=GS NS7B_SARS2/1-43       AC P0DTD8.1
#=GS U5WI60_SARS/1-43      AC U5WI60.1
#=GS A0A0U1WJY3_SARS/1-43  AC A0A0U1WJY3.1
NS7B_BC279/1-43                  MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDIEEPCNK..
A0A0K1Z050_SARS/1-43             MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDIEEPCNK..
NS7B_SARS/1-43                   MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPCTK..
NS7B_SARS2/1-43                  MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETC--ha
U5WI60_SARS/1-43                 MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDIEEPCNK..
A0A0U1WJY3_SARS/1-43             MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDIEEPCNK..
#=GC seq_cons                    MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDIEEPCNK..
//
DBGET integrated database retrieval system