#=GF ID   Phi6_P8
#=GF AC   PF25655.1
#=GF DE   Phi6 bacteriophage P8 capsid protein
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   UniProtKB:P07579
#=GF GA   27.00 27.00;
#=GF TC   29.70 220.30;
#=GF NC   24.80 23.20;
#=GF BM   hmmbuild  HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 90746521 --cpu 8 -E 1000 HMM pfamseq
#=GF TP   Family
#=GF RC   Paper describing PDB structure 5muu
#=GF RN   [1]
#=GF RM   28287099
#=GF RT   Double-stranded RNA virus outer shell assembly by bona fide
#=GF RT   domain-swapping.
#=GF RA   Sun Z, El Omari K, Sun X, Ilca SL, Kotecha A, Stuart DI, Poranen
#=GF RA   MM, Huiskonen JT;
#=GF RL   Nat Commun. 2017;8:14814.
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This entry represents the outer shell protein P8 from dsRNA
#=GF CC   bacteriophage phi6, which forms the T=13 shell of the
#=GF CC   nucleocapsid. The protein consists of two alpha-helical domains:
#=GF CC   an N-terminal peripheral domain and a C-terminal core domain,
#=GF CC   joined by a ~10 residue linker that allows the trimer to adopt
#=GF CC   either a closed or an open conformation. In the open
#=GF CC   conformation, the trimers swap domains with each other, allowing
#=GF CC   assembly of the outer shell. This domain-swapping is regulated
#=GF CC   by calcium concentration, which induces the transition of P8
#=GF CC   from the closed to open conformation. The structure includes a
#=GF CC   proline residue (Pro93) that breaks a helix in the C-terminal
#=GF CC   domain and may play a role in modulating the equilibrium between
#=GF CC   open and closed states.
#=GF SQ   4
#=GS CAPSD_BPPH6/10-149      AC P07579.1
#=GS A0A1W2KDT9_9VIRU/1-143  AC A0A1W2KDT9.1
#=GS Q9FZU2_9VIRU/2-150      AC Q9FZU2.1
#=GS A0A9X9JVS4_9VIRU/1-143  AC A0A9X9JVS4.1
CAPSD_BPPH6/10-149                 AVPAIESAIAATPGLVSRIAAAIGSKVSPSAILAAVKSNPVVAGLTLAQIGSTGYDAYQQLLENHPE.....VAEMLKD-..-LSFK-ADEIQPDFIGNLGQYREELELVEDAARFVGGMSNLIRLRQALELDIKYYGLKMQLNDMGYRS
A0A1W2KDT9_9VIRU/1-143             MYPAVAAALRAAPGAVKLLATRLGVPSSVSGVLNFAKANPTTFMLAAKETFDQGVAIYDLLGEAIGE.....VEQSANAQ..KISFKQIDSVGGNVLDQLDALADEMQDIDVAIRVVGSLHELLALRRALLMSEEHFTMYQRLKRLKGRI
Q9FZU2_9VIRU/2-150                 AFP-LAVVAQTAGRFLPALASRLGVSAKMGEVLNFAKANPTTFMLATKEVYDQGVSLYDSLFEAAPEkmtkaVAQLENSDagRSRLIEADLVPQGTLVGLDALSDEIDTITAAIEVAGSFDALMQFRRALSLNDEHYALYLKVKRLGKRT
A0A9X9JVS4_9VIRU/1-143             MYPAVAAALRAAPGAVKSLATRLGVPNSISGVLNFAKANPTTFMLAAKETFDQGVAVYDLLGEAIGE.....VEASASQQ..KIGFKPIDSVGGNVLDQLDALADEMQDIDTALRVVGSLDELLALRRALLMSEEHFTMYQRLKRLKGRI
#=GC seq_cons                      haPAlAuAlpAAPGhVptLAoRLGVssShSuVLNFAKANPTTFMLAsKEsaDQGVulYD.LhEAhsE.....Vtp.tssp..+luFK.hDpVssssLspLDALuDEhpsI-sAlRVVGShcpLltLRRAL.hs-EHashY.+LKRLttRh
//