GenomeNet

Database: Pfam
Entry: RPA43_OB
LinkDB: RPA43_OB
Original site: RPA43_OB 
#=GF ID   RPA43_OB
#=GF AC   PF17875.4
#=GF DE   RPA43 OB domain in RNA Pol I
#=GF AU   El-Gebali S;0000-0003-1378-5495
#=GF SE   ECOD:EUF00577
#=GF GA   27.60 27.60;
#=GF TC   27.60 27.60;
#=GF NC   27.30 27.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF CL   CL0021
#=GF RN   [1]
#=GF RM   18160037
#=GF RT   Functional architecture of RNA polymerase I.
#=GF RA   Kuhn CD, Geiger SR, Baumli S, Gartmann M, Gerber J, Jennebach S,
#=GF RA   Mielke T, Tschochner H, Beckmann R, Cramer P;
#=GF RL   Cell. 2007;131:1260-1272.
#=GF RN   [2]
#=GF RM   24153182
#=GF RT   RNA polymerase I structure and transcription regulation.
#=GF RA   Engel C, Sainsbury S, Cheung AC, Kostrewa D, Cramer P;
#=GF RL   Nature. 2013;502:650-655.
#=GF RN   [3]
#=GF RM   24153184
#=GF RT   Crystal structure of the 14-subunit RNA polymerase I.
#=GF RA   Fernandez-Tornero C, Moreno-Morcillo M, Rashid UJ, Taylor NM,
#=GF RA   Ruiz FM, Gruene T, Legrand P, Steuerwald U, Muller CW;
#=GF RL   Nature. 2013;502:644-649.
#=GF DR   INTERPRO; IPR041178;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This is OB domain found in RPA43 proteins (DNA-directed RNA
#=GF CC   polymerase I subunit RPA43, also known as A43) in yeast.
#=GF CC   Functional analysis of RNA polymerase I show that, subunits A14
#=GF CC   and A43 form the heterodimer A14/43, which is distantly related
#=GF CC   to Rpb4/7 in Pol II and C17/25 in Pol III [1]. Crystal structure
#=GF CC   analysis show that A43-A14 heterodimer forms the stalk that
#=GF CC   provides a platform for initiation factors and interacts with
#=GF CC   newly synthesized RNA [3].
#=GF SQ   1148
#=GS A0A420U509_FUSOX/284-397   AC A0A420U509.1
#=GS A0A4P9ZWI3_9FUNG/78-194    AC A0A4P9ZWI3.1
#=GS G2Q989_MYCTT/306-430       AC G2Q989.1
#=GS A0A067N1B1_9AGAM/163-301   AC A0A067N1B1.1
#=GS A0A437CWG6_ORYJA/158-372   AC A0A437CWG6.1
#=GS A0A081CE30_PSEA2/229-325   AC A0A081CE30.1
#=GS A0A0K8LBQ9_9EURO/180-338   AC A0A0K8LBQ9.1
#=GS A0A091P484_9PASS/44-250    AC A0A091P484.1
#=GS A0A1B7TGX6_9ASCO/1-68      AC A0A1B7TGX6.1
#=GS A0A401GEU1_9APHY/142-264   AC A0A401GEU1.1
#=GS A0A287R928_HORVV/1-149     AC A0A287R928.1
#=GS A0A3M7M3U8_9PLEO/135-239   AC A0A3M7M3U8.1
#=GS A0A2T3B4U6_AMORE/146-246   AC A0A2T3B4U6.1
#=GS K5W6M7_PHACS/131-246       AC K5W6M7.1
#=GS A0A0C9U8W3_SPHS4/118-256   AC A0A0C9U8W3.1
#=GS A0A1V6UB47_9EURO/152-290   AC A0A1V6UB47.1
#=GS A0A5C2S240_9APHY/156-275   AC A0A5C2S240.1
#=GS A0A1B7MVA9_9AGAM/132-259   AC A0A1B7MVA9.1
#=GS A0A453KJY3_AEGTS/61-128    AC A0A453KJY3.1
#=GS A0A3P4NGT7_GULGU/125-334   AC A0A3P4NGT7.1
#=GS A0A4Y9ZDT9_9AGAM/127-280   AC A0A4Y9ZDT9.1
#=GS A0A3L6R6V1_PANMI/96-249    AC A0A3L6R6V1.1
#=GS A0A2I2FAP6_9EURO/188-355   AC A0A2I2FAP6.1
#=GS X0BTJ9_FUSOX/283-396       AC X0BTJ9.1
#=GS A0A026W741_OOCBI/78-133    AC A0A026W741.1
#=GS A0A2N6NXY9_BEABA/259-372   AC A0A2N6NXY9.1
#=GS A0A1S3FUJ6_DIPOR/125-317   AC A0A1S3FUJ6.1
#=GS A0A4R8RN27_COLTR/298-421   AC A0A4R8RN27.1
#=GS A0A151MQG1_ALLMI/110-317   AC A0A151MQG1.1
#=GS A0A2I2G9N7_9EURO/187-347   AC A0A2I2G9N7.1
#=GS A0A287R8U4_HORVV/81-153    AC A0A287R8U4.1
#=GS A0A2B7ZL11_9EURO/244-411   AC A0A2B7ZL11.1
#=GS I2GVU7_TETBL/127-241       AC I2GVU7.1
#=GS A0A091LH10_CATAU/41-247    AC A0A091LH10.1
#=GS N1PVX8_DOTSN/131-203       AC N1PVX8.1
#=GS A0A067R3D0_ZOONE/104-371   AC A0A067R3D0.1
#=GS F1SC14_PIG/125-334         AC F1SC14.2
#=GS A0A286UH09_9AGAM/148-305   AC A0A286UH09.1
#=GS A0A7E6CJL1_9CHIR/125-379   AC A0A7E6CJL1.1
#=GS Q6CLK4_KLULA/121-220       AC Q6CLK4.1
#=GS A0A4Q4W9H2_9PEZI/309-434   AC A0A4Q4W9H2.1
#=GS A0A367Y118_9ASCO/128-221   AC A0A367Y118.1
#=GS A0A6J1NNX8_BICAN/100-271   AC A0A6J1NNX8.1
#=GS A5DRS4_LODEL/129-238       AC A5DRS4.1
#=GS A0A5N6SJP6_ASPPS/248-396   AC A0A5N6SJP6.1
#=GS A0A5N6L0P5_9ROSI/176-285   AC A0A5N6L0P5.1
#=GS A0A367LD87_9HYPO/400-513   AC A0A367LD87.1
#=GS A0A2A9NAP9_9AGAR/122-224   AC A0A2A9NAP9.1
#=GS A0A101MNI4_9EURO/190-328   AC A0A101MNI4.1
#=GS A0A2B7Y1H9_9EURO/227-383   AC A0A2B7Y1H9.1
#=GS F2EDK3_HORVV/98-250        AC F2EDK3.1
#=GS K0KJA1_WICCF/143-248       AC K0KJA1.1
#=GS T0KE68_COLGC/283-405       AC T0KE68.1
#=GS A0A0C7NES5_9SACH/126-227   AC A0A0C7NES5.1
#=GS A0A2K6SZF5_SAIBB/125-261   AC A0A2K6SZF5.1
#=GS V9ETG2_PHYPR/83-269        AC V9ETG2.1
#=GS A0A1E5RDD9_HANUV/118-208   AC A0A1E5RDD9.1
#=GS A0A5B1QRQ7_9AGAM/128-262   AC A0A5B1QRQ7.1
#=GS A0A2T4ABS0_TRIHA/120-233   AC A0A2T4ABS0.1
#=GS A0A6L2Q1Y6_COPFO/102-353   AC A0A6L2Q1Y6.1
#=GS A0A1L7WKR2_9HELO/157-260   AC A0A1L7WKR2.1
#=GS A0A4V5NGY1_9PEZI/175-280   AC A0A4V5NGY1.1
#=GS A0A1V6P7K7_PENDC/159-301   AC A0A1V6P7K7.1
#=GS A0A166V712_9HYPO/288-401   AC A0A166V712.1
#=GS A0A177DRU9_ALTAL/121-225   AC A0A177DRU9.1
#=GS Q2U264_ASPOR/283-431       AC Q2U264.1
#=GS A0A0E0FI08_ORYNI/81-229    AC A0A0E0FI08.1
#=GS A0A0C2YG17_HEBCY/84-203    AC A0A0C2YG17.1
#=GS A0A2P5I0C6_9PEZI/218-348   AC A0A2P5I0C6.1
#=GS A0A177CZU0_9PLEO/124-227   AC A0A177CZU0.1
#=GS A0A6P7FSH0_DIAVI/104-234   AC A0A6P7FSH0.1
#=GS A0A1Z5TRW6_HORWE/285-390   AC A0A1Z5TRW6.1
#=GS A0A439D8W1_9PEZI/254-375   AC A0A439D8W1.1
#=GS A0A5N3XSW1_MUNRE/121-331   AC A0A5N3XSW1.1
#=GS A0A0F9Y0P2_TRIHA/254-367   AC A0A0F9Y0P2.1
#=GS A0A0A2W9R5_BEABA/255-368   AC A0A0A2W9R5.1
#=GS A0A2P6TLW3_CHLSO/81-123    AC A0A2P6TLW3.1
#=GS R9PFN4_PSEHS/142-233       AC R9PFN4.1
#=GS A0A672FAW0_SALFA/140-367   AC A0A672FAW0.1
#=GS A0A455BPW8_PHYMC/125-289   AC A0A455BPW8.1
#=GS H3BX99_TETNG/124-340       AC H3BX99.1
#=GS I2K289_DEKBR/155-235       AC I2K289.1
#=GS A0A5N5DS73_9PEZI/167-271   AC A0A5N5DS73.1
#=GS W1NR12_AMBTC/81-235        AC W1NR12.1
#=GS F0UK09_AJEC8/234-392       AC F0UK09.1
#=GS K9G4Q5_PEND2/156-294       AC K9G4Q5.1
#=GS A0A0C4EGQ6_MAGP6/4-102     AC A0A0C4EGQ6.1
#=GS F7F5A4_MONDO/240-455       AC F7F5A4.2
#=GS K3Z901_SETIT/101-254       AC K3Z901.1
#=GS A0A3R7GGL3_9EURO/179-337   AC A0A3R7GGL3.1
#=GS A0A401PME0_SCYTO/115-309   AC A0A401PME0.1
#=GS A0A1Q8RRX1_9PEZI/290-409   AC A0A1Q8RRX1.1
#=GS A0A2G4T6K6_RHIZD/126-242   AC A0A2G4T6K6.1
#=GS A0A3B6KHY3_WHEAT/98-248    AC A0A3B6KHY3.1
#=GS A0A5B8MQP1_9CHLO/81-154    AC A0A5B8MQP1.1
#=GS A0A086TB97_ACRC1/265-378   AC A0A086TB97.1
#=GS R9AFX6_WALI9/105-198       AC R9AFX6.1
#=GS F4PAT8_BATDJ/144-203       AC F4PAT8.1
#=GS A0A369JD72_HYPMA/129-252   AC A0A369JD72.1
#=GS A0A409VPN4_PSICY/106-224   AC A0A409VPN4.1
#=GS A0A4U0XL01_9PEZI/105-204   AC A0A4U0XL01.1
#=GS A0A0E0MN61_ORYPU/81-143    AC A0A0E0MN61.1
#=GS A5DC09_PICGU/125-223       AC A5DC09.1
#=GS A0A4Q4TDL7_9PEZI/306-430   AC A0A4Q4TDL7.1
#=GS A0A094BR87_9PEZI/164-261   AC A0A094BR87.1
#=GS H6C0M7_EXODN/256-394       AC H6C0M7.1
#=GS A0A6J3MEM4_9PEZI/118-163   AC A0A6J3MEM4.1
#=GS A0A1L9Q4I5_ASPVE/177-347   AC A0A1L9Q4I5.1
#=GS A0A672SLB4_SINGR/132-282   AC A0A672SLB4.1
#=GS A0A3B5KGN9_TAKRU/129-341   AC A0A3B5KGN9.2
#=GS A0A340X8V4_LIPVE/125-328   AC A0A340X8V4.1
#=GS A0A066VIS4_TILAU/225-342   AC A0A066VIS4.1
#=GS A0A315UWE7_GAMAF/137-285   AC A0A315UWE7.1
#=GS A4SB27_OSTLU/127-170       AC A4SB27.1
#=GS C0NB42_AJECG/234-402       AC C0NB42.1
#=GS A0A369GQS0_9HYPO/293-406   AC A0A369GQS0.1
#=GS A0A5E4Q7I6_9NEOP/56-150    AC A0A5E4Q7I6.1
#=GS A0A452RSL0_URSAM/125-335   AC A0A452RSL0.1
#=GS A0A4T0WZ76_9ASCO/929-1108  AC A0A4T0WZ76.1
#=GS A0A6J2QNJ3_COTGO/141-386   AC A0A6J2QNJ3.1
#=GS A0A4S3JT50_9EURO/184-333   AC A0A4S3JT50.1
#=GS A0A5N6TK71_9EURO/184-334   AC A0A5N6TK71.1
#=GS A0A178F698_TRIRU/199-341   AC A0A178F698.1
#=GS A0A1R1X335_9FUNG/230-367   AC A0A1R1X335.1
#=GS A0A2K3QGS4_9HYPO/306-419   AC A0A2K3QGS4.1
#=GS A0A316VNN4_9BASI/88-217    AC A0A316VNN4.1
#=GS A0A1B8AZ98_FUSPO/268-381   AC A0A1B8AZ98.1
#=GS A0A093Y146_9PEZI/165-262   AC A0A093Y146.1
#=GS A0A5N5K6G9_9PEZI/303-433   AC A0A5N5K6G9.1
#=GS A0A1X2IEQ1_9FUNG/126-248   AC A0A1X2IEQ1.1
#=GS A0A1R1XD67_9FUNG/357-445   AC A0A1R1XD67.1
#=GS A7YWA1_BOVIN/121-328       AC A7YWA1.1
#=GS A0A3G2S827_9BASI/92-193    AC A0A3G2S827.1
#=GS A0A5N6ZQ50_9EURO/188-336   AC A0A5N6ZQ50.1
#=GS I1BVW7_RHIO9/129-247       AC I1BVW7.1
#=GS W2S4E4_9EURO/357-494       AC W2S4E4.1
#=GS A0A024G6Y8_9STRA/100-233   AC A0A024G6Y8.1
#=GS A0A6I9IYB3_CHRAS/125-330   AC A0A6I9IYB3.1
#=GS A0A2U9R1G4_PICKU/136-240   AC A0A2U9R1G4.1
#=GS A0A0E0A5L6_9ORYZ/81-229    AC A0A0E0A5L6.1
#=GS C4JKG6_UNCRE/240-371       AC C4JKG6.1
#=GS W6MHD2_9ASCO/124-231       AC W6MHD2.1
#=GS A6R469_AJECN/233-407       AC A6R469.1
#=GS A0A1R0H296_9FUNG/184-344   AC A0A1R0H296.1
#=GS A0A0K6FL51_9AGAM/146-251   AC A0A0K6FL51.1
#=GS A0A163B6A5_PHYB8/82-120    AC A0A163B6A5.1
#=GS A0A168PN23_MUCCL/126-243   AC A0A168PN23.1
#=GS U7PXU5_SPOS1/194-322       AC U7PXU5.1
#=GS A0A437ASR3_CHISP/111-295   AC A0A437ASR3.1
#=GS A0A5C3DVU4_9BASI/133-234   AC A0A5C3DVU4.1
#=GS M5BIX0_THACB/148-253       AC M5BIX0.1
#=GS A0A428Q024_9HYPO/297-410   AC A0A428Q024.1
#=GS A0A6P8PSE2_GEOSA/149-298   AC A0A6P8PSE2.1
#=GS A0A3Q2ZUR5_KRYMA/141-365   AC A0A3Q2ZUR5.1
#=GS M2UUC1_COCH5/119-223       AC M2UUC1.1
#=GS J9KGX1_ACYPI/91-270        AC J9KGX1.2
#=GS A0A2P7YS99_9ASCO/124-224   AC A0A2P7YS99.1
#=GS A0A072P0F1_9EURO/242-374   AC A0A072P0F1.1
#=GS A0A1E3NUQ8_WICAA/60-166    AC A0A1E3NUQ8.1
#=GS A0A0C9N5N9_9FUNG/126-243   AC A0A0C9N5N9.1
#=GS V2X7I9_MONRO/121-237       AC V2X7I9.1
#=GS G3HDP5_CRIGR/5-112         AC G3HDP5.1
#=GS A0A238FKJ7_9BASI/166-318   AC A0A238FKJ7.1
#=GS A0A2K5D818_AOTNA/125-268   AC A0A2K5D818.1
#=GS A0A3R7LX78_PENVA/98-228    AC A0A3R7LX78.1
#=GS A0A668UUI8_OREAU/141-285   AC A0A668UUI8.1
#=GS A0A067PZU0_9AGAM/141-263   AC A0A067PZU0.1
#=GS A0A6J1WLW0_GALME/100-305   AC A0A6J1WLW0.1
#=GS A0A7D8YZV8_9TREE/71-151    AC A0A7D8YZV8.1
#=GS A0A2V1CTZ6_9HELO/160-263   AC A0A2V1CTZ6.1
#=GS A0A6P7NYL6_BETSP/136-364   AC A0A6P7NYL6.1
#=GS A0A4Y8D9L6_9HELO/159-265   AC A0A4Y8D9L6.1
#=GS S0EEG3_GIBF5/284-397       AC S0EEG3.1
#=GS Q6FV17_CANGA/127-230       AC Q6FV17.1
#=GS A0A1B8DZ63_9PEZI/162-259   AC A0A1B8DZ63.1
#=GS A0A672TNL6_STRHB/107-318   AC A0A672TNL6.1
#=GS A0A061AP78_CYBFA/127-228   AC A0A061AP78.1
#=GS A2QYA8_ASPNC/174-343       AC A2QYA8.1
#=GS A0A446U6Y9_TRITD/98-249    AC A0A446U6Y9.1
#=GS A0A6P3EVH2_OCTDE/125-335   AC A0A6P3EVH2.1
#=GS A0A2K6ABF5_MANLE/125-332   AC A0A2K6ABF5.1
#=GS A0A3M9YCZ6_9PEZI/284-401   AC A0A3M9YCZ6.1
#=GS A0A1V1TAT5_9FUNG/280-401   AC A0A1V1TAT5.1
#=GS A0A2H3JJF5_WOLCO/127-241   AC A0A2H3JJF5.1
#=GS A0A6P5B6J7_BOSIN/121-330   AC A0A6P5B6J7.1
#=GS S8AJT4_DACHA/163-284       AC S8AJT4.1
#=GS A0A420YNT0_9PEZI/269-413   AC A0A420YNT0.1
#=GS A0A2R5G9P2_9STRA/115-260   AC A0A2R5G9P2.1
#=GS A0A1Y2I3I3_9FUNG/79-196    AC A0A1Y2I3I3.1
#=GS A0A2K6DJH1_MACNE/125-291   AC A0A2K6DJH1.1
#=GS A0A0M8N469_9HYPO/308-421   AC A0A0M8N469.1
#=GS A0A015K8B6_RHIIW/130-234   AC A0A015K8B6.1
#=GS A0A3Q7WDG2_URSAR/125-341   AC A0A3Q7WDG2.1
#=GS A0A178ZYW5_9EURO/246-383   AC A0A178ZYW5.1
#=GS A0A0E0A5L7_9ORYZ/81-231    AC A0A0E0A5L7.1
#=GS H2AVJ6_KAZAF/126-234       AC H2AVJ6.1
#=GS J3MBP0_ORYBR/163-318       AC J3MBP0.1
#=GS W9CEX8_SCLBF/154-258       AC W9CEX8.1
#=GS RPA43_HUMAN/125-271        AC Q3B726.1
#=GS A0A3Q2D0P0_CYPVA/137-374   AC A0A3Q2D0P0.1
#=GS A0A0A2JNP3_PENEN/156-295   AC A0A0A2JNP3.1
#=GS F0ZA80_DICPU/75-138        AC F0ZA80.1
#=GS A0A3F3Q987_9EURO/174-343   AC A0A3F3Q987.1
#=GS A0A401SFF1_CHIPU/116-316   AC A0A401SFF1.1
#=GS A0A4X2K649_VOMUR/112-310   AC A0A4X2K649.1
#=GS A0A2K1QJ44_9PEZI/335-479   AC A0A2K1QJ44.1
#=GS A0A0L1JEQ6_ASPNO/188-336   AC A0A0L1JEQ6.1
#=GS Q759A0_ASHGO/124-226       AC Q759A0.1
#=GS A0A117E499_ASPNG/179-358   AC A0A117E499.1
#=GS E1ZDH2_CHLVA/81-127        AC E1ZDH2.1
#=GS A0A3Q7P587_CALUR/125-333   AC A0A3Q7P587.1
#=GS A0A4W6EWY7_LATCA/121-324   AC A0A4W6EWY7.1
#=GS A0A091F368_CORBR/41-249    AC A0A091F368.1
#=GS A0A5C6NF67_9TELE/141-358   AC A0A5C6NF67.1
#=GS A0A4W6ETK7_LATCA/126-329   AC A0A4W6ETK7.1
#=GS G3T2G1_LOXAF/125-330       AC G3T2G1.1
#=GS A0A6J0ZED4_ODOVR/121-262   AC A0A6J0ZED4.1
#=GS A0A1E3NM78_9ASCO/101-196   AC A0A1E3NM78.1
#=GS A8N6U3_COPC7/119-245       AC A8N6U3.1
#=GS M3D922_SPHMS/122-193       AC M3D922.1
#=GS A7RZD8_NEMVE/84-124        AC A7RZD8.1
#=GS A0A087VPX4_BALRE/41-248    AC A0A087VPX4.1
#=GS A0A166FCW1_9AGAM/100-227   AC A0A166FCW1.1
#=GS M3JSR8_CANMX/125-218       AC M3JSR8.1
#=GS A0A2T3A1Y5_9PEZI/101-151   AC A0A2T3A1Y5.1
#=GS A0A3Q7RSG9_VULVU/121-335   AC A0A3Q7RSG9.1
#=GS F1PS84_CANLF/121-332       AC F1PS84.3
#=GS M4B8Q8_HYAAE/83-261        AC M4B8Q8.1
#=GS A0A151GAC9_9HYPO/283-396   AC A0A151GAC9.1
#=GS K8ELI5_9CHLO/111-275       AC K8ELI5.1
#=GS G7MLQ6_MACMU/125-290       AC G7MLQ6.1
#=GS D5GKX5_TUBMM/154-254       AC D5GKX5.1
#=GS A0A3M2T1Y4_9EURO/175-320   AC A0A3M2T1Y4.1
#=GS A0A093GRP6_DRYPU/100-305   AC A0A093GRP6.1
#=GS A0A5C3MIX0_9AGAR/121-238   AC A0A5C3MIX0.1
#=GS A0A0A1T3C6_9HYPO/259-372   AC A0A0A1T3C6.1
#=GS A0A177VIX9_9BASI/186-301   AC A0A177VIX9.1
#=GS RPA43_DANRE/133-388        AC Q6PHG8.2
#=GS B6QUX9_TALMQ/170-340       AC B6QUX9.1
#=GS A0A2Y9JM54_ENHLU/125-333   AC A0A2Y9JM54.1
#=GS A0A453KK92_AEGTS/81-150    AC A0A453KK92.1
#=GS A0A225ASV1_9EURO/184-355   AC A0A225ASV1.1
#=GS G2XUM9_BOTF4/159-265       AC G2XUM9.1
#=GS A0A428PCN7_9HYPO/299-412   AC A0A428PCN7.1
#=GS A0A395MKV6_9HYPO/262-375   AC A0A395MKV6.1
#=GS G9PC89_HYPAI/120-233       AC G9PC89.1
#=GS A0A453KK97_AEGTS/125-190   AC A0A453KK97.1
#=GS A0A2K6MTI5_RHIBE/125-286   AC A0A2K6MTI5.1
#=GS A0A4Q2D1X9_9AGAR/124-240   AC A0A4Q2D1X9.1
#=GS I6NCP6_ERECY/130-233       AC I6NCP6.1
#=GS R4XDG9_TAPDE/165-262       AC R4XDG9.1
#=GS A0A0C3HBW3_9PEZI/162-262   AC A0A0C3HBW3.1
#=GS A0A7E6CHY3_9CHIR/125-438   AC A0A7E6CHY3.1
#=GS A0A6P5LJ56_PHACI/110-324   AC A0A6P5LJ56.1
#=GS A0A1L8FVY7_XENLA/122-464   AC A0A1L8FVY7.1
#=GS A0A1L9VJ41_ASPGL/169-317   AC A0A1L9VJ41.1
#=GS G5BZJ2_HETGA/125-324       AC G5BZJ2.1
#=GS A0A167PLD9_CALVF/139-239   AC A0A167PLD9.1
#=GS A0A0C9Y685_9AGAR/127-244   AC A0A0C9Y685.1
#=GS A0A4Z0Y9E1_9PEZI/251-366   AC A0A4Z0Y9E1.1
#=GS A0A1G4MCB2_LACFM/125-225   AC A0A1G4MCB2.1
#=GS A0A1B8F7G8_9PEZI/164-261   AC A0A1B8F7G8.1
#=GS J3K430_COCIM/186-319       AC J3K430.2
#=GS A0A1Y2AJ81_9TREE/71-181    AC A0A1Y2AJ81.1
#=GS A0A452FW74_CAPHI/121-331   AC A0A452FW74.1
#=GS A0A5N5WVS0_9EURO/185-336   AC A0A5N5WVS0.1
#=GS A0A176WED0_MARPO/82-338    AC A0A176WED0.1
#=GS A0A3P8VL67_CYNSE/141-371   AC A0A3P8VL67.1
#=GS A0A1S9DIP4_ASPOZ/188-336   AC A0A1S9DIP4.1
#=GS W7HNZ1_9PEZI/154-257       AC W7HNZ1.1
#=GS A0A226N606_CALSU/114-335   AC A0A226N606.1
#=GS A1D987_NEOFI/180-339       AC A1D987.1
#=GS A0A0D9RM70_CHLSB/125-291   AC A0A0D9RM70.1
#=GS A0A286Y4L5_CAVPO/125-326   AC A0A286Y4L5.1
#=GS A0A0W8CL96_PHYNI/83-269    AC A0A0W8CL96.1
#=GS A0A2T2P6K5_CORCC/122-231   AC A0A2T2P6K5.1
#=GS A0A4S4LTB0_9AGAM/142-259   AC A0A4S4LTB0.1
#=GS A0A0C9M1U3_9FUNG/213-318   AC A0A0C9M1U3.1
#=GS A0A4S4LEZ3_9AGAM/130-263   AC A0A4S4LEZ3.1
#=GS A0A0E9NGD8_SAICN/141-190   AC A0A0E9NGD8.1
#=GS A0A0D2HKI2_9EURO/250-387   AC A0A0D2HKI2.1
#=GS A0A5E3XAM2_9AGAM/108-222   AC A0A5E3XAM2.1
#=GS A0A4P9WZ69_9FUNG/106-393   AC A0A4P9WZ69.1
#=GS A0A094GZB8_9PEZI/164-261   AC A0A094GZB8.1
#=GS A0A372QZT0_9GLOM/130-234   AC A0A372QZT0.1
#=GS A0A287R900_HORVV/79-231    AC A0A287R900.1
#=GS G1XR41_ARTOA/160-283       AC G1XR41.1
#=GS A0A341AXK8_NEOAA/125-326   AC A0A341AXK8.1
#=GS A0A1Q3E3L9_LENED/139-253   AC A0A1Q3E3L9.1
#=GS A0A0P5FHP0_9CRUS/103-283   AC A0A0P5FHP0.1
#=GS A0A024U6U7_9STRA/71-126    AC A0A024U6U7.1
#=GS Q6BX66_DEBHA/184-282       AC Q6BX66.2
#=GS A0A1B9IDC0_9TREE/131-242   AC A0A1B9IDC0.1
#=GS A0A3Q3XIZ0_MOLML/141-383   AC A0A3Q3XIZ0.1
#=GS A0A448YQF5_BRENA/141-244   AC A0A448YQF5.1
#=GS W7TIX5_9STRA/111-158       AC W7TIX5.1
#=GS A0A2Y9DMM2_TRIMA/125-337   AC A0A2Y9DMM2.1
#=GS D0NQP5_PHYIT/46-231        AC D0NQP5.1
#=GS A0A0L0VM36_9BASI/154-273   AC A0A0L0VM36.1
#=GS W4GCA7_9STRA/71-118        AC W4GCA7.1
#=GS A0A6J1US52_9SAUR/132-319   AC A0A6J1US52.1
#=GS A0A1E3HI08_9TREE/121-234   AC A0A1E3HI08.1
#=GS A0A094ADF3_9PEZI/164-261   AC A0A094ADF3.1
#=GS A0A1A0HCL7_9ASCO/126-228   AC A0A1A0HCL7.1
#=GS A0A4W5KE19_9TELE/140-351   AC A0A4W5KE19.1
#=GS A0A0F7TI00_PENBI/171-316   AC A0A0F7TI00.1
#=GS RPA43_SCHPO/83-130         AC O43036.1
#=GS RPA43_SCHPO/83-130         DR PDB; 7AOC G; 83-130;
#=GS RPA43_SCHPO/83-130         DR PDB; 7AOD S; 83-130;
#=GS RPA43_SCHPO/83-130         DR PDB; 7AOD G; 83-130;
#=GS RPA43_SCHPO/83-130         DR PDB; 7AOE G; 83-130;
#=GS RPA43_MOUSE/125-330        AC Q78WZ7.1
#=GS A0A2S6BUY7_9PEZI/137-187   AC A0A2S6BUY7.1
#=GS A0A4W3HBA7_CALMI/127-287   AC A0A4W3HBA7.1
#=GS A0A024U7F7_9STRA/84-138    AC A0A024U7F7.1
#=GS A0A671FC48_RHIFE/140-367   AC A0A671FC48.1
#=GS Q6C2P5_YARLI/121-218       AC Q6C2P5.1
#=GS W6YR90_COCCA/119-223       AC W6YR90.1
#=GS M7Z8N7_TRIUA/98-248        AC M7Z8N7.1
#=GS G8Y1N0_PICSO/130-228       AC G8Y1N0.1
#=GS T5ACZ6_OPHSC/388-501       AC T5ACZ6.1
#=GS A0A177WU78_BATDL/151-210   AC A0A177WU78.1
#=GS A0A226PBZ8_COLVI/114-335   AC A0A226PBZ8.1
#=GS A0A1Y2EVY3_PROLT/76-125    AC A0A1Y2EVY3.1
#=GS N4UHD6_FUSC1/283-396       AC N4UHD6.1
#=GS G3B606_CANTC/122-222       AC G3B606.1
#=GS S7QCD2_GLOTA/131-254       AC S7QCD2.1
#=GS A0A653DAL6_CALMS/104-330   AC A0A653DAL6.1
#=GS A0A2G7G1R0_9EURO/188-336   AC A0A2G7G1R0.1
#=GS A0A4Q9Q341_9APHY/136-249   AC A0A4Q9Q341.1
#=GS A0A671RRT5_9TELE/137-348   AC A0A671RRT5.1
#=GS A0A0M8PAQ7_9EURO/189-328   AC A0A0M8PAQ7.1
#=GS A0A6J0SMK6_9SAUR/147-318   AC A0A6J0SMK6.1
#=GS U3K594_FICAL/77-304        AC U3K594.1
#=GS A0A094F347_9PEZI/164-261   AC A0A094F347.1
#=GS A0A3D8S6P2_9HELO/152-256   AC A0A3D8S6P2.1
#=GS A0A453KKA3_AEGTS/98-162    AC A0A453KKA3.1
#=GS K1PN01_CRAGI/47-195        AC K1PN01.1
#=GS A0A2S7Q3I2_9HELO/160-264   AC A0A2S7Q3I2.1
#=GS A0A179UM13_BLAGS/251-414   AC A0A179UM13.1
#=GS G1PCC7_MYOLU/98-300        AC G1PCC7.1
#=GS S7ZQK7_PENO1/167-312       AC S7ZQK7.1
#=GS A0A316VJN4_9BASI/112-147   AC A0A316VJN4.1
#=GS R0K3I7_ANAPL/46-240        AC R0K3I7.1
#=GS A0A2U3V9L8_TURTR/125-326   AC A0A2U3V9L8.1
#=GS A0A367K5I4_RHIAZ/126-242   AC A0A367K5I4.1
#=GS A0A5E4NQ91_9HEMI/33-265    AC A0A5E4NQ91.1
#=GS A0A5J5CXU4_9PERO/141-383   AC A0A5J5CXU4.1
#=GS A0A2T3Z8L1_9HYPO/256-369   AC A0A2T3Z8L1.1
#=GS F7C1U5_HORSE/125-323       AC F7C1U5.3
#=GS A0A7H9HYZ8_9SACH/127-237   AC A0A7H9HYZ8.1
#=GS A0A6J2WKA0_CHACN/140-290   AC A0A6J2WKA0.1
#=GS Q2GYW2_CHAGB/300-427       AC Q2GYW2.1
#=GS A0A094N149_ANTCR/41-246    AC A0A094N149.1
#=GS A0A1Y2CIX1_9FUNG/81-157    AC A0A1Y2CIX1.1
#=GS W5PJ89_SHEEP/121-315       AC W5PJ89.1
#=GS A0A6P8XA39_GYMAC/141-348   AC A0A6P8XA39.1
#=GS A0A1E3PGM9_9ASCO/133-237   AC A0A1E3PGM9.1
#=GS A0A699YPV8_HAELA/13-65     AC A0A699YPV8.1
#=GS B8NJ07_ASPFN/24-172        AC B8NJ07.1
#=GS A0A453KJY5_AEGTS/81-231    AC A0A453KJY5.1
#=GS A0A5M6C653_9TREE/138-247   AC A0A5M6C653.1
#=GS M7NS26_PNEMU/131-185       AC M7NS26.1
#=GS A0A1V9ZJD1_9STRA/81-128    AC A0A1V9ZJD1.1
#=GS A0A2Z6S601_9GLOM/87-191    AC A0A2Z6S601.1
#=GS A0A2C5YUI0_9HYPO/299-406   AC A0A2C5YUI0.1
#=GS A0A163D3L8_DIDRA/922-1029  AC A0A163D3L8.1
#=GS A0A5N6EHB8_9EURO/188-336   AC A0A5N6EHB8.1
#=GS A0A2P4ZJ00_9HYPO/252-365   AC A0A2P4ZJ00.1
#=GS A0A066XES9_COLSU/285-407   AC A0A066XES9.1
#=GS A0A0F4GB66_9PEZI/130-195   AC A0A0F4GB66.1
#=GS A0A2S4PJR5_9PEZI/148-252   AC A0A2S4PJR5.1
#=GS J8PYL0_SACAR/127-250       AC J8PYL0.1
#=GS J3NDW1_ORYBR/81-230        AC J3NDW1.1
#=GS A0A4U6VH83_SETVI/101-254   AC A0A4U6VH83.1
#=GS A0A063BUF8_USTVR/347-460   AC A0A063BUF8.1
#=GS A0A2T7EHK8_9POAL/95-248    AC A0A2T7EHK8.1
#=GS A0A397ST96_9GLOM/130-234   AC A0A397ST96.1
#=GS A0A0P7BIU0_9HYPO/278-391   AC A0A0P7BIU0.1
#=GS Q0ULW6_PHANO/106-210       AC Q0ULW6.1
#=GS A0A371D5V5_9APHY/160-282   AC A0A371D5V5.1
#=GS A0A5N7CVH9_9EURO/188-336   AC A0A5N7CVH9.1
#=GS G2QUF7_THETT/318-444       AC G2QUF7.1
#=GS A0A4Q4W3I2_9PEZI/308-433   AC A0A4Q4W3I2.1
#=GS A0A0D2MQI4_9CHLO/96-268    AC A0A0D2MQI4.1
#=GS A0A2V1AKS6_9ASCO/126-226   AC A0A2V1AKS6.1
#=GS A0A7E5VAI7_TRINI/100-302   AC A0A7E5VAI7.1
#=GS A0A6P7Y3S8_9AMPH/129-270   AC A0A6P7Y3S8.1
#=GS A0A2I1BY73_ASPN1/123-281   AC A0A2I1BY73.1
#=GS A0A6G0XIV8_9STRA/82-129    AC A0A6G0XIV8.1
#=GS A0A177UGA8_9BASI/218-327   AC A0A177UGA8.1
#=GS A7TPJ9_VANPO/126-231       AC A7TPJ9.1
#=GS A0A1V6NCW4_9EURO/155-293   AC A0A1V6NCW4.1
#=GS G1NCZ6_MELGA/35-243        AC G1NCZ6.2
#=GS C5DG18_LACTC/129-229       AC C5DG18.1
#=GS A0A179I748_CORDF/258-371   AC A0A179I748.1
#=GS A0A1V8TX05_9PEZI/312-417   AC A0A1V8TX05.1
#=GS A0A3M7N209_9EURO/316-451   AC A0A3M7N209.1
#=GS A0A091T9K0_PHALP/41-248    AC A0A091T9K0.1
#=GS A0A0L6WY41_9AGAR/49-164    AC A0A0L6WY41.1
#=GS F8PUM5_SERL3/111-226       AC F8PUM5.1
#=GS A0A2S4KNT4_9HYPO/296-409   AC A0A2S4KNT4.1
#=GS A0A2R9AZY1_PANPA/125-322   AC A0A2R9AZY1.1
#=GS A0A3A3A8Z8_9EURO/172-324   AC A0A3A3A8Z8.1
#=GS A0A1W2TRU3_ROSNE/299-418   AC A0A1W2TRU3.1
#=GS W5PJ88_SHEEP/121-335       AC W5PJ88.1
#=GS A0A6P6RIA6_CARAU/136-332   AC A0A6P6RIA6.1
#=GS S8G2K8_FOMPI/128-242       AC S8G2K8.1
#=GS A0A1A6AFV0_9TREE/130-241   AC A0A1A6AFV0.1
#=GS A0A2R6WB80_MARPO/82-338    AC A0A2R6WB80.1
#=GS A0A507C070_9FUNG/106-153   AC A0A507C070.1
#=GS D7FQC3_ECTSI/85-145        AC D7FQC3.1
#=GS W2Z2G7_PHYPR/83-269        AC W2Z2G7.1
#=GS A0A5C5FQU9_9BASI/181-347   AC A0A5C5FQU9.1
#=GS A0A1E4SRR1_9ASCO/125-222   AC A0A1E4SRR1.1
#=GS A0A1D2VP88_9ASCO/144-240   AC A0A1D2VP88.1
#=GS A0A409VWS9_9AGAR/81-205    AC A0A409VWS9.1
#=GS A0A4Q4YY92_9PEZI/301-426   AC A0A4Q4YY92.1
#=GS A0A2B4ST39_STYPI/105-245   AC A0A2B4ST39.1
#=GS A0A010QLK4_9PEZI/282-401   AC A0A010QLK4.1
#=GS B6HL93_PENRW/156-295       AC B6HL93.1
#=GS A0A165N0P2_9APHY/128-261   AC A0A165N0P2.1
#=GS A0A0C3SDA8_PHLGI/52-168    AC A0A0C3SDA8.1
#=GS A0A553HZU7_9PEZI/599-720   AC A0A553HZU7.1
#=GS A0A1S8W3U8_9FUNG/151-211   AC A0A1S8W3U8.1
#=GS A0A0E0BTJ5_9ORYZ/81-152    AC A0A0E0BTJ5.1
#=GS A0A094DG24_9PEZI/169-266   AC A0A094DG24.1
#=GS A0A0F7ZTW5_9HYPO/315-428   AC A0A0F7ZTW5.1
#=GS A0A4S4KXG5_9AGAM/1-130     AC A0A4S4KXG5.1
#=GS A0A058ZEH9_FONAL/106-167   AC A0A058ZEH9.1
#=GS A0A0D2X4M3_CAPO3/83-126    AC A0A0D2X4M3.1
#=GS A0A4P9ZCM6_9ASCO/126-228   AC A0A4P9ZCM6.1
#=GS A0A2J6TS94_9HELO/159-263   AC A0A2J6TS94.1
#=GS A0A061H5L2_9BASI/156-257   AC A0A061H5L2.1
#=GS W1QIM7_OGAPD/130-228       AC W1QIM7.1
#=GS A0A0D2BCB9_9PEZI/255-370   AC A0A0D2BCB9.1
#=GS A0A0G4PU71_PENCA/155-295   AC A0A0G4PU71.1
#=GS A0A316YYZ6_9BASI/145-274   AC A0A316YYZ6.1
#=GS A0A135LSD9_PENPA/154-292   AC A0A135LSD9.1
#=GS A0A1G4JL36_9SACH/126-227   AC A0A1G4JL36.1
#=GS A0A3N0XLU7_ANAGA/140-382   AC A0A3N0XLU7.1
#=GS A0A1S7H814_9SACH/126-231   AC A0A1S7H814.1
#=GS D8U4R7_VOLCA/88-151        AC D8U4R7.1
#=GS G2WYB3_VERDV/284-401       AC G2WYB3.1
#=GS A0A194QCQ0_PAPXU/100-294   AC A0A194QCQ0.1
#=GS A0A5M9J8U8_MONFR/154-258   AC A0A5M9J8U8.1
#=GS A0A0D7BVL8_9AGAR/124-232   AC A0A0D7BVL8.1
#=GS A0A6P3H5L0_BISBI/121-320   AC A0A6P3H5L0.1
#=GS W9HPW3_FUSOX/283-396       AC W9HPW3.1
#=GS A0A1J9R2K8_9PEZI/172-280   AC A0A1J9R2K8.1
#=GS A0A7N6AJG8_ANATE/141-372   AC A0A7N6AJG8.1
#=GS A0A2K6QW86_RHIRO/125-332   AC A0A2K6QW86.1
#=GS A0A3B5Q757_XIPMA/137-353   AC A0A3B5Q757.1
#=GS A0A1B8GXM5_9PEZI/166-263   AC A0A1B8GXM5.1
#=GS A0A0Q3TST9_AMAAE/111-335   AC A0A0Q3TST9.1
#=GS A0A0D9XZY3_9ORYZ/81-217    AC A0A0D9XZY3.1
#=GS A0A4U1FKV6_MONMO/1-196     AC A0A4U1FKV6.1
#=GS I1BLC1_RHIO9/128-246       AC I1BLC1.1
#=GS A0A4U0W4L6_9PEZI/294-393   AC A0A4U0W4L6.1
#=GS A0A2V0PAU3_9CHLO/95-140    AC A0A2V0PAU3.1
#=GS A0A485N8H4_LYNPA/92-299    AC A0A485N8H4.1
#=GS A0A0V0Q969_PSEPJ/89-196    AC A0A0V0Q969.1
#=GS A0A1J9Q724_9EURO/246-408   AC A0A1J9Q724.1
#=GS A0A093Q1A7_9PASS/69-274    AC A0A093Q1A7.1
#=GS V8NVY4_OPHHA/124-189       AC V8NVY4.1
#=GS A0A0C3QUQ9_9AGAM/154-287   AC A0A0C3QUQ9.1
#=GS A0A6P8H3Y1_CLUHA/150-363   AC A0A6P8H3Y1.1
#=GS A0A6J2X7K1_SITOR/104-316   AC A0A6J2X7K1.1
#=GS A0A0E0RI71_ORYRU/81-234    AC A0A0E0RI71.1
#=GS A0A4T0LU31_9BASI/102-154   AC A0A4T0LU31.1
#=GS A0A4U6XHJ1_9PEZI/289-414   AC A0A4U6XHJ1.1
#=GS B0D0C4_LACBS/123-241       AC B0D0C4.1
#=GS A0A5E4Q802_9NEOP/100-192   AC A0A5E4Q802.1
#=GS W6PZI8_PENRF/159-297       AC W6PZI8.1
#=GS A0A4U5VJU9_COLLU/126-338   AC A0A4U5VJU9.1
#=GS A0A4W6ETK0_LATCA/141-363   AC A0A4W6ETK0.1
#=GS A0A067NLG2_PLEOS/129-230   AC A0A067NLG2.1
#=GS A0A2I1FT95_9GLOM/130-234   AC A0A2I1FT95.1
#=GS A0A672SMR3_SINGR/132-342   AC A0A672SMR3.1
#=GS A0A1B8CUR4_9PEZI/150-206   AC A0A1B8CUR4.1
#=GS T1JF64_STRMM/681-845       AC T1JF64.1
#=GS A0A3B6LKW5_WHEAT/98-249    AC A0A3B6LKW5.1
#=GS A0A0D9NSB3_METAN/279-392   AC A0A0D9NSB3.1
#=GS A0A194XCZ5_9HELO/178-281   AC A0A194XCZ5.1
#=GS A0A5J9WC87_9POAL/109-262   AC A0A5J9WC87.1
#=GS A0A1S3AB57_ERIEU/121-332   AC A0A1S3AB57.1
#=GS A0A1V6QM53_9EURO/155-295   AC A0A1V6QM53.1
#=GS A0A4V1M3G1_TREME/144-255   AC A0A4V1M3G1.1
#=GS A0A517L6A3_9PEZI/212-324   AC A0A517L6A3.1
#=GS A0A2T0FL00_9ASCO/124-221   AC A0A2T0FL00.1
#=GS A0A5C3DYL8_9BASI/133-234   AC A0A5C3DYL8.1
#=GS A0A3N4M4H9_9PEZI/158-279   AC A0A3N4M4H9.1
#=GS K1VRR5_TRIAC/123-224       AC K1VRR5.1
#=GS M1WGV3_CLAP2/292-405       AC M1WGV3.1
#=GS A0A1S3IX91_LINUN/110-318   AC A0A1S3IX91.2
#=GS C1GAN7_PARBD/248-411       AC C1GAN7.1
#=GS A0A2A4JKN2_HELVI/100-304   AC A0A2A4JKN2.1
#=GS A0A093ENN4_9AVES/41-247    AC A0A093ENN4.1
#=GS W3X4I0_PESFW/253-359       AC W3X4I0.1
#=GS A0A1Y2WMZ5_9PEZI/286-419   AC A0A1Y2WMZ5.1
#=GS A0A2X0KGE6_9BASI/185-341   AC A0A2X0KGE6.1
#=GS A0A3P9BJ45_9CICH/166-382   AC A0A3P9BJ45.1
#=GS A0A1Y1XTL9_9FUNG/160-257   AC A0A1Y1XTL9.1
#=GS A0A1D8PS34_CANAL/126-219   AC A0A1D8PS34.1
#=GS A0A397GWE2_9EURO/180-338   AC A0A397GWE2.1
#=GS A0A5A8C9B1_CAFRO/86-305    AC A0A5A8C9B1.1
#=GS A0A179HL03_PURLI/277-390   AC A0A179HL03.1
#=GS A0A5C3ESU8_9BASI/156-257   AC A0A5C3ESU8.1
#=GS A0A5C3PRV1_9APHY/155-278   AC A0A5C3PRV1.1
#=GS A0A1L9T3P4_9EURO/189-359   AC A0A1L9T3P4.1
#=GS K2QVW6_MACPH/181-289       AC K2QVW6.1
#=GS A0A095EJ74_CRYGR/130-241   AC A0A095EJ74.1
#=GS G9MJU5_HYPVG/120-233       AC G9MJU5.1
#=GS A0A0D1ZP40_EXOME/276-412   AC A0A0D1ZP40.1
#=GS A0A2J6QBT7_9HELO/160-264   AC A0A2J6QBT7.1
#=GS A0A5D6Y8T1_9STRA/88-265    AC A0A5D6Y8T1.1
#=GS G7DT34_MIXOS/166-310       AC G7DT34.1
#=GS A0A1Q5ULC8_9EURO/175-320   AC A0A1Q5ULC8.1
#=GS A0A6J2AEF5_ACIJB/125-332   AC A0A6J2AEF5.1
#=GS A0A4Q7JHM4_METCM/285-398   AC A0A4Q7JHM4.1
#=GS A0A091VU76_OPIHO/41-247    AC A0A091VU76.1
#=GS A0A5N6DEW1_ASPPA/188-336   AC A0A5N6DEW1.1
#=GS A0A4U0UCY0_9PEZI/299-407   AC A0A4U0UCY0.1
#=GS A0A0D1ZF82_9EURO/243-379   AC A0A0D1ZF82.1
#=GS A0A395IVE2_9HELO/154-258   AC A0A395IVE2.1
#=GS A0A672KL76_SINGR/153-384   AC A0A672KL76.1
#=GS A0A1E3BUX5_9EURO/169-318   AC A0A1E3BUX5.1
#=GS A0A5N6V4C1_9EURO/188-336   AC A0A5N6V4C1.1
#=GS A0A1E1JQT7_9HELO/160-263   AC A0A1E1JQT7.1
#=GS K3WSG0_GLOUD/86-133        AC K3WSG0.1
#=GS A0A087SHR1_AUXPR/83-219    AC A0A087SHR1.1
#=GS A0A3P9N5U6_POERE/137-366   AC A0A3P9N5U6.1
#=GS A0A6G1QYI8_9TELE/141-358   AC A0A6G1QYI8.1
#=GS A0A5B0QPS5_PUCGR/168-285   AC A0A5B0QPS5.1
#=GS V4A100_LOTGI/99-136        AC V4A100.1
#=GS A0A0D2DN57_9EURO/240-374   AC A0A0D2DN57.1
#=GS A0A166WDK6_METRR/289-402   AC A0A166WDK6.1
#=GS U5HHQ1_USTV1/186-342       AC U5HHQ1.1
#=GS B8A0V9_MAIZE/104-257       AC B8A0V9.1
#=GS A0A6P3QD67_PTEVA/125-278   AC A0A6P3QD67.1
#=GS A0A444TB00_ARMVU/100-303   AC A0A444TB00.1
#=GS G4UFD2_NEUT9/113-161       AC G4UFD2.1
#=GS A0A1Y2G1K6_9BASI/162-323   AC A0A1Y2G1K6.1
#=GS A0A1Y1UW01_9FUNG/84-142    AC A0A1Y1UW01.1
#=GS N1JFA8_BLUG1/157-261       AC N1JFA8.1
#=GS A0A1Y1MRS7_PHOPY/102-347   AC A0A1Y1MRS7.1
#=GS A0A1Y2J3H3_PYCCO/137-251   AC A0A1Y2J3H3.1
#=GS A0A395H9J7_9EURO/176-343   AC A0A395H9J7.1
#=GS S2K2S0_MUCC1/126-243       AC S2K2S0.1
#=GS A0A3S0ZVB3_ELYCH/79-223    AC A0A3S0ZVB3.1
#=GS A0A0G4N036_9PEZI/671-788   AC A0A0G4N036.1
#=GS A0A2I0MQU4_COLLI/84-291    AC A0A2I0MQU4.1
#=GS A0A423VQL2_9PEZI/219-347   AC A0A423VQL2.1
#=GS A0A4Z2H987_9TELE/126-352   AC A0A4Z2H987.1
#=GS A0A395NRQ7_TRIAR/243-356   AC A0A395NRQ7.1
#=GS B2VQJ4_PYRTR/121-225       AC B2VQJ4.1
#=GS A0A139WJY5_TRICA/38-204    AC A0A139WJY5.1
#=GS B9GDH8_ORYSJ/81-234        AC B9GDH8.1
#=GS C4Y684_CLAL4/129-230       AC C4Y684.1
#=GS A0A669PTL8_PHACC/114-322   AC A0A669PTL8.1
#=GS A0A232LWP0_9EURO/178-332   AC A0A232LWP0.1
#=GS A0A317VWH7_9EURO/98-265    AC A0A317VWH7.1
#=GS F0XRN0_GROCL/199-334       AC F0XRN0.1
#=GS J7RYQ9_KAZNA/125-249       AC J7RYQ9.1
#=GS C5YPA7_SORBI/144-297       AC C5YPA7.1
#=GS A0A6J3CQP9_AYTFU/111-316   AC A0A6J3CQP9.1
#=GS A0A0D1E694_USTMA/152-245   AC A0A0D1E694.1
#=GS A0A421JM36_9ASCO/118-216   AC A0A421JM36.1
#=GS A0A420HIF9_9PEZI/148-252   AC A0A420HIF9.1
#=GS A7E6K9_SCLS1/158-262       AC A7E6K9.1
#=GS A0A2P4TF30_BAMTH/114-336   AC A0A2P4TF30.1
#=GS A0A1Y2VWU1_9PEZI/275-404   AC A0A1Y2VWU1.1
#=GS A0A167Y4T9_9PEZI/250-367   AC A0A167Y4T9.1
#=GS L9KG29_TUPCH/133-336       AC L9KG29.1
#=GS A0A4W3HBB1_CALMI/114-273   AC A0A4W3HBB1.1
#=GS G0SUL0_RHOT2/162-271       AC G0SUL0.1
#=GS J4GJA6_9APHY/135-250       AC J4GJA6.1
#=GS A0A319ECY4_ASPSB/177-344   AC A0A319ECY4.1
#=GS A0A1Y1WID1_9FUNG/105-228   AC A0A1Y1WID1.1
#=GS F7BDD1_XENTR/121-468       AC F7BDD1.4
#=GS A0A2K5JMW9_COLAP/125-269   AC A0A2K5JMW9.1
#=GS A0A642UHY9_DIURU/107-195   AC A0A642UHY9.1
#=GS A0A6G0TR56_APHGL/90-249    AC A0A6G0TR56.1
#=GS G8BBJ9_CANPC/122-216       AC G8BBJ9.1
#=GS G8Y4K8_PICSO/130-228       AC G8Y4K8.1
#=GS A0A1V6TKY1_9EURO/156-295   AC A0A1V6TKY1.1
#=GS H3AQL8_LATCH/135-344       AC H3AQL8.1
#=GS A0A6P9AAV3_THRPL/100-272   AC A0A6P9AAV3.1
#=GS A0A663EMP4_AQUCH/108-314   AC A0A663EMP4.1
#=GS A0A512UM51_9ASCO/126-228   AC A0A512UM51.1
#=GS A0A0P1B981_9BASI/202-345   AC A0A0P1B981.1
#=GS G9A064_TORDC/130-237       AC G9A064.1
#=GS A0A1Y2LQM6_EPING/107-157   AC A0A1Y2LQM6.1
#=GS A0A402END0_9SAUR/121-301   AC A0A402END0.1
#=GS G0SAD7_CHATD/274-401       AC G0SAD7.1
#=GS A0A1L9NHU9_ASPTC/177-354   AC A0A1L9NHU9.1
#=GS F4R871_MELLP/154-276       AC F4R871.1
#=GS A0A2J6S2X0_9HELO/160-264   AC A0A2J6S2X0.1
#=GS A0A1V6XGI4_PENNA/156-295   AC A0A1V6XGI4.1
#=GS A0A1E4RVC5_CYBJN/127-226   AC A0A1E4RVC5.1
#=GS R7Z5J8_CONA1/185-314       AC R7Z5J8.1
#=GS A0A4V5NBX6_9BASI/170-327   AC A0A4V5NBX6.1
#=GS A0A427XNE0_9TREE/135-249   AC A0A427XNE0.1
#=GS A0A0D2CYM8_9EURO/241-379   AC A0A0D2CYM8.1
#=GS A0A674IAV9_TERCA/114-319   AC A0A674IAV9.1
#=GS H2LGA8_ORYLA/186-416       AC H2LGA8.2
#=GS A0A0D0ASR1_9AGAM/130-257   AC A0A0D0ASR1.1
#=GS A0A167PML3_CORFA/284-397   AC A0A167PML3.1
#=GS A0A1V8UFT6_9PEZI/313-418   AC A0A1V8UFT6.1
#=GS A0A161HL94_9ASCO/155-301   AC A0A161HL94.1
#=GS A0A428T568_9HYPO/300-413   AC A0A428T568.1
#=GS A0A099YUH2_TINGU/41-246    AC A0A099YUH2.1
#=GS L0PDC8_PNEJ8/127-180       AC L0PDC8.1
#=GS B8MU07_TALSN/165-339       AC B8MU07.1
#=GS A0A7C8IB06_9PLEO/152-205   AC A0A7C8IB06.1
#=GS Q5ARH8_EMENI/192-356       AC Q5ARH8.1
#=GS A0A0C2SZL1_AMAMU/115-226   AC A0A0C2SZL1.1
#=GS A0A093P8C7_PYGAD/41-249    AC A0A093P8C7.1
#=GS W9WRW6_9EURO/243-381       AC W9WRW6.1
#=GS A0A6A6YWI5_9PEZI/139-252   AC A0A6A6YWI5.1
#=GS A0A1V6RVJ0_9EURO/156-294   AC A0A1V6RVJ0.1
#=GS M5GD55_DACPD/81-180        AC M5GD55.1
#=GS A0A139AQT6_GONPJ/245-309   AC A0A139AQT6.1
#=GS A0A1F5L9L0_9EURO/151-290   AC A0A1F5L9L0.1
#=GS D4ADH7_RAT/125-321         AC D4ADH7.1
#=GS A0A093HXW2_STRCA/44-248    AC A0A093HXW2.1
#=GS A0A3B6MP57_WHEAT/98-248    AC A0A3B6MP57.1
#=GS G3NT27_GASAC/95-262        AC G3NT27.1
#=GS A0A444UAN7_ACIRT/136-350   AC A0A444UAN7.1
#=GS A0A091TEA5_PELCR/41-246    AC A0A091TEA5.1
#=GS A0A2Y9PJS7_DELLE/125-328   AC A0A2Y9PJS7.1
#=GS A0A446T1F3_TRITD/98-248    AC A0A446T1F3.1
#=GS A0A1U7LL78_NEOID/107-155   AC A0A1U7LL78.1
#=GS A0A1R1XD67_9FUNG/230-367   AC A0A1R1XD67.1
#=GS G3RU18_GORGO/125-274       AC G3RU18.1
#=GS M3X5H4_FELCA/125-325       AC M3X5H4.2
#=GS A0A672SJX2_SINGR/119-282   AC A0A672SJX2.1
#=GS A0A4W3HU68_CALMI/120-311   AC A0A4W3HU68.1
#=GS Q1K5X0_NEUCR/250-375       AC Q1K5X0.1
#=GS A0A094GR84_9PEZI/165-262   AC A0A094GR84.1
#=GS A0A0S7DSY8_9EURO/180-339   AC A0A0S7DSY8.1
#=GS A0A060SM99_PYCCI/52-166    AC A0A060SM99.1
#=GS A0A2U9D1F4_SCOMX/138-367   AC A0A2U9D1F4.1
#=GS H2PMQ7_PONAB/125-269       AC H2PMQ7.1
#=GS A0A0K3CR30_RHOTO/162-270   AC A0A0K3CR30.1
#=GS A0A0L0FGB5_9EUKA/45-190    AC A0A0L0FGB5.1
#=GS A0A5N5QXT3_9AGAM/154-258   AC A0A5N5QXT3.1
#=GS I1I2T1_BRADI/81-231        AC I1I2T1.1
#=GS A0A6H5JDH5_9PHAE/85-256    AC A0A6H5JDH5.1
#=GS A0A091SAI5_NESNO/41-243    AC A0A091SAI5.1
#=GS A0A484EH94_BRELC/80-126    AC A0A484EH94.1
#=GS A0A1V8TK90_9PEZI/311-416   AC A0A1V8TK90.1
#=GS A0A067SYG4_GALM3/31-144    AC A0A067SYG4.1
#=GS A0A2I0UBT8_LIMLA/224-432   AC A0A2I0UBT8.1
#=GS A0A068RS34_9FUNG/134-253   AC A0A068RS34.1
#=GS A0A0J8RST8_COCIT/186-319   AC A0A0J8RST8.1
#=GS Q5K9N5_CRYNJ/130-241       AC Q5K9N5.1
#=GS A0A166SPX4_9PEZI/290-409   AC A0A166SPX4.1
#=GS A0A1B9G9X0_9TREE/130-241   AC A0A1B9G9X0.1
#=GS A0A443HMI5_BYSSP/176-322   AC A0A443HMI5.1
#=GS A0A420GIL7_9PEZI/129-233   AC A0A420GIL7.1
#=GS B9EPB1_SALSA/140-357       AC B9EPB1.1
#=GS A0A1U7RU07_ALLSI/110-305   AC A0A1U7RU07.2
#=GS A0A5M3MWP2_CONPW/136-258   AC A0A5M3MWP2.1
#=GS A0A7C8IMX3_9PEZI/281-401   AC A0A7C8IMX3.1
#=GS A0A0C3BAI3_PILCF/135-254   AC A0A0C3BAI3.1
#=GS A0A559M7Z9_9HELO/112-214   AC A0A559M7Z9.1
#=GS Q7PV20_ANOGA/105-240       AC Q7PV20.3
#=GS A0A369H265_9HYPO/114-230   AC A0A369H265.1
#=GS A0A485L6Z0_9STRA/82-129    AC A0A485L6Z0.1
#=GS A0A5C3QLU0_9AGAR/152-295   AC A0A5C3QLU0.1
#=GS A0A136ISG3_9PEZI/316-439   AC A0A136ISG3.1
#=GS A0A017SDS7_9EURO/167-316   AC A0A017SDS7.1
#=GS F1NJS0_CHICK/190-398       AC F1NJS0.3
#=GS A0A074WSE8_9PEZI/164-275   AC A0A074WSE8.1
#=GS A0A5N5T383_9CRUS/100-303   AC A0A5N5T383.1
#=GS A0A094CUA7_9PEZI/165-262   AC A0A094CUA7.1
#=GS F6WGE7_CALJA/125-337       AC F6WGE7.3
#=GS G8BWN1_TETPH/125-236       AC G8BWN1.1
#=GS G7XW29_ASPKW/177-356       AC G7XW29.1
#=GS A0A6J3ILJ0_SAPAP/125-334   AC A0A6J3ILJ0.1
#=GS A0A4U0XBC3_9PEZI/175-280   AC A0A4U0XBC3.1
#=GS A0A1Y2EBF2_9PEZI/333-474   AC A0A1Y2EBF2.1
#=GS A0A196S6Z1_BLAHN/84-161    AC A0A196S6Z1.1
#=GS A0A166FKE7_9AGAM/111-225   AC A0A166FKE7.1
#=GS A0A318Z572_9EURO/188-375   AC A0A318Z572.1
#=GS A0A1L0CSI1_9ASCO/129-231   AC A0A1L0CSI1.1
#=GS L8GGT6_ACACA/100-218       AC L8GGT6.1
#=GS A0A178ANT6_9PLEO/108-213   AC A0A178ANT6.1
#=GS A0A507ETX2_9FUNG/80-143    AC A0A507ETX2.1
#=GS A0A383YQD0_BALAS/125-319   AC A0A383YQD0.1
#=GS A0A376B2J3_9ASCO/131-229   AC A0A376B2J3.1
#=GS A0A507APE6_9PEZI/262-381   AC A0A507APE6.1
#=GS A0A137QTP2_9AGAR/118-233   AC A0A137QTP2.1
#=GS A0A427Y3C3_9TREE/244-361   AC A0A427Y3C3.1
#=GS A0A5A9NIY3_9TELE/132-384   AC A0A5A9NIY3.1
#=GS A3LV72_PICST/131-224       AC A3LV72.1
#=GS A0A3B1KB85_ASTMX/133-323   AC A0A3B1KB85.1
#=GS A0A364KUH9_9EURO/175-346   AC A0A364KUH9.1
#=GS A0A1V9ZCH9_9STRA/81-128    AC A0A1V9ZCH9.1
#=GS A0A409YWR0_9AGAR/79-180    AC A0A409YWR0.1
#=GS A0A1Y1HMN1_KLENI/87-134    AC A0A1Y1HMN1.1
#=GS A0A1Y2UBK4_9PEZI/280-409   AC A0A1Y2UBK4.1
#=GS A0A384BPS3_URSMA/125-335   AC A0A384BPS3.1
#=GS E4V032_ARTGP/199-341       AC E4V032.1
#=GS A0A671TE27_SPAAU/190-426   AC A0A671TE27.1
#=GS A0A507F299_9FUNG/80-144    AC A0A507F299.1
#=GS A0A5E4NLU0_9HEMI/33-266    AC A0A5E4NLU0.1
#=GS A0A1E4STR3_9ASCO/127-240   AC A0A1E4STR3.1
#=GS A0A1V4KC12_PATFA/79-286    AC A0A1V4KC12.1
#=GS A0A423X4T5_9PEZI/215-342   AC A0A423X4T5.1
#=GS A0A250XI53_9CHLO/84-127    AC A0A250XI53.1
#=GS A0A175VWL9_9PEZI/317-444   AC A0A175VWL9.1
#=GS I4Y542_WALMC/80-132        AC I4Y542.1
#=GS A0A7J6JB21_COLFN/283-405   AC A0A7J6JB21.1
#=GS A0A6F9CQ83_9TELE/140-351   AC A0A6F9CQ83.1
#=GS A0A2T6ZK22_TUBBO/85-187    AC A0A2T6ZK22.1
#=GS A0A1E3IY70_9TREE/126-240   AC A0A1E3IY70.1
#=GS A0A1B7NLF5_9EURO/249-416   AC A0A1B7NLF5.1
#=GS A0A074VK21_9PEZI/156-267   AC A0A074VK21.1
#=GS I1RKQ5_GIBZE/273-386       AC I1RKQ5.1
#=GS Q4WAQ0_ASPFU/179-342       AC Q4WAQ0.1
#=GS A0A0N1H5A5_9EURO/299-441   AC A0A0N1H5A5.1
#=GS A0A0L0SS37_ALLM3/14-128    AC A0A0L0SS37.1
#=GS A0A3Q0CVH2_MESAU/125-322   AC A0A3Q0CVH2.1
#=GS A0A421J802_9ASCO/125-223   AC A0A421J802.1
#=GS A0A0P7UGT1_SCLFO/118-338   AC A0A0P7UGT1.1
#=GS A0A059LIE5_9CHLO/84-145    AC A0A059LIE5.1
#=GS C1H7Y2_PARBA/252-415       AC C1H7Y2.2
#=GS A0A316UHK9_9BASI/90-193    AC A0A316UHK9.1
#=GS J3PI81_GAET3/292-439       AC J3PI81.1
#=GS C5GBZ2_AJEDR/251-414       AC C5GBZ2.2
#=GS G3JV16_CORMM/259-372       AC G3JV16.1
#=GS A0A0C4F606_PUCT1/156-270   AC A0A0C4F606.1
#=GS A0A0L0N1G5_TOLOC/306-419   AC A0A0L0N1G5.1
#=GS A0A1R3R968_ASPC5/76-247    AC A0A1R3R968.1
#=GS A0A5E4BR63_MARMO/125-324   AC A0A5E4BR63.1
#=GS E9DYY3_METAQ/282-395       AC E9DYY3.1
#=GS A0A0A2LLC1_PENIT/156-295   AC A0A0A2LLC1.1
#=GS W9YCY8_9EURO/260-400       AC W9YCY8.1
#=GS A0A1X7RR62_ZYMTR/128-193   AC A0A1X7RR62.1
#=GS A0A1Y1VUA6_9FUNG/84-142    AC A0A1Y1VUA6.1
#=GS A0A6J0C6R1_NEOLC/104-359   AC A0A6J0C6R1.1
#=GS M9LWC2_PSEA3/140-236       AC M9LWC2.1
#=GS A0A6I9IGG2_VICPA/125-335   AC A0A6I9IGG2.1
#=GS A0A5N7B5Y2_9EURO/188-336   AC A0A5N7B5Y2.1
#=GS H3GGU1_PHYRM/84-130        AC H3GGU1.1
#=GS A0A091FNC1_9AVES/41-249    AC A0A091FNC1.1
#=GS A0A2T4C059_TRILO/258-371   AC A0A2T4C059.1
#=GS S3CX65_GLAL2/153-254       AC S3CX65.1
#=GS A0A3M0JVM5_HIRRU/113-321   AC A0A3M0JVM5.1
#=GS A0A1Y3NGC7_PIRSE/45-80     AC A0A1Y3NGC7.1
#=GS A9UYD7_MONBE/71-243        AC A9UYD7.1
#=GS C7YZW4_FUSV7/279-392       AC C7YZW4.1
#=GS A0A162JK33_CORDF/261-374   AC A0A162JK33.1
#=GS F7W7D9_SORMK/241-364       AC F7W7D9.1
#=GS A0A4W2GCM4_BOBOX/121-328   AC A0A4W2GCM4.1
#=GS A0A3Q1C138_AMPOC/141-379   AC A0A3Q1C138.1
#=GS A0A395HQW4_ASPHC/185-377   AC A0A395HQW4.1
#=GS A0A284QLS7_ARMOS/126-244   AC A0A284QLS7.1
#=GS A0A6P7HFY1_DIAVI/40-170    AC A0A6P7HFY1.1
#=GS L8IEQ3_9CETA/121-331       AC L8IEQ3.1
#=GS A0A453KJY1_AEGTS/62-212    AC A0A453KJY1.1
#=GS M7TNG4_BOTF1/159-265       AC M7TNG4.1
#=GS S3BN74_OPHP1/222-384       AC S3BN74.1
#=GS G0VFN6_NAUCC/123-240       AC G0VFN6.1
#=GS G1LPM2_AILME/125-327       AC G1LPM2.2
#=GS A0A4Q4YHV6_9PEZI/536-661   AC A0A4Q4YHV6.1
#=GS A0A0D0DQY9_9AGAM/165-302   AC A0A0D0DQY9.1
#=GS A0A4Z1HHF7_9HELO/159-265   AC A0A4Z1HHF7.1
#=GS A0A6P6IBA8_PUMCO/125-332   AC A0A6P6IBA8.1
#=GS A0A6G1GHI7_9PEZI/175-282   AC A0A6G1GHI7.1
#=GS A0A2K6FDT6_PROCO/125-335   AC A0A2K6FDT6.1
#=GS A0A074XHN0_AURPU/164-275   AC A0A074XHN0.1
#=GS T0RQ13_SAPDV/93-140        AC T0RQ13.1
#=GS A0A0F4Z8R0_9PEZI/228-329   AC A0A0F4Z8R0.1
#=GS A0A287R998_HORVV/86-240    AC A0A287R998.1
#=GS G4N9S9_MAGO7/327-467       AC G4N9S9.1
#=GS A0A2H3CCH6_9AGAR/126-244   AC A0A2H3CCH6.1
#=GS A0A2K5MG82_CERAT/125-332   AC A0A2K5MG82.1
#=GS A0A665TRC7_ECHNA/141-343   AC A0A665TRC7.1
#=GS A0A194SCX3_RHOGW/173-353   AC A0A194SCX3.1
#=GS A0A194USG2_9PEZI/221-353   AC A0A194USG2.1
#=GS A0A087X5M1_POEFO/137-373   AC A0A087X5M1.2
#=GS A0A0G4KLU3_9PEZI/698-815   AC A0A0G4KLU3.1
#=GS D4AJZ0_ARTBC/199-341       AC D4AJZ0.1
#=GS A0A673SRE3_SURSU/152-360   AC A0A673SRE3.1
#=GS G0WBT5_NAUDC/124-245       AC G0WBT5.1
#=GS A0A1X0RQX1_RHIZD/126-242   AC A0A1X0RQX1.1
#=GS A0A0C3PNM4_PISTI/121-261   AC A0A0C3PNM4.1
#=GS A0A182YCA6_ANOST/105-344   AC A0A182YCA6.1
#=GS A0A1X7R4Z3_9SACH/126-234   AC A0A1X7R4Z3.1
#=GS A0A507QXG3_MONPU/181-331   AC A0A507QXG3.1
#=GS A0A0C3EM83_9AGAM/118-232   AC A0A0C3EM83.1
#=GS A0A1X2G8Q3_9FUNG/120-225   AC A0A1X2G8Q3.1
#=GS W4GB78_9STRA/84-131        AC W4GB78.1
#=GS A0A545A1I6_9PEZI/129-233   AC A0A545A1I6.1
#=GS A0A4P6XT47_9ASCO/165-267   AC A0A4P6XT47.1
#=GS A0A2V1DZZ9_9PLEO/136-251   AC A0A2V1DZZ9.1
#=GS A0A5N6FDV1_PETAA/243-393   AC A0A5N6FDV1.1
#=GS G3AIG6_SPAPN/119-217       AC G3AIG6.1
#=GS F6Z410_ORNAN/161-369       AC F6Z410.2
#=GS B6JYA1_SCHJY/83-149        AC B6JYA1.1
#=GS A0A0L6V9T4_9BASI/160-276   AC A0A0L6V9T4.1
#=GS A0A6F9ABN0_9TELE/24-203    AC A0A6F9ABN0.1
#=GS A0A5J9VEW5_9POAL/115-277   AC A0A5J9VEW5.1
#=GS A0A3P8XEY3_ESOLU/140-346   AC A0A3P8XEY3.1
#=GS A0A4U0USQ0_9PEZI/287-386   AC A0A4U0USQ0.1
#=GS A0A091HGR2_BUCRH/43-249    AC A0A091HGR2.1
#=GS A0A1V8SS70_9PEZI/311-416   AC A0A1V8SS70.1
#=GS W9WBR2_9EURO/243-380       AC W9WBR2.1
#=GS A0A139HCY3_9PEZI/139-212   AC A0A139HCY3.1
#=GS A0A2I3HSQ3_NOMLE/124-329   AC A0A2I3HSQ3.1
#=GS A0A397U473_9GLOM/94-182    AC A0A397U473.1
#=GS A0A067CHZ3_SAPPC/81-128    AC A0A067CHZ3.1
#=GS A0A317SQ09_9PEZI/67-170    AC A0A317SQ09.1
#=GS A0A6I9Z6U5_9SAUR/132-319   AC A0A6I9Z6U5.1
#=GS A0A6G1CN81_9ORYZ/81-139    AC A0A6G1CN81.1
#=GS R0I8T2_SETT2/119-223       AC R0I8T2.1
#=GS F9X8A0_ZYMTI/128-193       AC F9X8A0.1
#=GS A0A165I386_XYLHT/174-280   AC A0A165I386.1
#=GS W4K537_HETIT/93-213        AC W4K537.1
#=GS A0A2V5GYZ5_ASPV1/185-368   AC A0A2V5GYZ5.1
#=GS A0A0U1M856_TALIS/181-341   AC A0A0U1M856.1
#=GS A0A672YBN7_9TELE/143-384   AC A0A672YBN7.1
#=GS A0A0D3GDA2_9ORYZ/81-229    AC A0A0D3GDA2.1
#=GS E3QKU1_COLGM/290-412       AC E3QKU1.1
#=GS A0A4T0VLT4_9PEZI/289-412   AC A0A4T0VLT4.1
#=GS A0A0D1Z6R4_9EURO/240-377   AC A0A0D1Z6R4.1
#=GS A0A0F8B522_CERFI/275-387   AC A0A0F8B522.1
#=GS A0A3M6W1Z8_HORWE/298-403   AC A0A3M6W1Z8.1
#=GS A0A287R988_HORVV/81-233    AC A0A287R988.1
#=GS K1X568_MARBU/168-271       AC K1X568.1
#=GS W5N055_LEPOC/137-318       AC W5N055.1
#=GS A0A0L0HRX8_SPIPD/108-168   AC A0A0L0HRX8.1
#=GS A0A1V6Q1R0_9EURO/149-288   AC A0A1V6Q1R0.1
#=GS A0A0L0SVD6_ALLM3/79-196    AC A0A0L0SVD6.1
#=GS M5E5S5_MALS4/98-199        AC M5E5S5.1
#=GS A0A388KAA3_CHABU/51-108    AC A0A388KAA3.1
#=GS A0A6H0XTC2_9PEZI/188-292   AC A0A6H0XTC2.1
#=GS E3JQ84_PUCGT/168-285       AC E3JQ84.2
#=GS A0A1U7UGS7_CARSF/125-338   AC A0A1U7UGS7.1
#=GS A0A1Y2AJY2_9FUNG/84-142    AC A0A1Y2AJY2.1
#=GS I3N9D6_ICTTR/152-363       AC I3N9D6.2
#=GS C5FTH5_ARTOC/203-348       AC C5FTH5.1
#=GS M3B2E7_PSEFD/86-125        AC M3B2E7.1
#=GS A0A4Z1JFZ2_9HELO/159-265   AC A0A4Z1JFZ2.1
#=GS A0A6P8IBY8_ACTTE/102-280   AC A0A6P8IBY8.1
#=GS A0A4S4NBC7_9APHY/136-255   AC A0A4S4NBC7.1
#=GS A0A1B8CK13_9PEZI/165-262   AC A0A1B8CK13.1
#=GS A0A2H3GG90_FUSOX/267-380   AC A0A2H3GG90.1
#=GS A0A367YC14_9ASCO/129-222   AC A0A367YC14.1
#=GS Q0CWU2_ASPTN/191-342       AC Q0CWU2.1
#=GS A0A1Y1U9N8_9TREE/71-169    AC A0A1Y1U9N8.1
#=GS A0A096PAW5_OSTTA/123-167   AC A0A096PAW5.1
#=GS A0A4Q4UEY5_9PEZI/309-434   AC A0A4Q4UEY5.1
#=GS A0A545VLH0_9HYPO/260-373   AC A0A545VLH0.1
#=GS A0A6I9M8T7_PERMB/122-322   AC A0A6I9M8T7.1
#=GS A0A091I138_CALAN/41-247    AC A0A091I138.1
#=GS C6H3P1_AJECH/239-407       AC C6H3P1.1
#=GS A0A091S0T9_9GRUI/78-285    AC A0A091S0T9.1
#=GS A0A1Y2GGI4_9FUNG/90-205    AC A0A1Y2GGI4.1
#=GS A0A6J1SML4_FRAOC/100-271   AC A0A6J1SML4.1
#=GS A0A0J8R421_COCIT/186-319   AC A0A0J8R421.1
#=GS A0A5N5MGS4_9PEZI/286-416   AC A0A5N5MGS4.1
#=GS H2QU84_PANTR/125-332       AC H2QU84.1
#=GS A0A453KK87_AEGTS/98-248    AC A0A453KK87.1
#=GS A0A1L9U4H9_ASPBC/180-356   AC A0A1L9U4H9.1
#=GS A0A667Y766_9TELE/141-376   AC A0A667Y766.1
#=GS A0A1J7I7F8_9PEZI/291-428   AC A0A1J7I7F8.1
#=GS A0A060YX96_ONCMY/57-268    AC A0A060YX96.1
#=GS H0YWP4_TAEGU/114-338       AC H0YWP4.2
#=GS A0A4Z1KN83_9HELO/159-265   AC A0A4Z1KN83.1
#=GS I2G594_USTH4/144-243       AC I2G594.1
#=GS A0A0G2EKC8_9EURO/237-381   AC A0A0G2EKC8.1
#=GS A0A1S3IWP8_LINUN/110-159   AC A0A1S3IWP8.1
#=GS A0A0D3HV98_9ORYZ/81-234    AC A0A0D3HV98.1
#=GS A0A3M6VJQ8_9STRA/83-129    AC A0A3M6VJQ8.1
#=GS A0A2S5B0W9_9BASI/166-319   AC A0A2S5B0W9.1
#=GS W9XTP1_9EURO/255-400       AC W9XTP1.1
#=GS A0A3Q1GIT1_9TELE/141-360   AC A0A3Q1GIT1.1
#=GS A0A2R6NLF8_9APHY/136-253   AC A0A2R6NLF8.1
#=GS A0A2K0WV38_GIBNY/283-396   AC A0A2K0WV38.1
#=GS A0A4W3HBX3_CALMI/110-269   AC A0A4W3HBX3.1
#=GS A0A0L0D2E7_THETB/79-132    AC A0A0L0D2E7.1
#=GS R1EJW2_BOTPV/161-272       AC R1EJW2.1
#=GS G4ZTJ4_PHYSP/83-154        AC G4ZTJ4.1
#=GS A0A437A6G1_9PEZI/160-283   AC A0A437A6G1.1
#=GS A0A4Z1PFA6_9PEZI/198-310   AC A0A4Z1PFA6.1
#=GS A0A5C3KPW2_9AGAR/121-233   AC A0A5C3KPW2.1
#=GS A0A3D8QHV0_9EURO/190-355   AC A0A3D8QHV0.1
#=GS M2LWW5_BAUPA/299-400       AC M2LWW5.1
#=GS A0A2L2TT20_9HYPO/267-380   AC A0A2L2TT20.1
#=GS A0A1E4TB45_9ASCO/98-149    AC A0A1E4TB45.1
#=GS A0A034WA80_BACDO/105-332   AC A0A034WA80.1
#=GS A0A316TZ72_9BASI/188-295   AC A0A316TZ72.1
#=GS A0A3N4L754_9PEZI/163-262   AC A0A3N4L754.1
#=GS A0A1L9SM25_9EURO/181-336   AC A0A1L9SM25.1
#=GS A0A2X0P533_9BASI/186-342   AC A0A2X0P533.1
#=GS A0A3R7H9S3_9STRA/83-280    AC A0A3R7H9S3.1
#=GS A0A2S7P9X8_9HELO/160-264   AC A0A2S7P9X8.1
#=GS A0A1B9GYT0_9TREE/129-243   AC A0A1B9GYT0.1
#=GS A0A137PJ21_CONC2/46-98     AC A0A137PJ21.1
#=GS A0A074SI40_9AGAM/144-249   AC A0A074SI40.1
#=GS A0A4Y7TTR1_9AGAR/124-246   AC A0A4Y7TTR1.1
#=GS A0A482WPE2_LAOST/99-211    AC A0A482WPE2.1
#=GS A0A0B7MR30_9FUNG/126-243   AC A0A0B7MR30.1
#=GS A0A150UV75_9PEZI/265-364   AC A0A150UV75.1
#=GS A0A3Q3GFX4_9LABR/141-372   AC A0A3Q3GFX4.1
#=GS A0A2K5VT47_MACFA/125-291   AC A0A2K5VT47.1
#=GS A0A4U0UD39_9PEZI/286-385   AC A0A4U0UD39.1
#=GS A0A7E6CHL5_9CHIR/125-335   AC A0A7E6CHL5.1
#=GS A0A433DGX9_9FUNG/189-302   AC A0A433DGX9.1
#=GS C1MWR4_MICPC/117-332       AC C1MWR4.1
#=GS A0A091V7C3_NIPNI/41-248    AC A0A091V7C3.1
#=GS F2SUG1_TRIRC/199-341       AC F2SUG1.1
#=GS A0A084QVM3_STAC4/272-385   AC A0A084QVM3.1
#=GS E2LDG9_MONPE/14-120        AC E2LDG9.1
#=GS A0A0E0PU12_ORYRU/81-229    AC A0A0E0PU12.1
#=GS A0A163K1X3_ABSGL/132-256   AC A0A163K1X3.1
#=GS A0A5N6Z2J3_9EURO/188-339   AC A0A5N6Z2J3.1
#=GS A0A1Y2FPE5_9FUNG/84-142    AC A0A1Y2FPE5.1
#=GS E3RX37_PYRTT/121-225       AC E3RX37.1
#=GS A0A2I0S691_9PEZI/142-188   AC A0A2I0S691.1
#=GS A0A1C1CNL6_9EURO/244-381   AC A0A1C1CNL6.1
#=GS D8QYX2_SELML/99-157        AC D8QYX2.1
#=GS A0A507DUE3_9FUNG/126-189   AC A0A507DUE3.1
#=GS A0A096NPL9_PAPAN/125-291   AC A0A096NPL9.1
#=GS A0A261Y7R2_9FUNG/111-230   AC A0A261Y7R2.1
#=GS A0A197KK38_9FUNG/91-199    AC A0A197KK38.1
#=GS A0A0G2FTJ0_9PEZI/220-344   AC A0A0G2FTJ0.1
#=GS A0A093ENS8_TYTAL/41-247    AC A0A093ENS8.1
#=GS A0A2N1JFG4_9BASI/95-195    AC A0A2N1JFG4.1
#=GS A0A670Z7U0_PSETE/132-319   AC A0A670Z7U0.1
#=GS A0A6I9MZ88_9TELE/141-358   AC A0A6I9MZ88.1
#=GS A0A287R923_HORVV/76-228    AC A0A287R923.1
#=GS A0A287R906_HORVV/81-233    AC A0A287R906.1
#=GS RPA43_YEAST/127-250        AC P46669.2
#=GS RPA43_YEAST/127-250        DR PDB; 6HLR G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 6RUI G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 5OA1 G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 2RF4 A; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 2RF4 E; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 5N61 G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 4C3J G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 5N60 G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 6HLQ G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 5W66 G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 2RF4 C; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 6H67 G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 5M3M G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 6RQT G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 5G5L G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 5N5Z G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 4C3I G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 5W5Y G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 6H68 G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 5N5Y G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 5M5W G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 6RUO G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 4C3H G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 6RRD G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 5M5Y G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 4C2M G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 6RWE G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 5W65 G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 5M64 G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 5M5X G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 4C2M V; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 5W64 G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 6HLS G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 6RQH G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 6TPS G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 6RQL G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 6HKO G; 127-250;
#=GS RPA43_YEAST/127-250        DR PDB; 5M3F G; 127-250;
#=GS A0A0U5GAR5_9EURO/188-364   AC A0A0U5GAR5.1
#=GS A0A2C5X337_9PEZI/275-387   AC A0A2C5X337.1
#=GS A0A550CXV5_9AGAR/124-237   AC A0A550CXV5.1
#=GS A0A0C2XCV0_9AGAM/135-246   AC A0A0C2XCV0.1
#=GS A0A1X2IPT0_9FUNG/123-226   AC A0A1X2IPT0.1
#=GS A0A059JFF5_TRIIM/200-342   AC A0A059JFF5.1
#=GS A0A0F4YKA5_TALEM/188-343   AC A0A0F4YKA5.1
#=GS W7MMW7_GIBM7/283-396       AC W7MMW7.1
#=GS A0A1L9WJ52_ASPA1/186-369   AC A0A1L9WJ52.1
#=GS A0A7N4V232_SARHA/108-349   AC A0A7N4V232.1
#=GS A0A4U0WWE8_9PEZI/294-393   AC A0A4U0WWE8.1
#=GS A0A1D6IWQ3_MAIZE/104-156   AC A0A1D6IWQ3.1
#=GS D8Q8H0_SCHCM/121-235       AC D8Q8H0.1
#=GS A0A166IHK3_9AGAM/129-252   AC A0A166IHK3.1
#=GS L8G8K0_PSED2/164-261       AC L8G8K0.1
#=GS C9S9F6_VERA1/181-298       AC C9S9F6.1
#=GS R8BXX5_TOGMI/333-457       AC R8BXX5.1
#=GS A0A0G4FCQ2_VITBC/148-293   AC A0A0G4FCQ2.1
#=GS E4ZMP9_LEPMJ/123-235       AC E4ZMP9.1
#=GS A0A2S7QGN0_9HELO/156-260   AC A0A2S7QGN0.1
#=GS RPA43_DICDI/96-157         AC Q55FA4.1
#=GS A0A4R0R3G6_9APHY/135-251   AC A0A4R0R3G6.1
#=GS A0A3M6U7S8_POCDA/105-261   AC A0A3M6U7S8.1
#=GS K7F9I5_PELSI/78-290        AC K7F9I5.1
#=GS J4KPJ6_BEAB2/258-371       AC J4KPJ6.1
#=GS A0A2P6NBQ6_9EUKA/85-170    AC A0A2P6NBQ6.1
#=GS A0A4S2N434_9PEZI/121-208   AC A0A4S2N434.1
#=GS A1CG30_ASPCL/183-348       AC A1CG30.1
#=GS A0A6G1B6A6_CROCR/92-289    AC A0A6G1B6A6.1
#=GS A0A3M6YJ91_HORWE/298-403   AC A0A3M6YJ91.1
#=GS B8BM96_ORYSI/81-234        AC B8BM96.1
#=GS A0A061HKW3_BLUGR/157-261   AC A0A061HKW3.1
#=GS A0A074Z2H1_AURSE/166-277   AC A0A074Z2H1.1
#=GS A0A6P3W1B9_CLUHA/140-357   AC A0A6P3W1B9.1
#=GS A0A5B0PZA6_PUCGR/169-286   AC A0A5B0PZA6.1
#=GS A0A317VW33_9EURO/156-309   AC A0A317VW33.1
#=GS A0A4Q4TS61_9PEZI/309-434   AC A0A4Q4TS61.1
#=GS A0A0D9WMC6_9ORYZ/81-235    AC A0A0D9WMC6.1
#=GS A0A250XSV5_9CHLO/84-131    AC A0A250XSV5.1
#=GS A0A2C5YF31_9HYPO/312-435   AC A0A2C5YF31.1
#=GS A0A5C3NB55_9AGAM/55-180    AC A0A5C3NB55.1
#=GS A0A178E5I7_9PLEO/136-240   AC A0A178E5I7.1
#=GS A0A4W4EFV1_ELEEL/139-345   AC A0A4W4EFV1.1
#=GS A0A669CM52_ORENI/176-317   AC A0A669CM52.1
#=GS M7SCV9_EUTLA/250-391       AC M7SCV9.1
#=GS A0A0H1B7E4_9EURO/245-407   AC A0A0H1B7E4.1
#=GS A0A0F8XTH6_9EURO/188-365   AC A0A0F8XTH6.1
#=GS A0A161XTV7_9PEZI/292-411   AC A0A161XTV7.1
#=GS A0A674A2W3_SALTR/140-354   AC A0A674A2W3.1
#=GS A0A6J2I5A4_9PASS/117-320   AC A0A6J2I5A4.1
#=GS F9G216_FUSOF/283-396       AC F9G216.1
#=GS A0A1M2V451_TRAPU/138-273   AC A0A1M2V451.1
#=GS A0A1E4TUA2_PACTA/135-282   AC A0A1E4TUA2.1
#=GS A0A6P7HM75_9TELE/141-375   AC A0A6P7HM75.1
#=GS A0A3Q2W0K6_HAPBU/166-382   AC A0A3Q2W0K6.1
#=GS I0YV46_COCSC/58-104        AC I0YV46.1
#=GS A0A1Y1YGF5_9PLEO/132-241   AC A0A1Y1YGF5.1
#=GS A0A1V6TTN0_9EURO/156-297   AC A0A1V6TTN0.1
#=GS A0A0C9ZXN5_9AGAM/125-264   AC A0A0C9ZXN5.1
#=GS A0A164ZXI0_9AGAM/98-214    AC A0A164ZXI0.1
#=GS A0A1J9QBL2_9EURO/243-407   AC A0A1J9QBL2.1
#=GS W2PYU0_PHYPN/83-269        AC W2PYU0.1
#=GS H0X025_OTOGA/125-336       AC H0X025.1
#=GS A0A165N5X1_EXIGL/136-261   AC A0A165N5X1.1
#=GS A0A3Q3M0Y4_9TELE/137-353   AC A0A3Q3M0Y4.1
#=GS A0A0E0A5L8_9ORYZ/81-180    AC A0A0E0A5L8.1
#=GS A0A165G8M9_9BASI/81-180    AC A0A165G8M9.1
#=GS N4V489_COLOR/296-419       AC N4V489.1
#=GS A0A091JWD7_EGRGA/41-249    AC A0A091JWD7.1
#=GS A0A2I4CNJ4_9TELE/140-364   AC A0A2I4CNJ4.1
#=GS A0A1G4B716_9PEZI/293-416   AC A0A1G4B716.1
#=GS A0A0E0IEF6_ORYNI/81-232    AC A0A0E0IEF6.1
#=GS A0A218YU00_9HELO/160-263   AC A0A218YU00.1
#=GS A0A2B7WPC1_9EURO/230-376   AC A0A2B7WPC1.1
#=GS A0A1E4RLK2_9ASCO/134-234   AC A0A1E4RLK2.1
#=GS A0A3Q4GQ09_NEOBR/141-365   AC A0A3Q4GQ09.1
#=GS A0A091CR13_FUKDA/125-326   AC A0A091CR13.1
#=GS A0A2S4UK29_9BASI/170-298   AC A0A2S4UK29.1
#=GS A0A2D3UVN0_9PEZI/117-195   AC A0A2D3UVN0.1
#=GS A0A1S7HK16_9SACH/126-231   AC A0A1S7HK16.1
#=GS A0A4T0FMP4_9BASI/105-200   AC A0A4T0FMP4.1
#=GS G0RUR9_HYPJQ/258-371       AC G0RUR9.1
#=GS A0A1C7N729_9FUNG/129-246   AC A0A1C7N729.1
#=GS A0A0E0L8D4_ORYPU/182-330   AC A0A0E0L8D4.1
#=GS A0A4Y9YU24_9APHY/128-243   AC A0A4Y9YU24.1
#=GS C1EFU4_MICCC/97-144        AC C1EFU4.1
#=GS A0A093QZR2_PHACA/41-248    AC A0A093QZR2.1
#=GS A0A670JJ00_PODMU/120-290   AC A0A670JJ00.1
#=GS C4R5C2_KOMPG/122-227       AC C4R5C2.1
#=GS A0A0D2F455_9EURO/236-370   AC A0A0D2F455.1
#=GS A0A2U3YQH2_LEPWE/107-316   AC A0A2U3YQH2.2
#=GS A0A0D2IPB3_9EURO/238-375   AC A0A0D2IPB3.1
#=GS A0A2B7Y6P4_9EURO/1-141     AC A0A2B7Y6P4.1
#=GS A0A7H9B3V2_ZYGMR/128-244   AC A0A7H9B3V2.1
#=GS A0A0A0A2F3_CHAVO/41-243    AC A0A0A0A2F3.1
#=GS A0A2T9ZK83_9FUNG/187-307   AC A0A2T9ZK83.1
#=GS A0A5Q4BBY1_9PEZI/290-415   AC A0A5Q4BBY1.1
#=GS M2S3C6_COCSN/119-223       AC M2S3C6.1
#=GS A0A4T0I0U4_WALIC/105-198   AC A0A4T0I0U4.1
#=GS A0A0N0RSD7_9BASI/95-196    AC A0A0N0RSD7.1
#=GS A0A1R1X335_9FUNG/357-445   AC A0A1R1X335.1
#=GS A0A0C9YL47_9AGAM/125-165   AC A0A0C9YL47.1
#=GS A0A671Q068_9TELE/128-338   AC A0A671Q068.1
#=GS A0A1X2G8W2_9FUNG/11-82     AC A0A1X2G8W2.1
#=GS A0A0E0DXM9_9ORYZ/81-229    AC A0A0E0DXM9.1
#=GS G3XUY5_ASPNA/174-343       AC G3XUY5.1
#=GS A0A2G5B8G2_COERN/128-271   AC A0A2G5B8G2.1
#=GS A0A2N5TP43_9BASI/155-269   AC A0A2N5TP43.1
#=GS A0A6P8BLX0_MAGGR/328-468   AC A0A6P8BLX0.1
#=GS A0A2H3J099_9EURO/175-345   AC A0A2H3J099.1
#=GS H3DK84_TETNG/121-322       AC H3DK84.1
#=GS A0A397JR54_9GLOM/105-208   AC A0A397JR54.1
#=GS A0A316Z3H8_9BASI/149-307   AC A0A316Z3H8.1
#=GS A0A395T3D3_9HYPO/266-379   AC A0A395T3D3.1
#=GS A0A0W0FVS3_9AGAR/121-237   AC A0A0W0FVS3.1
#=GS A0A319CNB8_9EURO/189-369   AC A0A319CNB8.1
#=GS A0A0D2CV49_9EURO/245-382   AC A0A0D2CV49.1
#=GS A0A5J5EVC8_9PEZI/177-276   AC A0A5J5EVC8.1
#=GS A0A319CYI5_9EURO/181-343   AC A0A319CYI5.1
#=GS A0A673IQD1_9TELE/132-340   AC A0A673IQD1.1
#=GS A0A1C7M1Q4_GRIFR/143-258   AC A0A1C7M1Q4.1
#=GS M3YR84_MUSPF/125-355       AC M3YR84.1
#=GS A0A2T4GV40_FUSCU/273-377   AC A0A2T4GV40.1
#=GS A0A094C1U4_9PEZI/164-261   AC A0A094C1U4.1
#=GS A0A3N2PSJ8_9PEZI/292-411   AC A0A3N2PSJ8.1
#=GS A0A2N3N057_9PEZI/364-472   AC A0A2N3N057.1
#=GS A0A5N5KKH0_PANHP/141-373   AC A0A5N5KKH0.1
#=GS A0A094ASU3_9PEZI/66-163    AC A0A094ASU3.1
#=GS A0A4S8M006_DENBC/125-235   AC A0A4S8M006.1
#=GS A0A1A6HI69_NEOLE/1-193     AC A0A1A6HI69.1
#=GS A0A5E8BZM6_9ASCO/159-303   AC A0A5E8BZM6.1
#=GS A0A4D9EHU7_9SAUR/114-320   AC A0A4D9EHU7.1
#=GS A0A1X6NBS3_9APHY/138-257   AC A0A1X6NBS3.1
#=GS A0A3N4K1V2_9PEZI/155-253   AC A0A3N4K1V2.1
#=GS A0A1B9IVJ8_9TREE/125-240   AC A0A1B9IVJ8.1
#=GS A0A2H3DKL6_ARMGA/126-244   AC A0A2H3DKL6.1
#=GS G1KLH7_ANOCA/124-188       AC G1KLH7.1
#=GS A0A395RK70_FUSSP/272-385   AC A0A395RK70.1
#=GS A0A507C0U1_9FUNG/130-177   AC A0A507C0U1.1
#=GS A0A2T7PJ08_POMCA/97-131    AC A0A2T7PJ08.1
#=GS A0A1L9RHL8_ASPWE/178-333   AC A0A1L9RHL8.1
#=GS A0A370TTU5_9HELO/185-291   AC A0A370TTU5.1
#=GS A0A6P9AJ58_PANGU/132-321   AC A0A6P9AJ58.1
#=GS A0A553P5A8_9TELE/144-313   AC A0A553P5A8.1
#=GS S9Y1P5_CAMFR/92-302        AC S9Y1P5.1
#=GS A0A6J0ZEG4_ODOVR/121-260   AC A0A6J0ZEG4.1
#=GS E9DHM3_COCPS/186-319       AC E9DHM3.1
#=GS A0A0B2WLQ9_METAS/299-412   AC A0A0B2WLQ9.1
#=GS A0A4Y7QGW8_9AGAM/138-269   AC A0A4Y7QGW8.1
#=GS A0A098VT82_9MICR/83-224    AC A0A098VT82.1
#=GS A0A168DU30_9EURO/183-324   AC A0A168DU30.1
#=GS L5KNR7_PTEAL/125-337       AC L5KNR7.1
#=GS A0A673SV66_SURSU/152-326   AC A0A673SV66.1
#=GS A0A1X2H3R6_SYNRA/132-256   AC A0A1X2H3R6.1
#=GS N1RDV0_FUSC4/283-396       AC N1RDV0.1
#=GS V5ESW5_KALBG/143-239       AC V5ESW5.1
#=GS A0A1S8B505_9PEZI/168-276   AC A0A1S8B505.1
#=GS A0A0D2DU37_9EURO/253-390   AC A0A0D2DU37.1
#=GS A0A165PQW9_9AGAM/159-284   AC A0A165PQW9.1
#=GS A0A0J1B532_9TREE/71-173    AC A0A0J1B532.1
#=GS A0A0M8ZSW5_9HYME/127-368   AC A0A0M8ZSW5.1
#=GS A0A423VVB5_9PEZI/223-356   AC A0A423VVB5.1
#=GS A0A0P1A5U2_PLAHL/83-129    AC A0A0P1A5U2.1
#=GS V5G232_BYSSN/177-329       AC V5G232.1
#=GS A0A135SE95_9PEZI/282-401   AC A0A135SE95.1
#=GS A0A4Y9ZYE7_9AGAM/122-252   AC A0A4Y9ZYE7.1
#=GS D8RA84_SELML/99-157        AC D8RA84.1
#=GS A0A2B7XBJ1_9EURO/257-421   AC A0A2B7XBJ1.1
#=GS A0A329SUJ5_9STRA/83-258    AC A0A329SUJ5.1
#=GS A0A2G8SPY1_9APHY/139-253   AC A0A2G8SPY1.1
#=GS A0A3P8TFT6_AMPPE/141-379   AC A0A3P8TFT6.1
#=GS B2ABZ6_PODAN/287-419       AC B2ABZ6.1
#=GS A0A1G4JYK9_9SACH/127-225   AC A0A1G4JYK9.1
#=GS A0A364MSE5_9PLEO/872-976   AC A0A364MSE5.1
#=GS A0A3E2GYP4_SCYLI/118-218   AC A0A3E2GYP4.1
#=GS A0A5E4DAF3_MARMO/125-313   AC A0A5E4DAF3.1
#=GS A0A1Z5TBN5_HORWE/286-391   AC A0A1Z5TBN5.1
#=GS A0A2Y9F6A3_PHYMC/125-319   AC A0A2Y9F6A3.1
#=GS A2YYI7_ORYSI/81-229        AC A2YYI7.1
#=GS A0A165GSH2_9APHY/128-243   AC A0A165GSH2.1
#=GS C5DV77_ZYGRC/126-225       AC C5DV77.1
#=GS A0A1F7ZUT1_9EURO/188-336   AC A0A1F7ZUT1.1
#=GS A8Q6I1_MALGO/97-198        AC A8Q6I1.1
#=GS A0A2H9TP73_9FUNG/106-172   AC A0A2H9TP73.1
#=GS A0A401KP69_ASPAW/174-343   AC A0A401KP69.1
#=GS A0A1E3Q307_LIPST/155-272   AC A0A1E3Q307.1
#=GS A0A2Y9H1J7_NEOSC/125-334   AC A0A2Y9H1J7.1
#=GS A0A1S8WA73_9FUNG/151-192   AC A0A1S8WA73.1
#=GS A0A2K5QMR4_CEBIM/125-269   AC A0A2K5QMR4.1
#=GS A0A093Z2S2_9PEZI/205-302   AC A0A093Z2S2.1
#=GS A0A6J0ZF76_ODOVR/121-322   AC A0A6J0ZF76.1
#=GS A0A2U3X0R0_ODORO/140-349   AC A0A2U3X0R0.1
#=GS C5M482_CANTT/205-298       AC C5M482.1
#=GS A0A0H2S7S8_9AGAM/131-256   AC A0A0H2S7S8.1
#=GS A0A2P7ZU89_9PEZI/336-471   AC A0A2P7ZU89.1
#=GS S9XIU4_SCHCR/96-145        AC S9XIU4.1
#=GS A0A109FJV8_9BASI/168-324   AC A0A109FJV8.1
#=GS A0A3M2S630_9HYPO/299-412   AC A0A3M2S630.1
#=GS G4TAG9_SERID/3-111         AC G4TAG9.1
#=GS A0A2K1JED6_PHYPA/91-265    AC A0A2K1JED6.1
#=GS A0A1J8QFB5_9AGAM/132-259   AC A0A1J8QFB5.1
#=GS A0A2H1A4Y5_CANAR/127-227   AC A0A2H1A4Y5.1
#=GS U1FYM5_ENDPU/227-336       AC U1FYM5.1
#=GS A0A6G0WA43_APHCR/91-269    AC A0A6G0WA43.1
#=GS A0A2A9PEQ3_9HYPO/451-564   AC A0A2A9PEQ3.1
#=GS A0A4Q4YX27_9PEZI/309-434   AC A0A4Q4YX27.1
#=GS A0A662XVB4_9STRA/86-254    AC A0A662XVB4.1
#=GS J4U2K2_SACK1/127-250       AC J4U2K2.1
#=GS A0A179F7Z8_METCM/296-409   AC A0A179F7Z8.1
#=GS A0A0D2NM55_HYPSF/109-224   AC A0A0D2NM55.1
#=GS A0A7H8QMH9_9EURO/183-344   AC A0A7H8QMH9.1
#=GS A0A1E3QXV7_9ASCO/127-224   AC A0A1E3QXV7.1
#=GS A0A317XYM4_9BASI/131-229   AC A0A317XYM4.1
#=GS A0A0W4ZUZ3_PNEJ7/127-180   AC A0A0W4ZUZ3.1
A0A420U509_FUSOX/284-397              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................D.WKWVP...........................................................................................................................--------..---..--NE.S..P....EA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWADGNGDKVKGK..iRFR..IRNFD..V-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
A0A4P9ZWI3_9FUNG/78-194               .........................PHVGSML.EGRI..NIESADHIGLLIYNTFNVS..I.P.A.D.L.........................I..PQ......................D.-KFIF...........................................................................................................................--------..QQN..EKYA.A..D....FD.AA..ED.E..A...AN..PA.G..NLDK..........................................................SMEQPTQAMGEWVSKITGQSMSH...-NG..LLRFK..VAS...................YHQVNELLSVTGSLL........................................................................................................................................................................................................................
G2Q989_MYCTT/306-430                  .........................PSRGKWM.EGVV..QLQSEGHIGVVCWNKFNAS..I.E.A.K.R.........................L..PK......................G.WKWVD...........................................................................................................................LAKGGV--..KSN..ASPA.P..D....QE.GE..PE.D..Q...SD..IL.D..GEEL..........................................................QVVEQIHTTGYWVDQKGKKVSGK..lRFR..IKNFD..V-G...................LAGDYGYLSIEGTCL........................................................................................................................................................................................................................
A0A067N1B1_9AGAM/163-301              .........................PVVGMRL.SAKV..NLCSPDHISLLIHRTFNVS..I.P.R.H.H.........................I..PA......................D.-DWVF...........................................................................................................................---EYGPA.eNEP..EPGE.A..A....VP.FQ..TP.E..K...EN..MD.I..DGDGsgsgein...........................................tiagidtrAEKIQEHETGKWVHCITGEKVGG...KDG..IVEIT..VVG...................LTIANQMLSLIGSLQ........................................................................................................................................................................................................................
A0A437CWG6_ORYJA/158-372              .........................PKKGQKL.LGKV..NKLGVSHVGCLVHGCFNAS..I.P.K.P.N.........................L..VS......................V.ETWRDagpkigtelefevtaldadaagvllirgrllktrvqella...........................................mcessestypvdtepnlesvqqepedtpkkkkkkkkdqikE-------..---..----.-..-....--.--..--.-..-...--..--.-..---Evveeevtrlpqspadgrs......................tphpngttdemqsddageKKKKKKKKKEKHIKDETEEVEVS...RNE..-----..---...................---------------vhcsdssgylsdkpskkrkyenctdgt.............................................................................................................................................................................................
A0A081CE30_PSEA2/229-325              .........................PKIGQML.EGTI..CLSSPSHVSLLLYGLFNAS..I.P.A.S.H.........................L..PE......................E.-DWEF...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.V..LNDA..........................................................EAGSNDHGLGYWQSKSDGSRLGG...QKG..TLAFT..VIS...................LTVANHMLSLHGSLL........................................................................................................................................................................................................................
A0A0K8LBQ9_9EURO/180-338              .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWVPp.........................................................................................................................gE--EEEDGfnSGE..KPKK.K..V....FS.ST..ED.E..D...DS..EP.-..---Ssrldpekehfkpisla..........................sdanpfsetmdlnngsAEDDESAAEGYFQSVSGHRVRGT..vRFR..VVDID..VIP..................gSDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A091P484_9PASS/44-250               .........................PKKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................V.VQWQElgfkigdelkfqvlhldsdaagvffirggltkssmrakkse.........................................titdstngdeiqkldrqenglndceeanvteeplnetdnpeR-ENEEEQ.sVDV..VNGL.C..D....DK.NK..KK.K..K...KK..GK.Q..EEQE..........................................................H----------------------...---..-----..---...................---------------vvpnsdssgyqsdhkkskkkkrkhcgeveeselsqlsekpkakkkr..........................................................................................................................................................................
A0A1B7TGX6_9ASCO/1-68                 ........................i-------.----..-------------------..-.-.-.-.-.........................-..PN......................N.WEYKY...........................................................................................................................--------..---..----.-..-....--.--..EE.D..D...SE..EG.D..GEDN..........................................................GDDDINKNLGYWVDGNGERINGK...---..KIDIK..VKQ...................VKTNGKMVSIEGSL-i.......................................................................................................................................................................................................................
A0A401GEU1_9APHY/142-264              .........................PRVGMKL.VGKV..NLCSPDHVSLLIHRTFNAS..I.P.R.H.H.........................I..ST......................D.-EWEF...........................................................................................................................---EYGPA..END..PEFG.P..E....VA.AE..ND.A..D...GT..PK.M..GADD..........................................................EKAAGVDRGGRWVHKITGAKLGG...EDG..SLEFT..VVG...................LTVANQMLSLVGSI-q.......................................................................................................................................................................................................................
A0A287R928_HORVV/1-149                .........................----MIL.EGKV..EMLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..PE......................T.FKFKRrghggkfisqldkqhvikkgsmirfsvkrvdte.........................................................mnchitgslmpphtgcmrwlsvhdaeyaseissG-------..---..--KR.K..S....RD.HT..KT.E..H...NV..QG.R..ATVN..........................................................-----------------------...---..-----..---...................---------------sedsvvnserprkskkrsvee...................................................................................................................................................................................................
A0A3M7M3U8_9PLEO/135-239              .........................PVQNAYL.QAHI..TDQAKTHITLAHLNTFPVS..I.L.A.A.C.........................M..PS......................D.WSWHS...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...KE..TG.K..MKKS..........................................................WDGRISDEGGWWVNGFGDKVEGElrvRIR..NVEGR..TDG...................KGKGKGFLRVEGSL-i.......................................................................................................................................................................................................................
A0A2T3B4U6_AMORE/146-246              .........................PDRGAWL.EGFV..NLQNEGHLGVVCWNLFNAS..I.K.R.N.S.........................L..PQ......................D.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...-V..EE.L..GKDG..........................................................GEVYAEDGQGYFVDGEGKKIEGM..vKFR..IREIE..-SS...................HDKERGFLSIEGTML........................................................................................................................................................................................................................
K5W6M7_PHACS/131-246                  .........................PYVGQKL.VGKV..NLYSPDHVSLLVHRTFNVS..I.P.R.H.H.........................I..PT......................D.-NWEF...........................................................................................................................--------..--E..YGPA.E..D....DP.EF..GA.E..Q...TS..ES.P..EDAE..........................................................ILEETTESSGRWVHKLTGDKLGG...KNG..HLEFT..VTG...................LTIANRMLSLVGSI-q.......................................................................................................................................................................................................................
A0A0C9U8W3_SPHS4/118-256              .........................PKVGQQL.TGQV..ILCSPDHVSLLVHRTFNVS..I.P.R.H.H.........................L..PS......................D.-EWEFeygpaend..........................................................................................................pefgtaafaA--AAEKD.gDIE..MDGD.E..A....KK.EA..AE.G..D...VA..EA.V..EGEF..........................................................EDELKSESQGQWMHKQTGKALGP...---..TVEFT..VIG...................LTIANQMLSLIGSI-q.......................................................................................................................................................................................................................
A0A1V6UB47_9EURO/152-290              .........................PKRGQTL.EGWV..NVQSEGFLGAVVFNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGE-DAET.pALT..DDDS.G..S....DK.DT..AD.F..D...TE..KE.C..FKPTtlseg................................................eiaidDEEEESSHTGYFQSVSGHRVHGS..vRFR..VVDVD..VIP..................gSERDRGFLSIEGTML........................................................................................................................................................................................................................
A0A5C2S240_9APHY/156-275              .........................PQVGMKL.SGKI..NLCSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..PT......................D.-SYEF...........................................................................................................................-------E.yGPA..ENDP.E..F....GA.GQ..EN.A..V...EG..AA.G..EEGA..........................................................EGHGRIDGGGRWVHKSTGTKLGD...PDG..YLEFT..VVG...................LTIANQMLSLVGSI-q.......................................................................................................................................................................................................................
A0A1B7MVA9_9AGAM/132-259              .........................PRIAMKL.VGKV..ILCSPDHVSLLVHRTFNVS..I.P.H.H.H.........................I..PQ......................D.-VWEFe.........................................................................................................................yGPAENDPE..YGT..GVVE.P..S....VD.KG..ED.A..T...IK..DG.D..DAQA..........................................................AGETVEEASGRWVHRVTGTKLGG...SDG..YLEFT..VVG...................QTVANEMLSLQGSI-q.......................................................................................................................................................................................................................
A0A453KJY3_AEGTS/61-128               .........................PQPEMIL.EGKV..EMLGKESIHAIVLGVFSAA..I.M.A.D.D.........................I..PE......................M.FKFKRrgh....................................................................................................................ggkfI-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------sqsdkrhvikkgsmir........................................................................................................................................................................................................
A0A3P4NGT7_GULGU/125-334              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.H.........................M..PA......................E.-QWQNleinvgdelefevfrldsdaagvfcirgklnitslqtkcsgvseeitetgpe..................eiiekplkkkkkkkkdpesyevesgnreladyadatmnketdlqidndlwkdePKKKKKKK.kHQE..DQDQ.D..P....VF.QG..SD.S..S...GY..QS.D..HKKK..........................................................KKKRKHSEEAE------------...---..-----..---...................---------------ftpllehspkkkrek.........................................................................................................................................................................................................
A0A4Y9ZDT9_9AGAM/127-280              .........................PEVGMKL.SGKI..NLCSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..PT......................D.-EWEFeygp...................................................................................................................aendPEFSSEAA.aAPD..PDPE.N..D....VP.DA..KP.E..E...GI..EA.A..EKTE..........................................................EKDEEVDRGGRWIHKVTGVRLGG...EEG..LLEFT..VVGcvyifasgrltadllefdrLTIANQMLSLLGSI-q.......................................................................................................................................................................................................................
A0A3L6R6V1_PANMI/96-249               .........................PQPDMIL.EGKV..EMLSKESIHAIILGVFSVA..I.M.S.D.D.........................I..RE......................K.FKFKRksdggrfvsrsdrqhvikrgtmlrflvkgvdte........................................................mnchitgslipphtgsmrwlsvhdaeyaaeinsgN-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------rrsrnvnikieqneqehrilknedsmvkserahksrkrsien..............................................................................................................................................................................
A0A2I2FAP6_9EURO/188-355              .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWVPpge....................................................................................................................eyeeG---EEST.gTAE..PQKD.K..P....AA.AT..TS.E..D...ED..S-.-..---Epsaafdaekehfnpvtlas...................dsnplademmteengdaagaGADDDAAAEGYFQSVSGHRVRGT..vRFR..VVDID..IIP..................gSERDHGFMSIEGTML........................................................................................................................................................................................................................
X0BTJ9_FUSOX/283-396                  .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................D.WKWVP...........................................................................................................................--------..---..--NE.S..P....EA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWADGNGDKVKGK..iRFR..IRNFD..V-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
A0A026W741_OOCBI/78-133               .........................PTVGCIL.KGIV..NKTGADHVIMLVHKMFTVS..I.P.K.Q.Y.........................N..ME......................-.-----...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------ewpgdkvevgqqirchlt......................................................................................................................................................................................................
A0A2N6NXY9_BEABA/259-372              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................S.WKWVS...........................................................................................................................--------..---..--NE.D..P....EA.EG..ME.E..T...AS..IV.A..PDEH..........................................................GVVHQIHSTGFWVDANGDKIKGK..iRFR..IRNFD..V-G...................VSGETTYLSLEGTML........................................................................................................................................................................................................................
A0A1S3FUJ6_DIPOR/125-317              .........................PGPGQKL.MGTV..NKVSSSHIGCLVHRCFNAS..I.P.KpE.Q.........................M..SS......................E.-QWQTleinvgdelefevfrldsdaagvf..........................................................................cirgklnmtslqskcskvseemsetR-------..---..----.T..E....ET.IE..KI.S..K...KK..KK.K..KKDP..........................................................ETYEADGTTSELADSAHST----...---..-----..---...................---------------vkeeiedvqiscnmeslqeeepkmkkkkkkkyqedqdpvfhgsdssgyqsdhkkkkkkrkq...........................................................................................................................................................
A0A4R8RN27_COLTR/298-421              .........................PRRGAWM.EGVI..NLENEGHIGVVCWGKFNAS..I.E.S.A.R.........................L..PT......................D.WRWVH...........................................................................................................................----ADSE.eAAN..YVDD.P..F....EQ.AE..GA.D..A...DA..QA.A..ETEH..........................................................GAVRQIHTTGFWVDGNSDKVKGR..vRFR..IKAFD..V-G...................ISGDHGYLSIEGTML........................................................................................................................................................................................................................
A0A151MQG1_ALLMI/110-317              .........................PQKGTRL.VGVI..NKIVPSHIGCLVHGCFNAS..V.P.K.H.Dcvsaeq............qqdlglkI..GD......................T.LEFEVsrldsdaagmffiwgrltkdslqskcpetvtedtnrnempkk......................................khkkngtvncegdsnlgevvedadsavreyeeeqnpdvvnglsH-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------kktkkkkkhkqenqepvlpgsdtsdyqsnhkkekrkkrkyceenhelsqlaeepkatkrkkqqmd.......................................................................................................................................................
A0A2I2G9N7_9EURO/187-347              .........................PQRGQVL.EGWV..NVQSEGFLGAVVLNLFSVG..V.E.R.K.R.........................L..PS......................D.WKWVPpg.......................................................................................................................ayGEEGEGEE.tANS..DADA.A..K....TK.SQ..SQ.S..D...DD..SS.-..---Epsaafdpekehfkpv...........................alasdanpllddpastEVDESAAAEGYFRSVSGHRVRGT..vRFR..VVDVD..VIP..................gSERDRGFMSIEGTML........................................................................................................................................................................................................................
A0A287R8U4_HORVV/81-153               .........................PQPEMIL.EGKV..EMLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..PE......................T.FKFKRrg.......................................................................................................................hgG-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------kfisqldkqhvikkgsmirfsvkr................................................................................................................................................................................................
A0A2B7ZL11_9EURO/244-411              .........................PERGQPL.EGWI..NVQSDGFLGAVVYNLFSVG..I.E.R.R.R.........................L..PA......................D.WQWVApgqeqeq............................................................................................................esaasgleV-------..-AT..PKTS.G..N....DD.DD..DD.D..D...DE..ED.-..---Sdfdsdkenfrplpassaa......................mldlstqqnqnndgmeppFEAFEDASAGYFRTRSGRRVRGM..vRFR..VRDVD..VIP..................gAENDKGFLSIEGTML........................................................................................................................................................................................................................
I2GVU7_TETBL/127-241                  .........................PQIGDII.EGWI..FIQSVSHISLLIFDAFNAN..I.N.K.N.F.........................I..PE......................D.WTFIN...........................................................................................................................--------..NEV..EEEE.I..L....QE.EK..AA.E..E...SN..GT.N..QDNN..........................................................KPNFTNRSLGYWVDGNGQRVDGK...---..-LKFQ..VRY...................INSNGRVITVEGSLL........................................................................................................................................................................................................................
A0A091LH10_CATAU/41-247               .........................PKKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................V.VQWQElglkigdelkfqvlyldsdaagvffirggltkrsmqpkqsetvt..................................dstngdeiqkldhqenglndsgganvteeplvemdstgrenaeeqS-------..VDA..VNGL.C..D....DK.NR..KK.K..K...KK..KH.K..QEQE..........................................................HVLPTSDSSGYQ-----------...---..-----..---...................---------------sdhkkskkkkrkhcdeveegelsqlsqepkakkkr.....................................................................................................................................................................................
N1PVX8_DOTSN/131-203                  .........................PSKGVKL.DGVV..SLQSESVLGLLCYNYFNAA..I.E.R.E.K.........................L..PE......................D.WNWNG...........................................................................................................................EK------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------wldgagkevssaitfivedfeasgqdg.............................................................................................................................................................................................
A0A067R3D0_ZOONE/104-371              .........................PEIGCTL.FGIV..NKKSVDHIGCLVHKCFHVS..I.P.Q.S.T.........................E..ET......................D.-EWLGtsvrigdqvtfrvemcdftgslpyirg.....................................................................klidsrpanvtsleedevdrisepkrkK-------..---..----.-..-....KK.NK..KN.K..H...KE..SD.L..SEHDecelmaen.........................................leqgkiepvV----------------------...---..-----..---...................---------------etqqkkrkrhledegeaatekkkkkklegyksvyhetpeseelhfthlssedveygtiledlketylkepegdidseaykkkkkkkhklhsvtsdgketateltevlehayegngdevvhfpdhakkkkkkkqee.................................................................................
F1SC14_PIG/125-334                    .........................PEPGQKL.MGTI..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................E.-QWQTleinvgdelefevfrldsdaagvfcirgkvnvsslqtkcpaipevtetateeaa..............vekppkkkkkkktdpepceaedgtteltdfvdvtikeetdsqinnivngllekepK-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------kkkkkkkkhqedqdqdpvfqgsdssgyqsdhkkkkkkrkeaeftplsehapkkkre................................................................................................................................................................
A0A286UH09_9AGAM/148-305              .........................PQIGMKL.TGRI..KLCSPDHIAILIHRTFNVS..I.P.R.H.H.........................I..PT......................D.-NWEFeygalededetpnsn............................................................................................dpntttadsqenqnpnD-------..---..----.-..-....--.--..--.-..-...--..--.-..EESGnsksvrfdnttdtgs............................sdpsaaaadkdkdstEDELGEPSLGYWVHKVTGEKLGD...KNG..QLEFT..VIG...................LTIANQMLSLVGSI-q.......................................................................................................................................................................................................................
A0A7E6CJL1_9CHIR/125-379              .........................PEPGQKL.LGAV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.H.........................M..PA......................E.-QWQGleinvgdelefevfrldsdaagvfcirgklnitslqakcsavseevtea.........................gpeevfekplkkkkkkkkdpepdegaggttepadfadpqvnssvnglwdG-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------eprkkkkkkkkkdpepsegaggttepadsagvpmteetdpqvnssvnglwdgepgkkkkeqhqedqdqdpvfpasdssgyqsdhkkkkkkrkhseeaeftpllehsprkkrk........................................................................................................
Q6CLK4_KLULA/121-220                  .........................PQVGDTI.EGWI..FIQSASHIGLLIHDAFNAS..I.K.K.N.N.........................I..PN......................D.WTFIH...........................................................................................................................--------..---..----.-..-....--.--..--.N..E...ET..TE.N..GQDS..........................................................TDDRKFQSLGHWVDGNGQQLGGK...---..-LKFK..VKN...................VYTTGRMVSLEGTLL........................................................................................................................................................................................................................
A0A4Q4W9H2_9PEZI/309-434              .........................PKRGSWM.EGSL..NLQSEGFIGVICFGMFNAS..I.E.A.S.R.........................L..PS......................G.WKWVD..........................................................................................................................lL--SKKGR..KQQ..NGKS.A..A....ET.KL..PT.P..E...PQ..DE.N..GVED..........................................................DGADQAHSTGYWVDESGSKVGGK...LRF..RIKNY..EVG...................SVGDYGYLSIEGTML........................................................................................................................................................................................................................
A0A367Y118_9ASCO/128-221              .........................PQVGDIL.EGDV..YMQTPSHIGLLINDTFNAS..I.K.K.Y.N.........................I..PS......................S.WTFKS...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.S..QVDE..........................................................VSSDDRKTFGHWIDENETKIEGK...---..-LQFT..VKA...................IYTTGRVVSVEGTL-i.......................................................................................................................................................................................................................
A0A6J1NNX8_BICAN/100-271              .........................PHVGATL.KGIV..NKKSVTHLGILVHRVFNVV..V.P.R.P.T.........................E..EP......................D.-DWIGstveegqevmfqivvldlygalpyirgkl.................................................................derwlnmvadgdedngieikptrpikisyV-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------nfdktkpiqkqinnesthtmnnesssqinigkkncngqsssnieceknlpekikkkkqnkvaeseakqpd..................................................................................................................................................
A5DRS4_LODEL/129-238                  .........................PNVGDVL.EGDI..YMQTPSHIGLLIHDVFNAS..I.K.K.H.N.........................I..PH......................D.WEFQH...........................................................................................................................--------..---..---A.Q..Q....DE.VG..EE.N..E...GG..AD.E..EGAT..........................................................AGTNGGRKFGHWVDAEGNSVDDA...---..KLKFT..IKS...................LYTTGRVVHIDGTL-i.......................................................................................................................................................................................................................
A0A5N6SJP6_ASPPS/248-396              .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEGSVS.gDQQ..KTTT.A..S....ED.DE..SE.P..S...AS..FD.Q..EK-Ehfnpvslanp......................................vsdtlneevnAEDDESAAEGYFQSVSGHRVRGT..vRFR..VVDVD..VIP..................gSERDRSFLSIEGTML........................................................................................................................................................................................................................
A0A5N6L0P5_9ROSI/176-285              .........................PKKGIVL.KGYP..TISSESHIGLICYNLFNAS..I.P.F.R.H.........................I..PK......................D.WRWEP...........................................................................................................................--------..---..----.-..-....--.--..--.A..R...SK..KS.S..VASG..........................................................DHAQEEEGEGYWIDGDDNPIRNDeelQFV..IRDFE..SVGq................gaGPRDKGFLTLEGTLL........................................................................................................................................................................................................................
A0A367LD87_9HYPO/400-513              .........................PSRGSWM.EGII..NLQTEGHIGVVCFEKFNAS..V.E.A.V.R.........................L..PP......................S.WKWVS...........................................................................................................................--------..---..--LG.S..V....EA.EG..FD.K..T...AS..FM.T..DDND..........................................................DAVQKVDSTGFWVDGRGAKVQGK..iRFR..IRNFD..A-G...................TSGGTSYLSLEGTML........................................................................................................................................................................................................................
A0A2A9NAP9_9AGAR/122-224              .........................PQVGVKL.VGKI..NAWSPDHVSLLIHETFNAS..I.P.R.R.H.........................I..PN......................N.-TWYF...........................................................................................................................--------..---..----.-..-....--.--..-K.Y..G...TL..RN.D..THRG..........................................................YIGSNIEEEGMWVHRATGDRLGD...-EG..YLEFT..VIG...................LIVANEMLSLLGSLQ........................................................................................................................................................................................................................
A0A101MNI4_9EURO/190-328              .........................PKRGQTL.DGWV..NVQSEGFLGAVVFNLFSVG..V.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEAETP..ALT..DDDS.G..S....DK.DM..AD.F..D...AE..KE.C..FKPAslsee................................................diaidGEEEDESHTGYFQSVSGHRVSGS..vRFR..VVDVD..VIP..................gSERDRGFLSIEGTML........................................................................................................................................................................................................................
A0A2B7Y1H9_9EURO/227-383              .........................PERSQIL.EGWI..NVQSEGFLGAIVYNLFSVG..I.E.K.R.R.........................L..PS......................N.WTWIT...........................................................................................................................PGQETAVT.sAAT..SSAT.S..P....AS.ED..SE.F..D...ED..KE.-..---Nfrpvpatslnldlgm...........................ttnddtttaattnavgEEDDLSADSGFFQTQSGRRVRGV..iRFR..VRDVD..VIP..................gSERDKGFLSIEGTML........................................................................................................................................................................................................................
F2EDK3_HORVV/98-250                   .........................PQPEMIL.EGKV..EMLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..PE......................T.FKFKRrghggkfisqldkqhvikkgsmirfsvkrvdte.........................................................mnchitgslmpphtgcmrwlsvhdaeyaseissG-------..---..--KR.K..S....RD.HT..KT.E..H...NV..QG.R..ATVN..........................................................-----------------------...---..-----..---...................---------------sedsvvnserprkskkrsvee...................................................................................................................................................................................................
K0KJA1_WICCF/143-248                  .........................PSIGDVV.EGLI..YMQSPSHIGLLINDTFNAS..I.K.K.N.F.........................I..PE......................N.WEFIP...........................................................................................................................--------..---..----.-..-....NQ.LD..EF.Q..D...EN..QD.D..EENN..........................................................SKSKKFQSLGQWNDENNMPIDGK...---..-IKFT..IRR...................IHTSGRVVSVEGSL-i.......................................................................................................................................................................................................................
T0KE68_COLGC/283-405                  .........................PRRGAWM.EGVI..NLENEGHIGVVCWSKFNAS..I.E.S.A.R.........................L..PA......................E.WRWVH...........................................................................................................................----ADSA..EAA..QYVA.D..P....FA.AE..ED.A..A...EA..QA.A..EDEH..........................................................GAVSQIHTTGFWVDGAGEKVKGR..vRFR..IKAFD..V-G...................VSGDHGYLSLEGTML........................................................................................................................................................................................................................
A0A0C7NES5_9SACH/126-227              .........................PQVGNVI.EGWV..FIQSPSHIGLLIHDAFNAS..I.K.K.T.T.........................I..PP......................E.WTFIH...........................................................................................................................--------..---..----.-..-....--.--..NE.D..I...NG..SE.E..GGND..........................................................GDAEQPRSLGHWVDENGQQLDGK...---..-LKFT..VRN...................VYTTGKVISLEGSLL........................................................................................................................................................................................................................
A0A2K6SZF5_SAIBB/125-261              .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWQTieinmgdelefevfrldsdtag..............................................................................vfcirgklnitslqfkhsevseeV-------..---..TENG.T..E....EA.AE..KP.T..K...KK..KK.K..KKD-..........................................................-----------------------...---..-----..---...................---------------petyevdsgttkiadfgddtpmees...............................................................................................................................................................................................
V9ETG2_PHYPR/83-269                   .........................PKEGMML.RGVV..NKIGSNHVGMLFAGVFNGS..V.A.E.A.E.........................L..PK......................G.YVHNYaqdcwlgedgssisvedevevkvlrvhvaggmiaie...................................................atmrfdaagvakstapkkvkktshlnlaagepvtkpIKEKKTKK.tKKV..DEAE.D..K....QE.KK..SK.K..R...KH..EK.P..DEEV..........................................................VEEEPVEAEEVKVKSKKHK----...---..-----..---...................---------------hkdkdakkkkhkktkhd.......................................................................................................................................................................................................
A0A1E5RDD9_HANUV/118-208              .........................PKRNDTI.KGYP..FIQSESHIGFLIHDLFNCY..I.K.L.Q.D.........................I..PD......................T.WKFIY...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..---D..........................................................EDSDDSTNIGYWVDENEEPINGK...---..KIDIK..VKQ...................LKTNGKMVSIEGSL-i.......................................................................................................................................................................................................................
A0A5B1QRQ7_9AGAM/128-262              .........................PEVGMKL.SGKI..NLCSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..PT......................D.-EWEFeygp...................................................................................................................aendPEFSSEAV.aAPD..PEPE.T..D....VA.EA..KL.E..E...GV..EA.A..EKTE..........................................................ENDEGVDRGGRWIHKVTGARLGG...EEG..RLEFT..VVG...................LTIANQMLSLLGSI-q.......................................................................................................................................................................................................................
A0A2T4ABS0_TRIHA/120-233              .........................PSRGAWM.EGSI..NLQTEGHIGVVCFGQFNAS..I.E.A.R.R.........................L..PS......................A.WKWVS...........................................................................................................................--------..---..--NE.D..P....EA.YG..ME.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWVDGDGKKVKGK..iRFR..IRNFD..V-G...................VSGETSYLSLEGTML........................................................................................................................................................................................................................
A0A6L2Q1Y6_COPFO/102-353              .........................PEVGCIL.FGVV..NKKGVDHIGCLVHRCFHVA..I.P.R.S.T.........................E..ET......................G.GEWLGtsvnigdmvtfrveecdftgslpyir.......................................................................gklinsssgcvtlmkkdevdgisepqKKKKKNKH.kESD..QSSE.N..A....EC.AL..MA.N..N...VE..RE.K..IEPL..........................................................LGTKHKKRKRHFEDEGGTGVE--...---..-----..---...................---------------ikkkkkkqdvedhkstycetqehedlhfthlssedaeygtvleaiketylgdsgskahkkkkkhklctdtnegkeketiaevtenrehscagngdevmhd....................................................................................................................
A0A1L7WKR2_9HELO/157-260              .........................PERGVEL.EGYV..NLQNEGHLGVVCWNLFNAS..I.E.R.K.R.........................L..PR......................D.WVWRD...........................................................................................................................--------..---..----.-..-....--.--..--.V..S...EL..EG.E..GVGG..........................................................NEGYAEDGQGCWVDGEGKKVEGM..iRFR..VKEIE..-SS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A4V5NGY1_9PEZI/175-280              .........................PRKGISI.RGYV..NLQTESHLALVCWNLFTAS..I.D.R.K.R.........................L..PK......................E.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..--.Q..D...AV..SN.G..TDSM..........................................................VNGSHQGGEGCFVDSEGQKVDGL..iDFR..IQDFE..ASP..................aTERDKGFMSIEGTLL........................................................................................................................................................................................................................
A0A1V6P7K7_PENDC/159-301              .........................PRRGQTL.EGWV..NVQSEGFLGAVVFNLFSVG..I.E.R.K.R.........................L..PT......................N.WRWVP...........................................................................................................................--PGDEAE.eTET..TGDA.A..T....DE.PA..TE.S..A...PP..GF.D..---Pakelfqprq........................................laegeidfdDDEEAAAAAGHFKSVSGHRVRGN..vRFR..VVDVD..VIQ..................gMERDRGFLSIEGTML........................................................................................................................................................................................................................
A0A166V712_9HYPO/288-401              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................A.WKWVS...........................................................................................................................--------..---..--NE.S..T....EA.NG..FE.D..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWVDGDGERVKGK..iRFR..IRNFD..A-G...................TSGEATYLSLEGTML........................................................................................................................................................................................................................
A0A177DRU9_ALTAL/121-225              .........................PTRNAHL.TAHI..TDQAKTHLTLAHLNTFPVS..I.L.K.E.C.........................L..PS......................D.WSWHS...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...EE..AG.H..MKKG..........................................................WDGRLSDEGGWWVNGDGEKVEGElrvRIR..DVDGR..MDG...................KGKGKGFLRVDGAL-i.......................................................................................................................................................................................................................
Q2U264_ASPOR/283-431                  .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEGSVS.gDQQ..KTAT.T..S....ED.DE..SE.P..S...AS..FD.Q..EKEHfnpvslanp.......................................vsdtlneeanAEDDESAAEGYFQSVSGHRVRGT..vRFR..VVDVD..VIP..................gSERDRSFLSIEGTML........................................................................................................................................................................................................................
A0A0E0FI08_ORYNI/81-229               .........................PKPDMML.EGKV..EMLGKESIHAIVLGVFSAA..I.M.L.D.D.........................I..HE......................K.FKFKRkkyggkfvsrsdkqhvikkgsmirfsvkrvdae.........................................................mnchvtgslipphtgsmlwlsvhddeyaleinsG-------..---..KRSR.D..N....KI.KT..EQ.H..E...QD..HS.V..KSSG..........................................................RKHKSKSR---------------...---..-----..---...................---------------krsfeer.................................................................................................................................................................................................................
A0A0C2YG17_HEBCY/84-203               .........................PRVGFKL.CKSFlaLLCSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..PT......................D.-TWEF...........................................................................................................................--------..EYG..PAEN.D..P....EF.GP..SV.Q..Q...AT..EE.D..EVTK..........................................................DYTLSQDSGGRWVHRVTADVLGG...NGA..LVEFT..VIG...................LTVANEMLSLLGSLQ........................................................................................................................................................................................................................
A0A2P5I0C6_9PEZI/218-348              .........................PSRGAWM.EGEI..NLQSEGHIGVVCFDKFNAS..I.S.R.R.S.........................L..PK......................G.WTWVDq........................................................................................................................peEEEEEEEQ.pEPV..AAEE.D..P....FV.EG..QE.Q..T...AE..GE.E..GKKA..........................................................EQAPQLRSSGYWLDRNGEKVTGK...IYF..RIKNF..SSG...................STGDYIYLSLQGTML........................................................................................................................................................................................................................
A0A177CZU0_9PLEO/124-227              .........................PAPNAYL.DATL..THQAGTHITLAHLNTFAIT..V.M.K.E.H.........................L..PA......................D.WTWNA...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...AQ..TG.K..KKKG..........................................................FDGRIADEGGWWMDGELNEVKKG...TSM..RVRVR..EWDv.................rGGKGKGVLRVDGSLL........................................................................................................................................................................................................................
A0A6P7FSH0_DIAVI/104-234              .........................PEIGKIM.EGVV..KRKSKDHIGALVYEAFNVS..I.P.L.T.SdddeeelgntvkvgdtvtfqiiyinL..--......................-.----Tsrlpyirgrlmse.................................................................................................ttetetneiseikI-------..--K..KRKN.K..S....KT.ET..TE.T..E...TN..ET.T..ETKV..........................................................KKKKSK-----------------...---..-----..---...................---------------tkekkveemedd............................................................................................................................................................................................................
A0A1Z5TRW6_HORWE/285-390              .........................PQKGTYL.EGYV..NLQNESLLGLVCYNYFNAG..I.E.W.N.S.........................L..PK......................D.WQWVS...........................................................................................................................--------..---..----.-..-....--.--..--.D..E...EG..AL.T..GKGK..........................................................GKKATQEGEGHWVDAEGKKVDGR..lIFR..VKDFE..ATP..................gSEGGAGSINIVGTLL........................................................................................................................................................................................................................
A0A439D8W1_9PEZI/254-375              .........................PSRGAWL.EGLV..NIQSGGHIGVVCWGKFNAS..I.E.S.E.R.........................L..PR......................D.WQWID...........................................................................................................................-------Q..HSS..QSNG.E..A....EP.ES..TS.S..P...SP..LA.Q..GDTE..........................................................VGHTEVHATGYWVDGQGSKITAEt.pICF..RIKNY..EVG...................SSGDYGYLSIEGTML........................................................................................................................................................................................................................
A0A5N3XSW1_MUNRE/121-331              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHKCFNAS..I.P.KpE.Q.........................M..PA......................D.-QWQTlqinvgdelefevfrldsdaagvfcirgk.................................................................lnitslqtkcsavpekapetgadepvekpPKKKKKKK.kDRE..SCEA.E..G....GA.TE..PA.E..F...AD..VT.V..KDET..........................................................DLQVSNSVNGLWEGEPKKKKKKK...---..-----..---...................---------------khqedrdqepvfqgsdssgyqsdhtkkkkkrkseeaeltpleehapkkkre.....................................................................................................................................................................
A0A0F9Y0P2_TRIHA/254-367              .........................PSRGAWM.EGSI..NLQTEGHIGVVCFGQFNAS..I.E.A.R.R.........................L..PS......................A.WKWVS...........................................................................................................................--------..---..--NE.D..P....VA.YG..ME.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWVDGDGKKVKGK..iRFR..IRNFD..V-G...................VSGDTSYLSLEGTML........................................................................................................................................................................................................................
A0A0A2W9R5_BEABA/255-368              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................S.WKWVS...........................................................................................................................--------..---..--NE.D..P....EA.EG..ME.E..T...AS..IV.A..PDEH..........................................................GVVHQIHSTGFWVDANGDKIKGK..iRFR..IRNFD..V-G...................VSGETTYLSLEGTML........................................................................................................................................................................................................................
A0A2P6TLW3_CHLSO/81-123               .........................PRPGMRL.VGTV..NKVGADYVGLLVLGVVNAS..I.A.A.D.Q.........................I..RP......................E.-----...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------frpr....................................................................................................................................................................................................................
R9PFN4_PSEHS/142-233                  .........................PRIGQML.EGNI..CLSSPSHVSLLLYGLFNAS..I.P.A.S.H.........................L..PA......................E.FEFVL...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-DDSGDQGMGFWKSKIDNTKLGG...STG..KLQFT..VIS...................LTIANHMLSLHGSML........................................................................................................................................................................................................................
A0A672FAW0_SALFA/140-367              .........................PQKGQKL.LGMV..NKLGLSHVGCLVHGCFNAS..I.P.K.P.N.........................L..VT......................V.ETWRDfgprigaelefevmaldadtagvllirgrlsktrvqemlaqg......................................esgessvpvdqtdaddtnpttepsqespddtpkkkkkkkkdrvK-------..---..----.-..-....--.--..--.-..-...--..--.-..---Eeeieeemscttpdl..............................ngttdevnggeaaeK----------------------...---..-----..---...................---------------kkkkkkkkekhikeeeeeteilptevqgsdssgyqsdkpskkrkheaggeeaeppkskkkrkhdveqf....................................................................................................................................................
A0A455BPW8_PHYMC/125-289              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................E.-QWQTleinmgdelefevfrld........................................................................................sdaagvfcirgklnitslQ---TKCS..EVS..EEVT.E..T....GT.EE..AT.E..K...PQ..KK.K..KKKKtype.................................................pyeveG----------------------...---..-----..---...................---------------gtteladfsdvtvkeetdlqinnhvnglweeepkkkkkkkhqdpv...........................................................................................................................................................................
H3BX99_TETNG/124-340                  .........................PQKGQKL.LGKV..NKLGVSHVGCLVHGCFNAS..I.P.K.P.N.........................L.vPM......................E.-TWRDagprigadlefevttldadavgv............................................................................llirgrldrtstapdqlqpdteenG------D.lNPD..STDE.S..A....VK.KK..KK.K..K...KK..NE.E..QEEEvtdpasvql........................................dagaadlneTVDGEQGSGGK------------...---..-----..---...................---------------kkrkkdkrlkqeeveqevpisavevhgsdssgyqsdkpskkrtrepaadvtsagdgpepkrskksksr....................................................................................................................................................
I2K289_DEKBR/155-235                  .........................PKIGDVV.EGWC..YMQSQSHIGLLIHDAFNAT..I.K.K.F.N.........................I..PA......................E.WQFVP...........................................................................................................................--NEEDEY..HXA..DAVE.D..G....DL.AE..SK.N..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------vgdattegtdyhskx.........................................................................................................................................................................................................
A0A5N5DS73_9PEZI/167-271              .........................PRKGIWI.EGSV..NLQNESHLGLVCWNLFSAS..I.D.R.K.R.........................L..PE......................D.WTWVE...........................................................................................................................--------..---..----.-..-....--.--..--.-..A...GE..GA.D..DEDM..........................................................DADKPDAGQGHFVDAQGKKVDGV..iKFR..IRDFE..TSP..................rTENDRGFITIEGSLL........................................................................................................................................................................................................................
W1NR12_AMBTC/81-235                   .........................PKPGMLL.EGTV..NKLGKDYIGVIVLGIFNAA..I.A.I.T.D.........................I..RE......................E.FHYEKdedgepiwvstdhgdhvirtgtvlrflvesvte.........................................................difieisgslkpsktgcvrwlsshevesasiprRSHKKHKS.nERK..PKDH.D..S....MQ.ED..TR.E..D...SN..SH.K..MG--..........................................................-----------------------...---..-----..---...................---------------kakrkrlsenve............................................................................................................................................................................................................
F0UK09_AJEC8/234-392                  .........................PERGQPL.EGWI..NVQSDGFLGAVVYNLFSVG..I.E.R.R.R.........................L..PA......................D.WRWVApgqestt.............................................................................................................stseavsPKDRGGSV.gVGV..DDDD.D..D....DD.DD..KS.S..D...FD..SD.K..ENFRplpassaamldh.................................stqyqsnggleppFEAFEDASAGYFQTRSGRRVRGM...EER..-----..---...................---------------kragfapsssssava.........................................................................................................................................................................................................
K9G4Q5_PEND2/156-294                  .........................PKRGQTL.DGWV..NVQSEGFLGAVVFNLFSVG..V.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEAETP..AVA..YDDS.G..S....DK.DM..AD.F..D...AE..KE.C..FRPTtlsae................................................eipidGEEDESAHTGYFQSVSGHRVNGS..vRFR..VVDVD..VIP..................gSERDRGFLSIEGTML........................................................................................................................................................................................................................
A0A0C4EGQ6_MAGP6/4-102                .......akkerfrnagkrtatvan-------.----..-------------------..-.-.-.-.-.........................-..--......................-.-----...........................................................................................................................---GDDDA.aSSS..TSQI.N..G....QN.GS..TN.N..N...EE..EG.P..EDLE..........................................................NSLQQMHATGYWVDADGQRVQGK..lRFR..IKNYD..-VG...................TAGDHGYISIEGTML........................................................................................................................................................................................................................
F7F5A4_MONDO/240-455                  .........................PERGQRL.LGTV..NKVAPSHLGCLVHGCFNAS..I.P.KpE.H.........................M..PA......................E.-QWQGlhfhvgdelefevsrldsdaagvfcirgalivsslppvfpalpegsenaghepepg...........igeekpkkkskkdlkqprldgglkeaaapsdeagtveidpqaqeavnglceeeqepPAKKKRHR.eEPE..QDPL.W..H....AS.DS..SG.Y..Q...SD..HQ.K..KKKK..........................................................R----------------------...---..-----..---...................---------------kkhsdepegpvapeeprpkrkkkk................................................................................................................................................................................................
K3Z901_SETIT/101-254                  .........................PQPDMIL.EGKV..EMLGKESIHAIVLGVFSVA..I.M.S.D.D.........................I..HE......................K.FKFKRrgdggrfvsrsdrehmikkgtmirfsvksvdte........................................................mnchitgslippqtgsmrwlsahdaeyasqinsgKRKSRDIS.iKIE..QNEQ.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------ehrilqnensmvkserphksrkrsied.............................................................................................................................................................................................
A0A3R7GGL3_9EURO/179-337              .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWVP..........................................................................................................................pGEEEEDTS.kSGE..KPKK.K..V....FS.ST..ED.D..D...ES..EP.S..SHFDpekehfkpislasd..............................anpfsetmelnnpsAEDDESAAEGYFQSVSGHRVRGT..vRFR..VVDID..VIP..................gSDRERAFLSIEGTML........................................................................................................................................................................................................................
A0A401PME0_SCYTO/115-309              .........................PKTGQKL.VGIV..NKIAPSHLGCLVHGCFNAS..I.P.K.P.Q.........................Q..AN......................G.-TWPDfavtvgdnlkfevlqldadvvgvlc........................................................................irgrlskrhrvqaacgvasaeslesnS-------..EES..LKKN.S..E....EQ.DY..EM.V..R...KK..KK.K..KR--..........................................................-----------------------...---..-----..---...................---------------ekcieegtaeeavsyeisdrslqkdgmgnaeiisdskkpkkrkrrtlelnadtenpgrddsdyhsdkaikknekkh............................................................................................................................................
A0A1Q8RRX1_9PEZI/290-409              .........................PRRGAWM.EGSI..NLENEGHIGVVCWGKFNAS..I.E.S.A.R.........................L..PP......................E.WRWIH...........................................................................................................................----AGS-..-AE..AAAY.V..S....D-.PF..DD.N..A...ST..HT.A..EDEH..........................................................GAVRQIHTTGFWVDGAGEKVKGR..vRFR..IKAFD..V-G...................VSGDHGYLSLEGTML........................................................................................................................................................................................................................
A0A2G4T6K6_RHIZD/126-242              .........................PKKGSKL.VGRI..NLQSEDHIGLLIYGTFNAS..I.P.K.S.R.........................I..PS......................S.-MYEW...........................................................................................................................--------..KVS..EEDD.A..P....VQ.EE..SS.I..D...ED..ED.G..KEST..........................................................PEERKRTQYGEWVNKQTGASVGG...DDG..TVEFT..VID...................IIEANDILTVTGSL-........................................................................................................................................................................................................................
A0A3B6KHY3_WHEAT/98-248               .........................PQPEMIL.EGKV..EMLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..PE......................T.FKFKRrghggkfisqsdkrhvikkgsmirfsvkrvdte........................................................mnchitgslmpphtgcmrwlsvhdteyaseissgK-------..---..---R.K..P....RD.HT..KS.E..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------qkvqdcttanredsvvnserprksrkrav...........................................................................................................................................................................................
A0A5B8MQP1_9CHLO/81-154               .........................PKRGSTL.VGKV..HKLGSDYIGMLVLGVFNAV..L.P.R.D.K.........................V..DY......................K.YQGNF...........................................................................................................................---KQDFD.gNTA..KAAK.K..K....GK.EA..D-.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------npveiregcs..............................................................................................................................................................................................................
A0A086TB97_ACRC1/265-378              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKWNAS..I.E.A.R.R.........................L..PP......................S.WRWVS...........................................................................................................................--------..---..--NE.E..A....EA.GF..EE.T..A...SV..IT.G..VDEH..........................................................GVVRQIHSTGYWVDASGEKISGR..vRFR..IRNFD..V-G...................VSGNATFLSLQGTML........................................................................................................................................................................................................................
R9AFX6_WALI9/105-198                  .........................PTIGQRM.RGKV..TLCSPDHISLLVHHTFNVT..I.P.R.E.F.........................I..DC......................Q.-TFKY...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..--AN..........................................................DSATENSGGGRWLHTSSTQVLAE...QGR..DVDFS..VIE...................RNTTNGMLTLTGSIL........................................................................................................................................................................................................................
F4PAT8_BATDJ/144-203                  .........................PKVGSIL.YGVV..NKVSPDHIGLLVYGVFNTS..I.P.S.S.H.........................I.cNK......................K.FSWDA...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------egyawkfesaidhst.........................................................................................................................................................................................................
A0A369JD72_HYPMA/129-252              .........................PHVGMKL.VGKV..NLCSPDHVSLLLHRTFNVS..I.P.R.H.H.........................I..PK......................G.-EWEF...........................................................................................................................---EYGPA.eNDP..EFGP.D..A....HH.EG..GE.D..K...VD..AG.E..TEGT..........................................................SEKHDGDGGGKWVHHLTGEKLGA...SDG..FLEFT..VIG...................LTVANEMLSLLGSI-q.......................................................................................................................................................................................................................
A0A409VPN4_PSICY/106-224              .........................PRVGLSL.SGKV..NLCSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..PT......................D.-IWEF...........................................................................................................................----E-YG.pVEN..DPEY.G..K....VD.GK..EE.Q..D...AT..VA.E..D---..........................................................GHEIDYSSGGKWVNRVTGEVLGS...RDG..LLEFT..VIG...................LTVANEMLSLLGSLQ........................................................................................................................................................................................................................
A0A4U0XL01_9PEZI/105-204              .........................PTKGSWL.EGFV..NLQNESLLGLVCYNYFNAA..I.E.R.H.R.........................L..PK......................D.WRWVE...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.D..GSQG..........................................................STRVGKGSQGYWVDGNGQKMDGR..vVFR..VKDFE..AAP..................gSESGAGSLNTLGTLL........................................................................................................................................................................................................................
A0A0E0MN61_ORYPU/81-143               .........................PRPDMIL.EGKV..ELLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..NE......................K.FKFKR...........................................................................................................................--KG----..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------dggkfisrsdrhhvirk.......................................................................................................................................................................................................
A5DC09_PICGU/125-223                  .........................PNAGDII.EGYS..YMQTASHIGLLVHDTFNAT..I.K.K.L.N.........................I..PA......................E.WRFVP...........................................................................................................................--------..---..----.-..-....--.--..--.-..S...QV..DE.Y..AESE..........................................................QDTGKFKSFGYWVDENDVKIEGK...---..-IKFT..VKS...................VHASGRVVSLAGTL-i.......................................................................................................................................................................................................................
A0A4Q4TDL7_9PEZI/306-430              .........................PKRGSWM.EGSL..NLQSEGFIGVICFGMFNAS..I.E.A.S.R.........................L..PS......................G.WKWVD..........................................................................................................................lLSKKD---..GKQ..QNGK.S..A....AE.AN..LP.T..P...EP..QD.E..NEEE..........................................................DGTDQAHSTGYWVDESGSKVGGK...LRF..RIKNY..EVG...................SVGDYGYLSIEGTML........................................................................................................................................................................................................................
A0A094BR87_9PEZI/164-261              .........................PTRGGWL.EGYV..NLQNEGHLGIVCWNLFNAS..I.E.R.Q.R.........................L..PK......................D.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.A..EDME..........................................................GDGYAEDGVGYYVDGAGTKIEGI..vKFR..VKDIE..-SS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
H6C0M7_EXODN/256-394                  .........................PERGDEL.YGWT..NVMSEGFVGLVSYNYFQTA..V.A.K.S.R.........................I..PQ......................D.WTWNGpsre..................................................................................................................eirknKKKGRKGR.lRDE..DGAS.S..Q....TP.EN..EN.A..A...VE..EG.D..QDAT..........................................................VSQVQLADVGSFVDAKGSKIPPT..qKFR..VVDTE..VVP..................sHDRHKWSLQIEGTLL........................................................................................................................................................................................................................
A0A6J3MEM4_9PEZI/118-163              .........................PRRGTLL.EGYV..TLQNESILGLLCYNYFNAG..I.Q.A.E.K.........................L..AK......................D.WTWDG...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------ea......................................................................................................................................................................................................................
A0A1L9Q4I5_ASPVE/177-347              .........................PQRGQTL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PR......................T.WKWIP...........................................................................................................................PGEEDYA-..EDS..GPTS.N..N....TS.AQ..TS.E..D...ED..DE.K..TSNSppfdpakehfnpvptasdsnp...............fasdtpdqdqdaidagtaerggEGSDEDTYEGYFQSISGHRVRGT..vKFR..VVDID..VIP..................gSERDRGFLSIEGTML........................................................................................................................................................................................................................
A0A672SLB4_SINGR/132-282              .........................PKKGSKL.VGVI..NKMGVGHVGCLVHGCFNAS..V.V.K.P.S.........................L..LS......................S.EQWRDcglcvgqslefevfqldadaagvllirgr................................................................lekcrygqcflfmfltsncyfrlkyesiiyN-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------nasssekvvwsesgeksaqikhrenspkqletnmwettgdglfhwsk.........................................................................................................................................................................
A0A3B5KGN9_TAKRU/129-341              .........................PRKGQKL.LGKV..NKLGVSHVGCLVHGCFNAS..I.P.K.P.N.........................L.vPM......................E.-TWRDagprigaelefevtaldadtvgvllirgrldrtrvqel...............................................laigetsessitvdqpnpsdteangelnldptdectikKKKKKKNK.iKEE..TEEV.A..D....SS.CI..HG.T..G...EK..KK.K..RKKE..........................................................KHLKPEEVKDE------------...---..-----..---...................---------------evqvsvmevhgsdsgyqsdkphkkrkhepaaditssvgdgpepkksk.........................................................................................................................................................................
A0A340X8V4_LIPVE/125-328              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................E.-QWQTleinmgdelefevfrldsdaagv.............................................................................fcirgklnitslqtkcsavskevT-------..---..-ETG.T..E....EA.TE..KP.Q..K...KK..KK.K..KKDP..........................................................E----------------------...---..-----..---...................---------------pyevesgtteladfadvtmkeetdlqinnnvnglweeepkkkkkhqdpvflgsdssgyqsdhkkkkkkrkhseeaefapllehapkkkre..............................................................................................................................
A0A066VIS4_TILAU/225-342              .........................PRIGMRL.EGKI..SLSSPSHVSLLLQGTFNAS..I.S.A.P.H.........................I.sLK......................H.WEFVH...........................................................................................................................--------..--E..DPAN.S..V....PS.SE..AG.S..D...GT..ND.H..ADGD..........................................................ADGHAPHSLGYWRNKKDGSRLGG...TSG..RLVFT..VIS...................MTVANHMLSLHGSLL........................................................................................................................................................................................................................
A0A315UWE7_GAMAF/137-285              .........................PEKGQKL.LGKV..NKLGVSHVGCLVHGCFNAS..I.P.K.P.S.........................L..VS......................V.ETWRDggprigselefkvttldadiagvllirgql...............................................................ertrvqelmamsenlessvpdgqeepqegeP-------..---..----.-..E....PQ.EA..--.-..-...--..--.-..---Epapepi..............................................hdgtpkKKKKRKKEKERIKEEETE-----...---..-----..---...................---------------eqitttpp................................................................................................................................................................................................................
A4SB27_OSTLU/127-170                  .........................PVKESRL.VGTV..NKIAHDFIGALVLDRFNVA..I.A.A.E.N.........................I..RE......................E.-----...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------lvsss...................................................................................................................................................................................................................
C0NB42_AJECG/234-402                  .........................PERGQPL.EGWI..NVQSDGFLGAVVYNLFSVG..I.E.R.R.R.........................L..PA......................D.WRWVApgqestt.............................................................................................................stseavaPKDRGGSV.gVGV..DDDD.D..D....DD.ED..KS.S..D...FD..SD.K..ENFRplpassaamldh.................................stqyqsnggleppFEAFEDASAGYFQTRSGRRVRGM..vRFR..VRDVD..VIP..................gAEHDKGFISIEGTML........................................................................................................................................................................................................................
A0A369GQS0_9HYPO/293-406              .........................PSRGSWM.EGII..NLQTEGHIGVVCFEKFNAS..V.E.A.V.R.........................L..PP......................S.WKWVS...........................................................................................................................--------..---..--LD.S..I....EA.EG..FD.K..T...AS..FM.A..ADDD..........................................................DAVQKVDSTGFWVDGRGARVQGK..vRFR..IRNFD..A-G...................TSGGTSYLSLEGTML........................................................................................................................................................................................................................
A0A5E4Q7I6_9NEOP/56-150               .........................PYVGATL.KGVV..NKKYLTHLGVLVHRVFNVV..I.P.R.P.T.........................E..ES......................D.TEWEGtni....................................................................................................................eegqT-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------vlfeiaaldlygalpyirgslekrwselveddedpgdsmkplk.............................................................................................................................................................................
A0A452RSL0_URSAM/125-335              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PT......................E.-QWQNleinvgdelefevfrldsdaagvfcirgklnitslqtkcsavseevtetgtee................iiekplkkkkkkkkdpesyeiengnreladcadatmkketdlqidnvnslcnnePKKKKKKK..HQE..DQDQ.D..P....VF.QG..SD.S..S...GY..QS.D..HKKK..........................................................KKKRKHSEEAEF-----------...---..-----..---...................---------------tpllehspkkkrek..........................................................................................................................................................................................................
A0A4T0WZ76_9ASCO/929-1108             .........................PKIDDIL.KGNI..VMQSQSHIALLVHDVFNAS..I.K.K.H.Y.........................I..PQ......................N.WSFVPnqadteesfknlgywcdgdstpisgplefkvravhvngkgiaiegtllsp......................edeydalpvempttkqhvvfddnetgdndamdvdvedsskttstdvndvpqY-------..AKS..DSDS.D..S....DS.NS..T-.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------sssssdsdsdsssedasssn....................................................................................................................................................................................................
A0A6J2QNJ3_COTGO/141-386              .........................PQKGQKL.LGKV..NKLGQSHVGCLVHGCFNAS..I.P.R.P.N.........................L..VS......................V.ETWRDagprigaemefevtaldadtagvllirgrldrtr......................................................vqellamgescesvvpadqpeapepelnpeateesP----KDT.pKKK..KKKK.K..K....DK.VK..VK.E..E...EE..EE.E..REEEttgtscqld.......................................snttpklngtMNEANDNEAGEKKKKKKKKIKKH..vKEE..EVEVE..FSP...................---------------tevhcsdssgylsdkpkrkrrhetgtdvttsfsedpeppkskkkrksd........................................................................................................................................................................
A0A4S3JT50_9EURO/184-333              .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................D.WKWVP...........................................................................................................................PGEEDDSD.gSKQ..KVSE.D..D....DS.EP..TT.A..F...DP..EK.E..HFKPvslasdanpl......................................sdtlnadpssAEDDESTSEGYFRSASGHRVRGT..vRFR..VIDID..LIP..................gSERDRGFMSIEGTML........................................................................................................................................................................................................................
A0A5N6TK71_9EURO/184-334              .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................D.WKWVP...........................................................................................................................PGEEGSVN.gDKQ..KNAA.S.vT....AS.ED..ES.E..P...SA..SF.D..---Sekehfspvsla...................................npisdtlteeanVEDDDSAAEGYFQSVSGHRVRGT..vRFR..VVDVD..VIP..................gSERDRSFLSIEGTML........................................................................................................................................................................................................................
A0A178F698_TRIRU/199-341              .........................PERGQTL.EGWI..NVQSEDFLGAIVFNLFSIG..I.E.R.R.R.........................L..PA......................D.WKWIApgqqsdr.............................................................................................................psttsasPTSSSKDE..EDE..DDDE.P..D....SD.KE..--.-..-...--..--.-..---Nfkplas..............................................nseasqFEDAASAETGYFQTRSGKRVRGT..iRFR..VRDVD..VIP..................gSERDKGFLSLEGTML........................................................................................................................................................................................................................
A0A1R1X335_9FUNG/230-367              .........................PLRGLRL.RGVV..NIQSQSHIGILVYNIFNAS..I.P.R.K.N.........................I.dKA......................K.YMWVEfeepiieevaadseenqlasnkd............................................................................iagqiaadmaemenkskeksneeeISKEDDSS.kVEE..KADG.S..D....DS.DE..SS.E..E...EE..SG.E..GKGS..........................................................DEKGEGSE---------------...---..-----..---...................---------------eke.....................................................................................................................................................................................................................
A0A2K3QGS4_9HYPO/306-419              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................A.WKWVS...........................................................................................................................--------..---..--NE.S..S....EA.QG..LG.E..T...AS..AM.T..ADDH..........................................................GVVRQIHSTGFWVDGGGARVEGK..iRFR..IRNFD..A-G...................ASGETSYLSLEGTML........................................................................................................................................................................................................................
A0A316VNN4_9BASI/88-217               .........................PHVGQRL.EGKL..TLSTSSHVSLLVHGTFNAS..I.S.S.M.H.........................L..PTseslalaesnstsferpnrgaqV.WSFVE...........................................................................................................................---GYGLD.gVDE..H-AR.G..D....AE.AE..HD.Q..Q...QQ..QE.E..EEEE..........................................................EEEEGRKSTGYWAKEDGGRLGGE...-NG..RIVFT..VIG...................---------------........................................................................................................................................................................................................................
A0A1B8AZ98_FUSPO/268-381              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................D.WKWVP...........................................................................................................................--------..---..--NE.S..P....DA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVIRQIHSTGFWADGSGDKVKGK..iRFR..IRNFD..V-G...................TSGEISYLSLEGTML........................................................................................................................................................................................................................
A0A093Y146_9PEZI/165-262              .........................PTRGGWL.EGYV..NLQNEGHLGIVCWNLFNAS..I.E.R.Q.R.........................L..PK......................D.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.A..EDLE..........................................................GDGYAEDGVGYYVDGAGTKIEGI..vKFR..VKDIE..-SS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A5N5K6G9_9PEZI/303-433              .........................PSRGAWM.EGTV..NLQSEGHVGVVCFNKFNAS..I.E.A.K.R.........................L..PS......................G.WRWVD...........................................................................................................................LNENHNSS.sSTK..PQGK.H..T....FL.SA..DP.D..T...PD..GT.DilDDSP..........................................................LELAELHTTGYWVNEAGEKVSSMp.lRFR..IKNFD..V-G...................VAGDYGYISIEGTTL........................................................................................................................................................................................................................
A0A1X2IEQ1_9FUNG/126-248              .........................PKKGSKL.VGRI..NLQSQDHIGLLIYGTFNAS..I.P.K.S.R.........................I..SS......................D.-KYEW...........................................................................................................................RASEDN--..DDD..GINN.N..T....TN.NS..SD.D..D...DD..EE.E..AVEQ..........................................................TEDRSQSQHGEWVVKDSGASVGG...DNG..SLEFN..VVD...................IIEANDILTVTGSL-........................................................................................................................................................................................................................
A0A1R1XD67_9FUNG/357-445              .................dekgegse-------.----..-------------------..-.-.-.-.-.........................-..--......................-.-----...........................................................................................................................-EKEEGSE..EKT..EESE.E..K....AE.GS..EE.K..G...AT..AT.D..GENH..........................................................SKMRSIKHTGQWVNILTNEPVGS...-EG..YIDFI..VSD...................VYRVNDVIGISGLM-a.......................................................................................................................................................................................................................
A7YWA1_BOVIN/121-328                  .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................D.-QWQTlqinvgdelefevfrldsdaagvfcirgk.................................................................lsiaslqtkcsavpeeapetgadepvekpPKKKKKKK.kDRE..PCEV.E..G....GA.TE..PE.D..F...AE..VA.T..KDEA..........................................................DLHVSNSVNGLWEEEPKKKKKKK...KQE..H----..---...................---------------qdqepvfqgsdssgyqsdhtkkkkkrkseeaeftplvertpkkk............................................................................................................................................................................
A0A3G2S827_9BASI/92-193               .........................PEVGMSV.KGTI..TLSSPSHVSLLLYDTFNAA..V.S.A.P.H.........................I..PA......................D.-AWEF...........................................................................................................................--------..---..----.-..-....--.--..--.-..V...HY..SD.V..GESQ..........................................................RQDAKDRSVGFWQNKETGQRLGG...QDN..TLTFC..VIS...................MTVANQMLSLHGSLL........................................................................................................................................................................................................................
A0A5N6ZQ50_9EURO/188-336              .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PT......................N.WKWVP...........................................................................................................................PGEEGSVS.gDQQ..KTTT.A..S....ED.DE..SE.P..S...AS..FD.Q..EK-Ehfnpvslanp......................................vsdtlneeinAEDDESAAEGYFQSVSGHRVRGT..vRFR..VVDVD..VIP..................gSERDRSFLSIEGTML........................................................................................................................................................................................................................
I1BVW7_RHIO9/129-247                  .........................PKKGTKL.VGRI..NLQSEDHIGLLIYGTFNAS..I.P.K.S.R.........................I..PS......................S.-TYEW...........................................................................................................................-------K.vNEE..DDVN.E..E....EE.SI..LE.D..D...DS..KD.S..QENA..........................................................PETRKRTQYGEWINKSTGASIGR...EDG..SLEFN..VVD...................IIEANDILTVTGSL-........................................................................................................................................................................................................................
W2S4E4_9EURO/357-494                  .........................PEHNDEL.AGWA..NVVSEGFVGVIAYNYFQAG..I.G.K.A.R.........................V..PK......................G.WQWMGat......................................................................................................................gsqHQRKKAKK.gRLG..DGVV.P..S....QD.ND..AD.D..P...PA..SM.Q..SGPV..........................................................YGTRTDDDAGYFVDEKGEKVPDV..lKFR..VVDTD..MAPah...............eaSGGSSWSLQIDGTLL........................................................................................................................................................................................................................
A0A024G6Y8_9STRA/100-233              .........................PRQGMLL.KAQI..NKIGSNHIGMLFVGVFNGS..V.A.A.S.E.........................L..PE......................G.FVYNYhkeswigndgdiinvddivt..................................................................................vkiqrvrvaggmisieasmkvD-------..-QK..EQQS.S..K....RT.KS..AF.V..K...KR..RK.D..----..........................................................-----------------------...---..-----..---...................---------------ivdeepqmemvpatkkkkskqrkqhks.............................................................................................................................................................................................
A0A6I9IYB3_CHRAS/125-330              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................D.-QWHSleinvgdelefevfrldsdaagvfcirgklnitslqdkcskvsedateti.......................teeavekppkrkkkkkdlepyevegntaelvdaaakegtdlqtsdnvhglG-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------eeepkkrkkkkrkhhgdqeqdpafqgsdssgyqsdhkkkkkkrkhseeaeltpileqlskk...........................................................................................................................................................
A0A2U9R1G4_PICKU/136-240              .........................PQVGDNL.EGYS..IMQSQSHIGLLIHDVFNAS..I.K.K.F.Y.........................I..PQ......................D.WYFVA...........................................................................................................................--------..---..----.-..-....-N.QA..DE.P..N...AD..DN.A..ADND..........................................................EPKSSFKKLGHWCDADGTPVGGK...---..-IKFT..VRA...................IHVSGKGLAVEGTLL........................................................................................................................................................................................................................
A0A0E0A5L6_9ORYZ/81-229               .........................PKPDMML.EGKV..EMLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..HE......................K.FKFKRkkyggkfvsrsdkqhvikkgsmirfsvkrvdae.........................................................mnchvtgslipphtgsmlwlsvhdaeyaleinsGKRSRDIK.iKTE..QHEQ.D..H....SA.KS..SG.R..K...HK..SK.S..----..........................................................-----------------------...---..-----..---...................---------------rkrsfeer................................................................................................................................................................................................................
C4JKG6_UNCRE/240-371                  .........................PERGQTL.QGWI..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PP......................D.WKWIAp.........................................................................................................................gQQPTAANQ.dEDE..HGEG.T..F....DP.GS..AL.D..E...DD..AG.R..LLNE..........................................................HDDEVSAAMGYFQTGSGKRIRGT..iEFR..VRDVD..VIP..................gSERDKGFISLEGTML........................................................................................................................................................................................................................
W6MHD2_9ASCO/124-231                  .........................PSVGDVV.EGWS..YMQTQSHIGLLIHDTFNAT..I.K.R.N.S.........................I..PT......................D.WTFEF...........................................................................................................................--------..---..----.S..P....EE.EY..EE.A..E...EG..AE.E..EESA..........................................................EQRPRVRSQGQWKDGNGLSIEGK...---..-IKFT..IKS...................VNRAGRVISVEGSL-v.......................................................................................................................................................................................................................
A6R469_AJECN/233-407                  .........................PERGQAL.EGWI..NVQSDGFLGAVVYNLFSVG..I.E.R.R.R.........................L..PA......................D.WRWVApgqesttsmseav.................................................................................................apkdrggsvgvgiG-------..---..-VDD.D..D....DD.DD..DD.D..D...ED..KS.S..DFDSdkenfrplpassaam...........................ldhstqhqnnggleppFEAFEDASAGYFQTRSGRRVRGM..vRFR..VRDVD..VIP..................gAEHDKGFISIEGTML........................................................................................................................................................................................................................
A0A1R0H296_9FUNG/184-344              .........................PMRGLVL.RGAI..NIQSPAHIGILLYNTFNAT..I.P.K.K.C.........................I.dKR......................L.YKWVEyeqpilqdvpetptd.............................................................................................tndllptsepekitvKTQVSDSS..SES..DSEN.D..D....ST.VP..ST.E..K...IS..SN.T..DEQSedividnpt.......................................spkpdqdthePKRKIITHTGEWVNISTNKSIGS...-EG..YIDFV..VS-...................---------------e.......................................................................................................................................................................................................................
A0A0K6FL51_9AGAM/146-251              .........................PEVGMRI.TGRI..SLHATDHIGVLVHRTFNAS..I.D.K.A.H.........................I..PG......................D.GEWEY...........................................................................................................................--------..---..----.-..-....--.--..VH.G..P...VA..ND.P..EINS..........................................................EEREGDEELGRWINSQTGETLGG...ESG..LVEFT..VIG...................YTIANQMLSLHGSLQ........................................................................................................................................................................................................................
A0A163B6A5_PHYB8/82-120               .........................PKKGSQL.VGRI..NLQSQDHIGLLIYGTFNAS..I.P.K.S.R.........................I..PA......................D.-----...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------........................................................................................................................................................................................................................
A0A168PN23_MUCCL/126-243              .........................PKRGTKL.VGRI..NLQSEDHIGLLIYGTFNAS..I.P.K.S.R.........................I..PS......................S.-TYEW...........................................................................................................................-------K..INE..EEAV.E..E....AI.QE..AN.E..D...ED..AD.V..TEAV..........................................................AEERTRTQYGEWINKATGSSIGG...EDG..TLEFN..VMD...................IIEANDILTVTGSL-........................................................................................................................................................................................................................
U7PXU5_SPOS1/194-322                  .........................PSRGAWL.EGTV..ILQNEGAIGVSCWDKFNAS..I.E.A.A.R.........................L..PT......................G.WQYVE..........................................................................................................................lEDVAETGA.gATN..GDDM.D..T....AE.DG..GA.Q..G...AP..PG.A..ATDT..........................................................ESVAPLQATGYWADADGRPVEGK..iRFR..IKDFD..V-G...................LAGDNGYIAIEGTML........................................................................................................................................................................................................................
A0A437ASR3_CHISP/111-295              .........................PYVGATL.KGVV..NKKSSTHLGILVHRVFNVV..I.P.R.P.T.........................E.ePG......................N.-KWIGegieegqqvvfqivvldlfgalpyir.......................................................................gqlderwlkqfpdddneveeysnesiS-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------vsyinfdktkphtqkqskdhgkscvdqicdmsperkpengdlsstkcgkkdnvavidklkiktkstdsdnqtdkeevsirqskkrkkk................................................................................................................................
A0A5C3DVU4_9BASI/133-234              .........................PKIGQML.EGNI..CLSSPSHVSLLLYGLFNAS..I.P.A.S.H.........................L..PE......................E.-EWEF...........................................................................................................................--------..---..----.-..-....--.--..--.-..V...LN..DD.D..AETT..........................................................EADSRDHGLGHWRNKLDGSKLGG...SSG..KLSFT..VIS...................LTVANHMLSLHGSLL........................................................................................................................................................................................................................
M5BIX0_THACB/148-253                  .........................PEVGMRI.TGRI..SLHATDHIGLLVHRTFNAS..I.D.R.A.H.........................I..PG......................D.GEWEY...........................................................................................................................--------..---..----.-..-....--.--..VH.G..P...VA..ND.P..EINT..........................................................EERQGDEESGRWVNSRTGETLGG...ESG..LVEFT..VIG...................YTIANQMLSLHGSLQ........................................................................................................................................................................................................................
A0A428Q024_9HYPO/297-410              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................D.WKWVP...........................................................................................................................--------..---..--NE.S..P....EA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWADGSGEKIKGK..iRFR..IRNFD..V-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
A0A6P8PSE2_GEOSA/149-298              .........................PKKHHRL.VGVI..NKVALTHIGCLVHGCFNAS..I.P.K.P.P........................pM..SV......................E.-DWQNlglnigdelefevfkldsdavgvfc.........................................................................irgklisesmdhtdvsaedaidrlhI-------..EKP..KKKK.K..E....KL.QS..TG.V..Q...GS..DS.S..GYQS..........................................................DHTNPKKHKRKFLQEEG------...---..-----..---...................---------------elletnrepkak............................................................................................................................................................................................................
A0A3Q2ZUR5_KRYMA/141-365              .........................PKRGQKL.LGKV..NKLGVSHVGCLVHGCFNAS..I.P.R.P.N.........................L..VS......................V.ETWRDagprigtelefkvtaldadaagvllirgqldqtrvqellamsessesgv.........................pinqpdpqevepaaepthkspdgtpkkkkkkkkdkikleeteeeltrtaPSQLNGTT.dETN..GTEE.K..K....KK.KK..KK.K..E...KD..LK.E..EEQE..........................................................MEISLVEDSGCFSDKPRRKRK--...---..-----..---...................---------------hdsgadptsgasddhtptkskkkrkge.............................................................................................................................................................................................
M2UUC1_COCH5/119-223                  .........................PVQNAYL.QAHV..TDHAKTHITLAHLNTFPVS..I.L.K.E.N.........................M..PE......................D.WSWHQ...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...NE..SG.K..VKKG..........................................................WDDKLSDEGGWWVNGKGKKVEGElrvRIR..NIDGR..MDG...................KGKGKGFLRVDGSLL........................................................................................................................................................................................................................
J9KGX1_ACYPI/91-270                   .........................PPVGSII.EAVV..NQTSDNHVSCLVHNLFNVS..I.V.R.P.E.........................N.ePC......................E.-QWSGskikkddkidvkvlsfdltkklphitg....................................................................eiikknddcydsnkiknssftkssstknI-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------vsdftksfnestaspsayssndsecsdeqnnmiteskicadesakvspllinttikqvqkentavsfskfsssdsessde........................................................................................................................................
A0A2P7YS99_9ASCO/124-224              .........................PQPGDVL.EGYI..YMQTQSHIGLLVHDTFNAS..I.K.V.R.N.........................L..PQ......................E.WEFVP...........................................................................................................................--------..---..----.-..-....--.--..-S.Q..A...DE..YG.E..EQGD..........................................................SGNSKFRSYGYWTDENGTKVEGK...---..-IKFT..VRN...................VNTAGRMVSLDGTL-v.......................................................................................................................................................................................................................
A0A072P0F1_9EURO/242-374              .........................PEKGDEL.YGWT..NVTSEGFVGLVSYNYFQTA..V.G.G.S.R.........................I..PE......................D.WKWNG...........................................................................................................................PTKEEMKR..NKK..KGRK.A..KlvgyDQ.NT..RD.Q..D...QP..GD.E..EQYT..........................................................QYSYAGNDLGIFTDASGSTVDGT..lKFR..VVDTE..VVP..................gYARHKWSLQIDGTLL........................................................................................................................................................................................................................
A0A1E3NUQ8_WICAA/60-166               .........................PSVGDVV.EGLI..YMQSPSHIGLLINDTFNAS..I.K.K.N.F.........................I..PE......................N.WTFIP...........................................................................................................................--------..---..----.-..N....QA.DE..FE.E..N...NN..NN.E..DDQN..........................................................TGSKKFQSLGQWVDENEIPIDGK...---..-IKFT..IRR...................IHTSGRVVSVEGSL-i.......................................................................................................................................................................................................................
A0A0C9N5N9_9FUNG/126-243              .........................PKRGTKL.IGRI..NLQSEDHIGLLIYGTFNAS..I.P.K.S.R.........................I..PS......................S.-TYEW...........................................................................................................................-------K..INE..EEAV.E..E....AV.QE..AD.E..D...ED..AD.V..TEAV..........................................................AEERTRTHYGEWINKATGSSIGG...EDG..TLEFN..VMD...................IIEANDILTVTGSL-........................................................................................................................................................................................................................
V2X7I9_MONRO/121-237                  .........................PRVGMKL.EGKI..NLCSPDHISLLVHKTFNVS..I.P.R.H.H.........................I..PT......................D.-SYVF...........................................................................................................................--------..-EY..GPAE.N..D....PE.YG..AG.A..Q...DI..EG.E..AGKT..........................................................EESGGGGGGGRWIHHLTSSTLGA...PDG..TLEFT..VIG...................LTIANEMLSLLGSLQ........................................................................................................................................................................................................................
G3HDP5_CRIGR/5-112                    ......svyvmftsqlslmlygpiv-------.----..------------------K..V.P.R.G.L.........................F..PS......................H.AEWTFcqnvpatvapaaykhe..........................................................................................fqmyrtakllseyqgveV-------..EEE..EEEE.E..E....EE.EE..EE.E..E...EE..EE.E..EEEE..........................................................EEEEEEEE---------------...---..-----..---...................---------------rqklrq..................................................................................................................................................................................................................
A0A238FKJ7_9BASI/166-318              .........................PRVGQKI.VGSP..TLSTPSHVSLLLHNLFNAT..L.P.A.S.H.........................I..PS......................D.-EWRFdpdyvvpafirdr.................................................................................................qkmsfpttttttkVKEEEAEM.gAQG..EDGE.G..G....GE.RE..KE.L..A...QE..EE.A..RLAM..........................................................EEDEMYADRGWWVNLKTGEPMGG...QEG..SVQFT..IVS...................LTIANSMITVTGSLL........................................................................................................................................................................................................................
A0A2K5D818_AOTNA/125-268              .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWQTmqinmgdelefevfrldsdtagvf..........................................................................cirgklniaslqfkhsevseeiienGTEEAAEK.pTKK..KKKK.K..K....DP.ET..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------cevdsgtakiadfaddtpveesalqntnn...........................................................................................................................................................................................
A0A3R7LX78_PENVA/98-228               .........................PQIGNIL.EATV..KKKSINHVGCLVHGMFNVS..V.P.R.P.Q.........................E..EA......................V.ENWCGtcvqegdvvkltitdlnvtt...................................................................................yipyikgeldpdrvqelvdaRREEEEQK.aEAN..KKPS.G..K....TP.DA..VK.P..T...K-..--.-..----..........................................................-----------------------...---..-----..---...................---------------skkrkadedlnssrsskrkk....................................................................................................................................................................................................
A0A668UUI8_OREAU/141-285              .........................PQKGQKL.RGKV..NKLGISHVGCLVHGCFNAS..I.P.R.P.N.........................L..VS......................V.ETWRDagprigsevefdvtaldadtvgvll........................................................................irgrldktrvqellamcegtetsvpaGEEGTETS.vPAG..EEDP.E..P....TQ.DA..SE.E..T...PK..KK.K..KKKK..........................................................VKEEEIE----------------...---..-----..---...................---------------eeiptisa................................................................................................................................................................................................................
A0A067PZU0_9AGAM/141-263              .........................PYVGQKL.TGRV..NLCSPDHVSLLIHRTFNVS..I.P.R.H.H.........................I..PT......................D.-HWEF...........................................................................................................................---EYGPA..END..PEFG.P..H....AV.PE..GE.D..Q...NM..SD.A..HDDP..........................................................PNEHEMDGGGRWVHKITGDKMGG...VLG..DLEFT..VIG...................LTVANQMLSLLGSI-q.......................................................................................................................................................................................................................
A0A6J1WLW0_GALME/100-305              .........................PHVGATL.KGIV..NKKSPTHLGILVHRVFNVV..I.P.R.P.T.........................E.ePG......................N.-KWIGasvqegqeivfrivvldlygalpyirgelversiqlgpngddeeye..............................pkpaqpinvshvnfdktkpyhqkqigdgitqssksiqkssskivslsK-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------qqikisslssenstkqtnsklcpekskkvnsdisiteksktkrqsktlesdikqtesyskpskkhkkd....................................................................................................................................................
A0A7D8YZV8_9TREE/71-151               .........................PKVGQVL.YGTH..SLSSPSHISLLFAKTFNVS..I.P.L.N.H.........................I..PL......................G.-KYEF...........................................................................................................................--EHT---..---..--DS.P..D....ED.DE..SS.D..E...ED..D-.-..----..........................................................-----------------------...---..-----..---...................---------------gdmfgaspvhervsgtdntd....................................................................................................................................................................................................
A0A2V1CTZ6_9HELO/160-263              .........................PEKGAWL.EGYV..NLQNEGHLGLVCWNLFNAS..I.E.R.K.R.........................L..PS......................D.WKWKD...........................................................................................................................--------..---..----.-..-....--.--..--.V..S...DA..RE.G..WEGV..........................................................GETYAEEGMGYYVDGEGKKIEGM...VKL..RVREI..ESS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A6P7NYL6_BETSP/136-364              .........................PEKGHKL.LGRV..NKLGASHVGCLVHGCFNAS..I.P.K.P.N.........................L..VS......................V.DTWRVagprigaelefevtaldadtagvllirgrlertrvq..................................................elmamgessesvlaadepdapdpdpapeqteeppddtP-KKKKKK..KKD..KVKE.E..E....TD.IE..IA.-..-...--..--.-..---Alcqe.................................................hgdapDEVNGNEAVREKKKKKKEKRVKE...EER..EMEIE..VSP...................MEV------------hgsdssgyvsdkpskkrkhqsgsdatsgfseepeppkskkkrk.............................................................................................................................................................................
A0A4Y8D9L6_9HELO/159-265              .........................PEKGAWL.EGYI..NLQNEGHLGLVCWNLFNAS..I.E.R.A.R.........................L..PK......................E.WRWVG...........................................................................................................................--------..---..----.-..-....--.-V..ED.Q..E...KD..AE.A..EAEE..........................................................GATYAEDGIGYYVDGEGKKIEGT...VKF..RVKEI..ESN...................HDKERGFLTIDGTML........................................................................................................................................................................................................................
S0EEG3_GIBF5/284-397                  .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................D.WKWVP...........................................................................................................................--------..---..--NE.S..P....EA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWADGNGDKVKGK..iRFR..IRNFD..V-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
Q6FV17_CANGA/127-230                  .........................PQVGDIL.EGHI..FIQSASHIGILIHDAFNAS..I.K.K.N.N.........................I..PN......................D.WSFIH...........................................................................................................................--------..---..----.-..-....--.NE..DE.E..Q...EE..QQ.D..DENN..........................................................KNNYNNRSIGHWVNANGETIDGK...---..-IKFR..VRS...................VYTTGRVISVDGTLL........................................................................................................................................................................................................................
A0A1B8DZ63_9PEZI/162-259              .........................PTRGGWL.EGYV..NLQNEGHLGIVCWNLFNAS..I.E.R.Q.R.........................L..PK......................D.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.A..EDLE..........................................................GDGYAEDGVGYYVDRAGTKIEGI..vKFR..VKDIE..-SS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A672TNL6_STRHB/107-318              .........................PKKGRKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................V.AQWQElglkigdelkfqvlhldsdaaglffirggltesslkpkqsetitdstsg.........................getqkldhqenslndswgdhvteepldgtnntakenaeeqsvnavnelcD-------..---..----.-..N....KN.KK..KK.K..K...KK..HK.Q..E---..........................................................-----------------------...---..-----..---...................---------------eqehvlptsdssgyqsdhkkskkkkrkhcseveeselsqlsqepkakkakkkrd..................................................................................................................................................................
A0A061AP78_CYBFA/127-228              .........................PQVGDVL.EGHI..YMQSPSHIGLLVNDTFNAS..I.K.K.N.N.........................I..PE......................G.WSFVP...........................................................................................................................--------..---..----.-..-....--.--..NQ.A..D...EV..QA.D..EEEG..........................................................TETKKSKSLGQWYDESEIAVDGK...---..-LKFT..VKA...................IHNSGRVVSVEGSL-v.......................................................................................................................................................................................................................
A2QYA8_ASPNC/174-343                  .........................PQRGQIL.EGWV..NVQSEGFLGAIVLNLFSVG..I.E.R.K.R.........................L..PP......................S.WKWIP...........................................................................................................................PGEELEEE..QQE..QGQQ.A..S....TT.EN..EG.D..D...SD..SS.N..SETKksafdpakelfrpialaedv.................npladtdpaststnnnatgdyDDDETAAAEGYFQSVSGHRVRGT..iKFR..VVDVD..VIP..................gSERESGFLSIEGTML........................................................................................................................................................................................................................
A0A446U6Y9_TRITD/98-249               .........................PQPEMIL.EGKV..EMLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..PE......................T.FKFKRrghggkfisqsdkrhvikkgsmirfsvkrvdte.........................................................mnchitgslmaphtgcmrwlsvhdaeyaseisrG-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------krksrdhikseqivqdrstvnsedgmvnserrrksrkktve...............................................................................................................................................................................
A0A6P3EVH2_OCTDE/125-335              .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..SA......................E.-QWHTveinvgdelefevfrldsdaagvfcirgklninslqpkcfkisegaetvtegav...............eklpkkkkkkkkapetdevdisatelgdlvdvtpkeevdlqtsnnvnelceeepKKKKKKKK.kQQQ..DQDQ.D..P....VC.QG..SD.S..S...GY..QS.D..HKKK..........................................................KKKRKHSEE--------------...---..-----..---...................---------------aefspavecsptkkr.........................................................................................................................................................................................................
A0A2K6ABF5_MANLE/125-332              .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWLTmeinmgdelefevfrldsdaagvfcirg..................................................................klnitslqfkrsevseevtengteeaakkPKKKKKKK..DPE..TYEV.D..S....GT.TK..LA.D..D...AD..DT.P..MEES..........................................................ALQNTNNVNGLWEEEPKKKKRKK...---..-----..---...................---------------khqevqdqdpvfqgsdssgyqsdhkkkkkkrkhneeaeftpplkcspkrk......................................................................................................................................................................
A0A3M9YCZ6_9PEZI/284-401              .........................PKRGAWM.EGSI..NLESEGHVGVVCWGKFNAS..I.E.S.A.R.........................L..PP......................A.WRWVH...........................................................................................................................--------..-LG..TDET.A..A....TS.AH..DD.T..V...SN..FT.A..EEQH..........................................................GAVRQIHATGYWVDEAGQKVKGR..vRFR..IKAFD..V-G...................VSGDHGYLSLEGTML........................................................................................................................................................................................................................
A0A1V1TAT5_9FUNG/280-401              .........................PSRGAWL.EGLV..NIQSGGHIGVVCWGKFNAS..I.E.S.E.R.........................L..PR......................D.WQWID...........................................................................................................................-------Q..HSS..QSNG.E..A....EP.ES..TS.S..P...SP..LA.Q..GDTE..........................................................AGHAEVHATGYWVDGQGSKITAEt.pICF..RIKNY..EVG...................SSGDYGYLSIEGTML........................................................................................................................................................................................................................
A0A2H3JJF5_WOLCO/127-241              .........................PQVGMKL.IGKV..KLCSPDHIALLVHHTFNVS..I.P.R.H.H.........................I..PI......................D.-NWEF...........................................................................................................................--------..---..EYGP.A..E....ND.PE..FG.A..E...IT..GE.D..GQQA..........................................................DVASGIEGSGRWVHKLTGATLGG...EDG..YLEFT..VVG...................MTVANQMLSLLGSI-q.......................................................................................................................................................................................................................
A0A6P5B6J7_BOSIN/121-330              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................D.-QWQTlqinvgdelefevfrldsdaagvfcirgk.................................................................lsiaslqtkcstvpeeapetgadepvekpPKKKKKKK.kDRE..PCEV.E..G....GA.TE..PE.D..F...AE..VA.T..KDEA..........................................................DLHVSNSVNGLWEEEPKKKKKKK...KQE..H----..---...................---------------qdqepvfqgsdssgyqsdhtkkkkkrkseeaeftplverapkrkgr..........................................................................................................................................................................
S8AJT4_DACHA/163-284                  .........................PVVGMVL.EGWV..NNVSPSHVGMLYANVFSVA..V.T.S.A.G.........................I..PE......................G.WKFVP...........................................................................................................................-AKEN-EQ.nSEA..EADS.G..E....GD.AA..RR.K..G...KG..DK.K..DGTE..........................................................LIEGLTQAMGRWVNLEGKDVEGI...---..-QKFL..VTG...................VKTEGGMLSLEGSF-k.......................................................................................................................................................................................................................
A0A420YNT0_9PEZI/269-413              .........................PRRGAWM.EGTV..NLQSEGHVGVVCWNKFNAS..I.E.A.K.R.........................L..PA......................G.WQWIDttkng................................................................................................................avhtgsTGKNTKIT.fGDD..NEDE.S..A....DS.ED..AE.E..E...EP..EK.A..DTDVld.....................................................dapLQLAELHTTGYWVDASGERVTSAp.lRFR..IKNFD..V-G...................IAGDFGYISIEGTT-l.......................................................................................................................................................................................................................
A0A2R5G9P2_9STRA/115-260              ........................s--KGSRL.TGRI..NQVSAGHIGLLVFGAFPVS..I.I.R.E.R.........................L..QS......................K.YQFSGatgnyvsssdsedilapdvsvsfrvhavdtts..........................................................ptdwfiegtmadadlgpvresdlasrfadadadE-----AE.pSAK..KVKK.E..K....KV.KK..EK.K..A...KK..EK.K..AKKE..........................................................KKA--------------------...---..-----..---...................---------------kkekh...................................................................................................................................................................................................................
A0A1Y2I3I3_9FUNG/79-196               .........................PAVGSRI.RGVI..NKQSQTHIGLLVFNLFNVS..I.G.N.S.D.........................I..PS......................D.-QFVF...........................................................................................................................-------Q..ADA..GAGD.D..Q....QD.EA..AQ.V..A...DG..RH.D..NRFR..........................................................KARHANALTGNWVHTPTQTTLSV...-GT..DLEFV..VTE...................VVRSHDFINIKGSL-s.......................................................................................................................................................................................................................
A0A2K6DJH1_MACNE/125-291              .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWLTmeinmgdelefevfrldsdaagvfcirg..................................................................klnitslrfkrsevseevtengteeaakkPKKKKKKK..DPE..TYEV.D..S....GT.TK..LA.D..D...AD..DT.P..MEES..........................................................ALQNTNNVNGLWEEEPKKKKRKK...---..-----..---...................---------------khqevqdqd...............................................................................................................................................................................................................
A0A0M8N469_9HYPO/308-421              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................A.WKWVS...........................................................................................................................--------..---..--NE.D..P....EA.AG..ME.E..T...AS..VF.T..ADDH..........................................................GVTRQIHSTGFWVDGAGDKVKGK..iRFR..IRNFD..V-G...................ISGDTSYLSLEGTML........................................................................................................................................................................................................................
A0A015K8B6_RHIIW/130-234              .......................st---GYKL.FGRV..ANQSLSHIHLHLYDQFYVK..I.P.R.H.H.........................I..PL......................D.-VFLW...........................................................................................................................--------..---..----.-..-....--.KD..ND.E..F...YD..AM.F..LDKQ..........................................................LDLDRMYAEGQWVFSDTGATIEE...-DA..WLEFE..VTG...................ADTNNGQLYLIGSLL........................................................................................................................................................................................................................
A0A3Q7WDG2_URSAR/125-341              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PT......................E.-QWQNleinvgdelefevfrldsdaagvfcirgklnitslqtkcsavseevtetgtee................iiekplkkkkkkkkdpesyeiengnreladcadatmkketdlqidnvnslcnnePKKKKKKK..HQE..DQDQ.D..P....VF.QG..SD.S..S...GY..QS.D..HKKK..........................................................KKKRKHSEEAEF-----------...---..-----..---...................---------------tpllehspkrkgksnflqci....................................................................................................................................................................................................
A0A178ZYW5_9EURO/246-383              .........................PERGDEL.YGWT..NVSSEGFVGLVSYNYFQTA..I.G.K.T.R.........................I..PA......................E.WTWNGpsre...................................................................................................................qlqkNKKGRKGR.lRDE..NSLD.D..G....EE.HG..TQ.E..T...SI..TA.V..EAPS..........................................................SQPLLVDDGGYFTDASGTRIKST..lKFR..VADTE..IVP..................aHDRHKWSLQIDGTLL........................................................................................................................................................................................................................
A0A0E0A5L7_9ORYZ/81-231               .........................PKPDMML.EGKV..EMLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..HE......................K.FKFKRkkyggkfvsrsdkqhvikkgsmirfsvkrvdae.........................................................mnchvtgslipphtgsmlwlsvhdaeyaleinsGKRSRDIK.iKTE..QHEQ.D..H....SA.KS..SG.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------rkhksksrkridswelr.......................................................................................................................................................................................................
H2AVJ6_KAZAF/126-234                  .........................PQVDDVL.EGYI..FIQSASHIGLLIHDVFNAS..I.K.K.N.N.........................I..PF......................D.WTFVQ...........................................................................................................................--------..---..---N.E..E....TS.ED..VE.N..E...EA..DA.D..ETRA..........................................................STTGRSHSMGHWVDSNGERIDGK...---..-LKFT..VRS...................VFTTGRLVSIEGTLL........................................................................................................................................................................................................................
J3MBP0_ORYBR/163-318                  .........................PKPDMML.EGKV..EMLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..HK......................K.FKFKKkngrgkfvsrsdqqhvikkgsmiqfsvkrvdtemnch.................................................itgslipphtgsmlwlsvhdaeyaleinsrkssrdinI-------..---..-KIE.Q..H....EQ.DN..KT.V..N...DE..QG.V..KNSE..........................................................RKHKSKS----------------...---..-----..---...................---------------rkrnfeer................................................................................................................................................................................................................
W9CEX8_SCLBF/154-258                  .........................PEKGAWL.EGYI..NLQNEGHLGLVCWNLFNAS..I.E.R.A.R.........................L..PK......................E.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..-V.E..D...QE..QE.A..EAEE..........................................................GATYAEDGIGYYVDGEGKKIEGT...VKF..RVKEI..ESN...................HDKERGFLTIDGTML........................................................................................................................................................................................................................
RPA43_HUMAN/125-271                   .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWQTmeinmgdelefevfrldsdaagv.............................................................................fcirgklnitslqfkrsevseevT-------..---..---E.N..G....TE.EA..AK.K..P...KK..KK.K..KKDP..........................................................ETYEVDSG---------------...---..-----..---...................---------------ttkladdaddtpmeesalqntnnangiw............................................................................................................................................................................................
A0A3Q2D0P0_CYPVA/137-374              .........................PKKGQKL.LGKV..NKLGVSHVGCLVHGCFNAS..I.P.K.P.N.........................L..VS......................V.ETWRDagprigtelefkvtaldadsagvllirgqlqrtsvqelmalsenpes............................sfpagqqeprdaepapesqetepvpdltqqchedmpkkkkkkkkekikE-------..---..----.-..-....--.--..--.-..-...--..--.-..---Eeteeqitriapnklhll........................aapalngsaenansgdtPEKKKKKKKEKHVKEEEEEIE--...---..-----..---...................---------------vsgmesqssfsdkpskkrklesrtdpsddeitpkkskkkrks..............................................................................................................................................................................
A0A0A2JNP3_PENEN/156-295              .........................PKRGQTL.DGWV..NVQSEGFLGAVVFNLFSVG..V.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEAETP..ALT..DDDS.G..S....DK.DM..AD.F..D...AE..KE.C..FKPAtlsae...............................................eiaidgEEEDESAHTGYFQSVSGHRVNGS..vRFR..VVDVD..VIP..................gSERDRGFLSIEGTML........................................................................................................................................................................................................................
F0ZA80_DICPU/75-138                   .........................PFKNQIL.NGVV..KRVSTTHISLLVFGIISAS..I.H.K.T.C.........................I..PK......................T.FIFDHss......................................................................................................................nmfV-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------nkqskatisvgtki..........................................................................................................................................................................................................
A0A3F3Q987_9EURO/174-343              .........................PQRGQIL.EGWV..NVQSEGFLGAIVLNLFSVG..I.E.R.K.R.........................L..PP......................S.WKWIP...........................................................................................................................PGEELEEE..QQE..QGQQ.A..S....TT.EN..EG.D..D...SD..SS.N..SETKksafdpakelfrpialaedv.................npladtdpaststnnnatgdyDDDETAATEGYFQSVSGHRVRGT..iKFR..VVDVD..VIP..................gSERESGFLSIEGTML........................................................................................................................................................................................................................
A0A401SFF1_CHIPU/116-316              .........................PKIGQKL.MGIV..NKVAPSHLGCLVHGCFNAS..I.P.K.P.H.........................K..AN......................G.-TWPGfavtvgdslkfevlqldadvagvlcirg..................................................................qlhlrlqatcvdsegslqdntgeqndgivR-------..-KK..KKKK.K..K....DE.TC..DR.E..V...EE..TL.N..YEISeenchedqm........................................gstevildsKKHKKKKQKTAELDADTETHGRD...DSD..YF---..---...................---------------sdkavkkkkkkrklsvddselsgyaqkak...........................................................................................................................................................................................
A0A4X2K649_VOMUR/112-310              .........................PEKGQKL.VGTV..NKVAPSHLGCLVHGCFNAS..I.P.KpE.H.........................M..PM......................E.-QWQSlhfhvgdelefevsrldsdaagvfcirgklsvsrwvhlheaepgagaekpkksrk.............slkqppehcgptpaavpsdvagaaetspqaheavnglceerkhhreeleqdslwhA-------..---..----.-..-....-S.DS..SG.Y..Q...SD..HQ.K..KKRK..........................................................RKKHS------------------...---..-----..---...................---------------depegpegpqeprpkkkkkkeke.................................................................................................................................................................................................
A0A2K1QJ44_9PEZI/335-479              .........................PQRGVYL.QGVV..QVQNPSWLGLVCWNYFNAG..I.P.R.R.R.........................L..PQ......................S.WRWVDtarrkrv.............................................................................................................patadgeAMDVEAHE.gEEE..QEQE.Q..E....QE.QE..QE.L..A...EG..ED.G..MEVD.........................................................rEGVVVDATEGFWVDEAGRKVQGM..lEFR..LVDFE..SAP..................sTERERGFVSFTGTLL........................................................................................................................................................................................................................
A0A0L1JEQ6_ASPNO/188-336              .........................PQKGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEGSVN.gDQQ..KTAT.A..S....ED.DE..SE.P..S...-A..SF.D..QEKEhfnpvslanp......................................vsdtvneevnAEDDESVTEGYFQSVSGHRVRGT..vRFR..VVDVD..VIP..................gSERDRSFLSIEGTML........................................................................................................................................................................................................................
Q759A0_ASHGO/124-226                  .........................PHIGDVL.EGWI..FIQSASHIGLLIHDAFNAS..I.K.K.N.N.........................I..PD......................D.WTFIH...........................................................................................................................--------..---..----.-..-....--.-N..EE.S..T...NG..SS.E..NDSS..........................................................TGMRKARSLGHWVDGNGKQLDGK...---..-LKFT..VKN...................VYTAGRMVSLEGSLL........................................................................................................................................................................................................................
A0A117E499_ASPNG/179-358              .........................PQRGQIL.EGWV..NVQSEGFLGAIVLNLFSVG..I.E.R.K.R.........................L..PP......................S.WKWIPpgee..................................................................................................................leeeqQ-------..-QQ..QETS.T..T....SA.TE..KE.D..N...NN..DD.E..D--Sdssstsegqkkksafdpakelfrpia......laedvnpladtdptststnnnatgdyDDDETAAAEGYFQSVSGHRVRGT..iKFR..VVDVD..VIP..................gSERESGFLSIEGTML........................................................................................................................................................................................................................
E1ZDH2_CHLVA/81-127                   .........................PKAGMRL.VGMV..NKVGADYIGVLLLGFINVS..I.A.A.D.Q.........................I..RA......................E.F----...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------rprpmer.................................................................................................................................................................................................................
A0A3Q7P587_CALUR/125-333              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PV......................E.-QWQNleinvgdelefevfrldsdaagvfcirgk................................................................lnttslqtkcsavsegvtetgteeiiekplKKKKKKKQ..---..----.-..-....-T.DP..ES.Y..E...VE..SD.N..REPAaradatvree.....................................talqggdvdglWRAESKQQQRHWEDQGQDP----...---..-----..---...................---------------vfqgsdssgyqsdrkkkkkkrkhseeaeftplvehspkkkre..............................................................................................................................................................................
A0A4W6EWY7_LATCA/121-324              .........................PKKGQKL.LGKV..NKLGVSHVGCLVHGCFNAS..I.P.K.P.N.........................L..VS......................V.ETWRDagprigaelefevtaldadaagvllirgrldrtrqvch...............................................gaepnpetteespgdtpkkkkkkkkdkikeeeredevmP-------..---..----.-..-....--.--..--.-..-...--..--.-..---Scqqnssttpelngttd.........................eangneageekkkkkkkKKEKGVKEEQEE-----------...---..-----..---...................---------------velspmevhgsdssgyvsdkpskkrkhetgsdvtsgf...................................................................................................................................................................................
A0A091F368_CORBR/41-249               .........................PKKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................I.VQWQElglkigdelkfqvlhldsdaagvffirggltkssmrpkksd.........................................tvtestngdkiqklghqenslnncgedtvteeplnetdnlgRENEEEQS.vDAV..NGLC.D..D....KN.KK..KK.K..K...KK..DK.Q..EEQE..........................................................L----------------------...---..-----..---...................---------------vlpasdssgyqsdhkkskkkkrkhcdeveenelsqmsekpkakkkrd.........................................................................................................................................................................
A0A5C6NF67_9TELE/141-358              .........................PRKGQKL.LGKV..NKLGVSHVGCLVHGCFNAS..I.P.K.P.N.........................L.vPM......................E.-TWRDagprigaelefevtaldadtvgvllirgrldrtrvqell............................................aigetsessitvdqpnpsdteangelnldptdectvkkkkK------K.kNKI..KEET.E..E....VT.DS..SC.I..Q...PD..AS.A..TELK..........................................................RAVNDESGTGEKKKKRKKEKH--...---..-----..---...................---------------lkpeevkdeevqvsvmevhgsdsgyqsdkphkkrkhepaaditss...........................................................................................................................................................................
A0A4W6ETK7_LATCA/126-329              .........................PKKGQKL.LGKV..NKLGVSHVGCLVHGCFNAS..I.P.K.P.N.........................L..VS......................V.ETWRDagprigaelefevtaldadaagvllirgrldrtrqvc................................................haepnpetteespgdtpkkkkkkkkdkikeeeredevmP-------..---..----.-..-....--.--..--.-..-...--..--.-..---Scqqnssttpelngttd.........................eangneageekkkkkkkKKEKGVKEEQE------------...---..-----..---...................---------------evelspmevhgsdssgyvsdkpskkrkhetgsdvtsgfs.................................................................................................................................................................................
G3T2G1_LOXAF/125-330                  .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................E.-QWQTleinlgdelefevfrldsdaagvfcirgklnttslqakcseiseevtetite..................eavekplkrkkkrkkdletyevkdgtaelldvttkeetvlqtnnnvdglweeePKKKKKKR.kHQE..DQDQ.D..P....VF.QG..SD.S..S...GY..QS.D..HKKK..........................................................KKKR-------------------...---..-----..---...................---------------khseeaeltpilehspkk......................................................................................................................................................................................................
A0A6J0ZED4_ODOVR/121-262              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHKCFNAS..I.P.KpE.Q.........................M..PA......................D.-QWQTlqinvgdelefevfrldsdaagvfcirgk.................................................................lsmaslqtkcsavpekapetgadepvekpP-------..---..-KKK.K..K....KK.K-..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------dlepceaegsttepaefadvtmkdetdlqmh.........................................................................................................................................................................................
A0A1E3NM78_9ASCO/101-196              .........................PRVGDVL.EGYS..IMQSQSHIGLLINDVFSAS..I.K.K.F.Y.........................I..PE......................D.WYFVP...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..NQ.A..DETS..........................................................TDENNFKRLGHWCDSNEVPVGGK...---..-IKFT..VRG...................IHVNGKGLSIEGTLL........................................................................................................................................................................................................................
A8N6U3_COPC7/119-245                  .........................PKIGSKM.KGRI..ILSSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..PS......................D.-EWEF...........................................................................................................................EYGPAEND.pEFG..ADAA.D..E....EG.QA..EG.E..T...EG..VK.E..GEEQ..........................................................PVKTEEASTGKWVHRTTGERLGG...TDK..KVEFT..VIG...................LTVANEMLSLVGSI-q.......................................................................................................................................................................................................................
M3D922_SPHMS/122-193                  .........................PAPGTYL.KGEV..NLQNEGIFGLIFMNYFTVS..I.P.S.E.N.........................M..PK......................D.WSWQG...........................................................................................................................DQWVNAQ-..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------gevekevickvddfepsgegs...................................................................................................................................................................................................
A7RZD8_NEMVE/84-124                   .........................PEIGNKL.IGVV..NKFGYDHIGCLVHGCFNAS..I.A.K.S.R.........................-..--......................-.-----...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------tsngly..................................................................................................................................................................................................................
A0A087VPX4_BALRE/41-248               .........................PKKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................I.VQWQElglkigdelkfqvlhldsdaagvffirggltkssmqpkqseavtgsanade....................iqkldhpenglndsggdnvteeplgetgntgrenaeeqsvdpvnglcdddksK-KKKKKK.kHKQ..EQQE.H..A....LP.TS..DS.S..-...--..--.-..----..........................................................---------GY------------...---..-----..---...................---------------qsdhkkskkkkkhcdevedselsqlsqepkakkkr.....................................................................................................................................................................................
A0A166FCW1_9AGAM/100-227              .........................PRIGSKL.VGKV..SLASPDHLGLILHSTFNAS..I.P.R.Q.H.........................I..RT......................DeWEFEY...........................................................................................................................GPAENDPE..FGQ..SVSW.K..T....DE.QT..VI.P..D...GE..QA.E..AEGE..........................................................AEAEEPQQTGKWIRITDGESIGG...EEG..LVEFT..VIG...................YTIANQMLSLIGSLL........................................................................................................................................................................................................................
M3JSR8_CANMX/125-218                  .........................PEVGDVL.EGDV..YMQTPSHIGLLINDTFNAS..I.K.K.Y.N.........................I..PS......................S.WSFQS...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.N..QVDE..........................................................VGEDNKKNYGHWVDDYQSKIEGK...---..-LQFT..IKA...................IHTTGRVVSVEGTL-i.......................................................................................................................................................................................................................
A0A2T3A1Y5_9PEZI/101-151              .........................PSRGAWM.EGEI..NLQSEGHIGVVCFEKFNAS..I.S.R.K.S.........................L..PK......................G.WQFVE...........................................................................................................................QEEEE---..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------dt......................................................................................................................................................................................................................
A0A3Q7RSG9_VULVU/121-335              .........................PEPGKKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..ST......................E.-QWQIleinvgdelefevfrldsdaagvfcirgklnitslqtkcsavpeeite..........................tsteeiiekplkkkkkkkdlesyevesdnreladvtdatmkqetdlqidN-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-------MNGLWKDEPKKKKKKK...KK-..-----..---...................---------------qqqqqqqqdqdqdpvfqgsdssgyqsdhkkkkkkrkyseeaeftpllehspkkkr.................................................................................................................................................................
F1PS84_CANLF/121-332                  .........................PEPGKKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..ST......................E.-QWQIleinvgdelefevfrldsdaagvfcirgk................................................................lnitslqtkcsavpeeitvtsteeiiekplK---KKKK.kKDP..ESYE.V..E....SD.NR..EL.A..D...VT..DA.T..MKKE..........................................................TDPQIDNMNGLWKDEPKKKKKKK..qQQ-..-----..---...................---------------qdqdqdpvfqgsdssgyqsdhkkkkkkrkyseeaeftpllehspkrkgesn.....................................................................................................................................................................
M4B8Q8_HYAAE/83-261                   .........................PRKGMEL.RGIV..NKIGSNHVGMLFAGVFNGS..V.A.E.A.E.........................L..PK......................G.YVHNYaqdcwlgedgssisvadevdvkvlryrpiedaskehsdvvatdlidnt...........................tqlhafprteherisqyftvdkrhfihnsavrsiqlhvtxxxxkdmdaV-------..KEK..RSKK.R..K....HK.EE..TM.K..K...PS..KH.K..VKDA..........................................................GKKER------------------...---..-----..---...................---------------hkkskhd.................................................................................................................................................................................................................
A0A151GAC9_9HYPO/283-396              .........................PSRGAWM.EGSI..NLQTEGHVGVVCYGKFNAS..V.E.A.R.R.........................L..PP......................S.WRWVS...........................................................................................................................--------..---..--NE.S..A....DA.RG..FE.E..T...AS..VM.T..SDDH..........................................................GVARQIHSTGFWTDGAGDKVKGK..iRFR..IRNFD..A-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
K8ELI5_9CHLO/111-275                  .........................PKVKAVL.IGKV..NKIGQDHIGLVVGNIFNAS..I.P.I.E.N.........................F..KE......................N.MMFDEtkeaweiiedgtemleeeeedlsdksesmsmkeikvga..............................................rvkfrvervnreddrvvlligsllgkgcgpvdrgstsnsE--ERSDN.dEDE..DVEA.D..D....DA.GD..GA.E..D...EE..EA.E..RDKK..........................................................RNKKEK-----------------...---..-----..---...................---------------kekke...................................................................................................................................................................................................................
G7MLQ6_MACMU/125-290                  .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWLTmeinmgdelefevfrldsdaagvfcirg..................................................................klnitslrfkrsevseevtengteeaakkPKKKKKKK..DPE..TYEV.D..S....GT.TK..LA.D..D...AD..DT.P..MEES..........................................................ALQNTNNVNGLWEEEPKKKKRK-...---..-----..---...................---------------kkhqevqdq...............................................................................................................................................................................................................
D5GKX5_TUBMM/154-254                  .........................PVRGMLL.KGWV..NMAGASHVGLLVENTWNVA..I.P.R.E.R.........................I..PE......................S.WSWVE...........................................................................................................................--------..---..----.-..-....--.--..-E.V..G...ME..VN.G..EGAA..........................................................VGEGAGVNGGYWVDGDGKKIEAF...---..-RKFK..IEA...................VKAMGHMVSMEGSLL........................................................................................................................................................................................................................
A0A3M2T1Y4_9EURO/175-320              .........................PQRGHVL.DGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PT......................D.WRWIP...........................................................................................................................PGEEA---..---..--DK.A..D....TS.AA..TS.D..D...ES..QG.S..PAFDplkehfspvtla.................................sdenpladamqdaAGDEASAAEGSFRSVSGHRVRGT..vRFR..VVDVD..VIP..................gTDRDRGFLSIEGSML........................................................................................................................................................................................................................
A0A093GRP6_DRYPU/100-305              .........................PKKGRKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................I.VQWQElglkigdelkfqvlhldsdaagvffirggltktsmkpkksetitgs...............................tnggeiqkldhqangcnnsendnvteepvgemgdpgkenaegqnvdA-------..---..ATGS.C..D....DK.IK..KK.K..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------kkkhkreeqehvlptsdssgyqsdhkkskkkkrkhcdeveeselsqlsqepkakkk................................................................................................................................................................
A0A5C3MIX0_9AGAR/121-238              .........................PHVGMKL.VGKV..NLCSPDHVSLLVHRTFNVS..I.P.R.H.H.........................I..PS......................D.-TWEF...........................................................................................................................--------..EYG..PAEN.D..P....EF.AP..DA.L..N...DV..DA.G..TSDT..........................................................KEKQEEESGGKWVHKLTGQKLGD...TDG..QLEFT..VIG...................LTVANEMLSLLGSI-q.......................................................................................................................................................................................................................
A0A0A1T3C6_9HYPO/259-372              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PR......................G.WKWIS...........................................................................................................................--------..---..--ND.D..P....EA.EG..IE.E..T...GS..VI.A..PDEH..........................................................GVVRQINSTGFWVDDNGDKVKGK..lRFR..IRNFD..V-G...................VSGETTYLSLEGTML........................................................................................................................................................................................................................
A0A177VIX9_9BASI/186-301              .........................PSIGMRL.EGKI..VYSNTDVVSLLLNGTFNAA..I.P.A.A.H.........................L..PP......................N.-QYEF...........................................................................................................................--------..--V..QNEY.N..H....GA.AA..AH.S..A...DG..GG.G..GEGG..........................................................EEDFGAHSPGFWRRKRDQAPLGG...SSG..RLTFT..CFG...................ITVANQLLFLRGSLL........................................................................................................................................................................................................................
RPA43_DANRE/133-388                   .........................PKNGSRL.MGVI..NKMGASHVGCLVHGCFNAS..V.M.K.P.N........................aL..TS......................D.-QWRDsglcvgqslefevfqldadaagvl..........................................................................lirgrldrsrvqelvaqfeqkqvtaE-------..SST..EADA.T..E....DT.TD..SP.K..P...KK..KK.K..RKKD..........................................................KNDTESSMEECVNNSSLQETSEH...---..-----..---...................---------------hqttteedcsangrhkekkkkkkrdkndtessmdecmnnnslqetaldtteedcnanerhkekkkkkkrdkqqdsaeivptsdssgyisdktsrkraleagddtetpaakkkk.......................................................................................................
B6QUX9_TALMQ/170-340                  .........................PQKGQVL.EGWI..NVQSEGFVGAIVHNLFSVG..I.E.R.K.R.........................L..PK......................S.WKWVP..........................................................................................................................pGADEDESN.tASD..KKKG.Y..V....SA.TS..GD.E..D...GS..SG.S..NKVAfdaekehftplpkkvsrqpi..................nlldsdtnmlgeefgeyddeEDDEASNATGYFQSVSGHRVRGT..iRFR..VRDVD..VIP..................gADPDRGFLSIEGTML........................................................................................................................................................................................................................
A0A2Y9JM54_ENHLU/125-333              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.H.........................M..PA......................E.-QWQNleinvgdelefevfrldsdaagvfcirgklnitslqtkcsgvse...................................erteagpeeiiekplkkkkkkkkdpesyevesgnreladyadatM-------..---..----.-..-....--.--..--.-..-...--..--.-..---N..........................................................KETDLQIDNDLWKDEPKKKKKKK...HQ-..-----..---...................---------------edqdqdpvfqgsdssgyqsdhkkkkkkrkhseeveftpllehspkkkrek......................................................................................................................................................................
A0A453KK92_AEGTS/81-150               .........................PQPEMIL.EGKV..EMLGKESIHAIVLGVFSAA..I.M.A.D.D.........................I..PE......................M.FKFKRrgh....................................................................................................................ggkfI-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------sqsdkrhvikkgsmirfs......................................................................................................................................................................................................
A0A225ASV1_9EURO/184-355              .........................PQKGQIL.DGWV..NVQSEGFLGAIAYNLFSVG..I.E.R.K.R.........................V..PK......................S.WKWIPpga.....................................................................................................................ngdEDEDDDTA.sVSS..KNRK.K..G....YV.SA..TS.G..D...ED..SG.N..KKDNkldfnpekelftplpkav......................trkpiptdntledgqdddEDEDDPNTTGYFQSVSGHRVRGT..iRFR..VRDVD..VIP..................gADPDRGFLSIEGTML........................................................................................................................................................................................................................
G2XUM9_BOTF4/159-265                  .........................PEKGAWL.EGYI..NLQNEGHLGLVCWNLFNAS..I.E.R.A.R.........................L..PK......................E.WRWVG...........................................................................................................................--------..---..----.-..-....--.-V..ED.Q..E...KD..AE.A..EAEE..........................................................GATYAEDGIGYYVDGEGKKIEGT...VKF..RVKEI..ESN...................HDKERGFLTIDGTML........................................................................................................................................................................................................................
A0A428PCN7_9HYPO/299-412              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................D.WKWVP...........................................................................................................................--------..---..--NE.S..P....EA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWADGSGEKVKGK..iRFR..IRNFD..V-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
A0A395MKV6_9HYPO/262-375              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................D.WKWVP...........................................................................................................................--------..---..--NE.S..P....EA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWADGNGDKVKGK..iRFR..IRNFD..V-G...................TSGDISYLSLEGTML........................................................................................................................................................................................................................
G9PC89_HYPAI/120-233                  .........................PSRGAWM.EGSI..NLQTEGHIGVVCFGQFNAS..I.E.A.R.R.........................L..PS......................A.WKWVS...........................................................................................................................--------..---..--NE.D..P....EA.FG..ME.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWVDGSGNKVKGK..iRFR..IRNFD..V-G...................VSGETSYLSLEGTML........................................................................................................................................................................................................................
A0A453KK97_AEGTS/125-190              .........................PQPEMIL.EGKV..EMLGKESIHAIVLGVFSAA..I.M.A.D.D.........................I..PE......................M.FKFKRrgh....................................................................................................................ggkfI-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------sqsdkrhvikkgsm..........................................................................................................................................................................................................
A0A2K6MTI5_RHIBE/125-286              .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWLTmeinmgdelefevfrlds......................................................................................daagvfcirgklnitslqfK-----SS.eVSE..EVTE.N..G....TE.EA..AK.K..P...KK..KK.K..KKDP..........................................................ETYEVDSGTTKLADDAGDTPM--...---..-----..---...................---------------eesalqntnnvnglweeepkkkkrkkkhqe..........................................................................................................................................................................................
A0A4Q2D1X9_9AGAR/124-240              .........................PHIGMKL.KGRI..NLSSPDHISLLLHRTFNVS..I.P.R.H.H.........................I..PS......................N.-EWEF...........................................................................................................................--------..-EY..GPAE.N..D....PE.YA..EQ.A..E...AE..EG.Q..AEGE..........................................................ESSDHDSGNGRWVSRSTGERLGG...PDG..KLEFT..VIG...................LTVANEMLSLVGSI-q.......................................................................................................................................................................................................................
I6NCP6_ERECY/130-233                  .........................PQIGDIV.EGWI..FIQSASHIGLLIHDAFNAS..I.K.K.N.S.........................I..PN......................N.WTFIH...........................................................................................................................--------..---..----.-..-....--.TD..ES.G..S...TM..GE.N..GQDS..........................................................IGVKRSRSLGHWVDSNGKQIDGK...---..-LKFT..IKK...................VYTTGRMVSLEGSLL........................................................................................................................................................................................................................
R4XDG9_TAPDE/165-262                  .........................PRRDEVV.QGRV..TFQGPSHIGFLLLGTFNAS..V.P.V.H.L.........................I..PP......................S.WSFHH...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..HH.H..HYAA..........................................................AEDGARDGEGHWVSHDGQTLSLN...--Q..ILPLR..TVG...................VKKGANILSVEGSLL........................................................................................................................................................................................................................
A0A0C3HBW3_9PEZI/162-262              .........................PERGAWL.EGYI..NLQSPGHVGVVCWNLFNAS..I.K.R.N.S.........................L..PE......................S.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...-V..DE.L..SAEG..........................................................GELYAEDGHGYYVDGEGNKVEGM..iKFK..VREIE..S-S...................HDRETGFLSIEGTML........................................................................................................................................................................................................................
A0A7E6CHY3_9CHIR/125-438              .........................PEPGQKL.LGAV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.H.........................M..PA......................E.-QWQGleinvgdelefevfrldsdaagvfc.........................................................................irgklnitslqakcsavseevteagP------E.eVFE..KPLK.K..K....KK.KK..KD.P..E...PD..EG.A..GGTTep.....................................................adfAGVPVTEETDPWVN---------...---..-----..---...................---------------ssvngfwdgepkkkkkkkkkdpepgegaggttepadfagvpeteetdpqvnssvnglwdgeprkkkkkkkkkdpepsegaggttepadsagvpmteetdpqvnssvnglwdgepgkkkkeqhqedqdqdpvfpasdssgyqsdhkkkkkkrkhseeaeftpllehsprkkrk............................................
A0A6P5LJ56_PHACI/110-324              .........................PEKGQKL.VGVV..NKVAPSHLGCLVHGCFNAS..I.P.KpE.H.........................M..PM......................E.-QWQSlhfhlgdelefevsrldsdaagvfcirgkllvsslppalpkgsgdigneaepgaggekpkkksrkslkqphedcgptpaavpsdvagaaetspqaletenglpeeqepqrkkqhhrekleqdpL-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------whasdssgyqsdhqkkkrkrkrhsdepegpeapeeprpkkkkkkeke.........................................................................................................................................................................
A0A1L8FVY7_XENLA/122-464              .........................PDCGQTL.VGIV..NKVAPTHIGCLVHGCFNAS..I.P.K.PpK.........................M..PI......................E.-NWLRigvkiddeiefevfr.............................................................................................ldsdaigvfcirgrlDESMEAKA.yETS..CEET.A..E....QT.DG..GT.S..D...KD..AD.A..LENS..........................................................NMESSIQTNGDVQDKSKKKHKKQ...K--..-----..---...................---------------lresltqeaestgdnsivadpdlenpvelnvetpkkerkkkkhknvlgqnsesdaekgldstsfeesintespviltetkpkkskkkgkeilhsndtasgflngvvenesfsespalepeemtasggvpdkfkkkhkrsnveqnpnsnlvscvsseeslteglavsqetpkakkhkskhqehllpgssqskhktakrqheeddqdilale......
A0A1L9VJ41_ASPGL/169-317              .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PT......................T.WKWIP...........................................................................................................................PGEEAPTT..NKT..DDES.E..S....DT.PT..KN.F..D...PE..KE.H..FTPVslasdanpls......................................ettpnpalegETEEDESAEGYFQSVSGHRVRGT..vRFR..VLDVD..VIP..................gTDRERGFMSIEGSML........................................................................................................................................................................................................................
G5BZJ2_HETGA/125-324                  .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..SA......................E.-QWHTvevnvgdelefevfrldsdaagvfcirgklsitslqskcfeiseevaetvtkea...............vekipkkkkkkkkapeidemdvsvteladiidvtpkeeedlqisnnvndlweeeP-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------kkkkkkkkhqeyqdqdpvfqgsdssgyqsdhkkkkkkrkhgeeaelt.........................................................................................................................................................................
A0A167PLD9_CALVF/139-239              .........................PRIGMRL.RGSV..SLCGPDHVGLILEKTWNCS..V.P.K.W.G.........................I.dEL......................V.WEYVP...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..GA.R..EEEG..........................................................GEGEEGVDSGWWKTKMSGDPLGR...ERK..TVDFT..VVG...................MTIANQMLSLTGSLL........................................................................................................................................................................................................................
A0A0C9Y685_9AGAR/127-244              .....................tcdn-----LL.VGKV..NLCSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..PT......................D.-EWDF...........................................................................................................................---EYGP-..-AE..--ND.P..E....YG.QS..AQ.E..N...KD..EM.V..ADDI..........................................................TKKQNSDGGGKWVRRITGHRIGN...KDG..FLEFT..VVG...................LTVANEMLSLLGSI-q.......................................................................................................................................................................................................................
A0A4Z0Y9E1_9PEZI/251-366              ......................vsf-------.-GLV..NIQSGGHIGVVCWNKFNAS..I.E.S.E.R.........................L..PR......................D.WRWVD...........................................................................................................................--------..QHS..SKRT.S..E....AE.AE..TT.S..P...SP..EA.Q..DDTE..........................................................ADHTEVHATGYWVDGQGSKITAEs.pICF..RIKNY..EVG...................SSGDYGYLSIEGTML........................................................................................................................................................................................................................
A0A1G4MCB2_LACFM/125-225              .........................PQIGDII.EGWI..FIQSPSHIGLLIHDAFNAS..I.K.K.N.N.........................I..PS......................E.WTFVQ...........................................................................................................................--------..---..----.-..-....--.--..-N.E..D...TE..NI.S..ENSE..........................................................NGSTKARSLGHWVDENGQSLDGK...---..-LKFT..VRN...................VYTTGKVVSLEGTL-s.......................................................................................................................................................................................................................
A0A1B8F7G8_9PEZI/164-261              .........................PTRGGWL.EGYV..NLQNEGHLGIVCWNLFNAS..I.E.R.Q.R.........................L..PK......................D.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.A..EDLE..........................................................GEGYAEDGVGYYVDGAGVKIEGI..vKFR..VKDIE..-SS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
J3K430_COCIM/186-319                  .........................PERGQTL.EGWI..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PP......................D.WKWVApg.......................................................................................................................qqPESTPTMT.qDED..DSDT.N..S....DT.EN..FR.P..L...KG..DK.H..IPDE..........................................................HDDEASAAMGYFQTRSGKRVRGM..iKFR..VRDVD..VIP..................gSEWDKGFLSLEGTML........................................................................................................................................................................................................................
A0A1Y2AJ81_9TREE/71-181               .........................PKIGQRL.YGTH..SLSSPSHLSLLFSKTFNIS..I.P.L.Q.H.........................I..PL......................D.-QYEF...........................................................................................................................--------..---..----.E..A....TD.PV..DG.D..D...DS..DS.E..NSDD..........................................................DDEDGVHEVGRWKRKKDGKLLGQ...GGK..GIKFT..VIG...................MQVSNQMLSLTGSLL........................................................................................................................................................................................................................
A0A452FW74_CAPHI/121-331              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHRCFNAS..I.P.KpE.Q.........................M..PA......................D.-QWQTlqinvgdelefevfrldsdaagvfcirgklsitslqtkcsavpeeapetgvdepve..........kppkkkkkkkkdlepcevqggstepaeladatmkdetdlhvsnsvnglweeeppkkkKKKKRKHQ.eDQD..QEPV.Y..Q....GS.DS..SG.Y..Q...SD..HT.K..KKKK..........................................................RK---------------------...---..-----..---...................---------------reeaestplverapkkk.......................................................................................................................................................................................................
A0A5N5WVS0_9EURO/185-336              .........................PRRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGDEGSVN.gDQQ..RKIP.A..S....TT.AS..ED.E..S...ES..SV.S..F--Dperehfnpvsla..................................npisdtlneeanAEDDDSSAEGYFQSVSGHRVRGT..vRFR..VVDVD..VIP..................gSERDRSFLSIEGTML........................................................................................................................................................................................................................
A0A176WED0_MARPO/82-338               .........................PSPGMLI.EGKV..NKIEKDYIGVVVLGLFNAA..I.G.V.S.D.........................I..RE......................D.LYYDEnpqgrawvsesderhsirlgstirfavksl...............................................................qetehiidlcgsladpktgcvnwielpsltPRKKSKSK.sAED..RSTH.D..A....DR.KH..KT.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------pkkeklllksegssdandvgtalktpkeehgvhnsyetphsndvarkvktpkserdhansfetpdvykkkkrghvleepikpmvidlepdvmptpstssghkhkkrkeaesvqtpdgvhhkkkkkrrdv.......................................................................................
A0A3P8VL67_CYNSE/141-371              .........................PTKGQKL.LGKV..NKLGISHVGCLVHGCFNAS..I.P.K.P.N.........................L..VS......................V.ETWRVagprigselefevmaldadnvgvllvrg..................................................................rldktrvqeliameensqmcvsteqpeaaD-------..TDS..KPEP.T..E....DQ.ET..SK.K..K...NK..EE.V..NENDaspplqpegadts...............................qpngtineeisnkgKKKKKKKKEKCL-----------...---..-----..---...................---------------keeeeeeaevttmdvhgsdssgyisdkpskkrkhenssdvtshvdeesetpkskkkkrksviel........................................................................................................................................................
A0A1S9DIP4_ASPOZ/188-336              .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEGSVS.gDQQ..KTAT.T..S....ED.DE..SE.P..S...AS..FD.Q..EKEHfnpvslanp.......................................vsdtlneeanAEDDESAAEGYFQSVSGHRVRGT..vRFR..VVDVD..VIP..................gSERDRSFLSIEGTML........................................................................................................................................................................................................................
W7HNZ1_9PEZI/154-257                  .........................PAVGMLL.EGYV..NDVSPSHVGMLYGNVFSVA..V.K.A.G.G.........................I..PG......................G.WQWSP...........................................................................................................................--------..---..----.-..-....--.NV..NA.H..V...GR..KG.A..DEGE..........................................................GGVVVDSVMGRWIDADGEEVAGL...---..-QRFV..VTA...................VKAEGGLLSLEGSF-k.......................................................................................................................................................................................................................
A0A226N606_CALSU/114-335              .........................PKKGKKM.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.KpE.H.........................M..SV......................A.-EWQElgfkvgdelkfravhldsdaagvffirgqltktrcfcfslppvfpysmqpk.....................qsetvtdavtdgtngeqiqnfdneknglndsggdnvtedllggtdntgggnTEEQSIDA.vNET..CDDK.K..K....KK.KK..KR.K..Q...EE..QE.-..----..........................................................-----------------------...---..-----..---...................---------------hvlpvsdssgyqsdlkkskkkkrkhceveeselselsqkpkakkkr..........................................................................................................................................................................
A1D987_NEOFI/180-339                  .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................D.WKWVP...........................................................................................................................PGEEEEEN.gFNS..SEKP.K..K....KV.FS..ST.E..D...ED..DS.E..PSSHfdpemehfkpislas............................nanpfsetmdlnngsADDDESAAEGYFQSVSGHRVRGT..vRFR..VVDID..VIP..................gSDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A0D9RM70_CHLSB/125-291              .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWLTmeinmgdelefevfrldsdaagvfcirg..................................................................klnitslqfkrsevseevtengteeaakkPKKKKKKK..DPE..TYEV.D..S....GT.TK..LA.D..D...AD..DT.P..MEES..........................................................ALQNTNNVNGLWEEEPKKKKRKK...---..-----..---...................---------------khqevqdqd...............................................................................................................................................................................................................
A0A286Y4L5_CAVPO/125-326              .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..ST......................E.-QWHTveinvgdelefevfrldsdaagvfcirgklniaslqskcigmseevaetvtdea..............vekilkkkkkkkkapetdevdvsiteltdledvtpkeeadlqisnpvndlceeepKKKKKKKK.kQQE..YQD-.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------qdpvlqgsdssgyqsdhkkkkkkrkhseeaelsp......................................................................................................................................................................................
A0A0W8CL96_PHYNI/83-269               .........................PKEGMML.RGVV..NKIGSNHVGMLFAGVFNGS..V.A.E.A.E.........................L..PK......................G.YVHNYaqdcwlgedgssisvedevevkvlrvhvaggmiaie...................................................atmrfdaagvakstapkkvkktshlnlaagepvtkpIKEKKTKK.tKKV..DEAE.D..K....QE.KK..SK.K..R...KH..EK.P..DEEV..........................................................VEEEPVEAEEVKVKSKKHK----...---..-----..---...................---------------hkdkdakkkkhkktkhd.......................................................................................................................................................................................................
A0A2T2P6K5_CORCC/122-231              .........................PRRNAWI.EARI..TGMSETHVSLSHLNTFPVA..I.L.R.A.H.........................L..PQ......................A.WTWHS...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...ES..AN.Q..KTKG..........................................................WDGRIVDLGGWWEDENGAPVGGA..dGNG..ELKVR..IRDfdg............rmdgKGKGRSVLRIEGSLL........................................................................................................................................................................................................................
A0A4S4LTB0_9AGAM/142-259              ................mgmklvida-------.----..-----YHISLLVHRTFNVS..I.P.R.H.H.........................I..PT......................D.-QWEFey.......................................................................................................................gpA-ENDPEFgaIAA..EKDA.V..A....DI.TE..DN.A..A...GG..GA.E..EGEG..........................................................GASQNVDRGGRWIHKVTGDQLGG...EDG..RLEFT..SH-...................---------------tqshhagars..............................................................................................................................................................................................................
A0A0C9M1U3_9FUNG/213-318              .........................PKRGSYV.SGTV..RVQNPSWLGLVCWNYFNAG..I.P.R.R.R.........................L..PP......................S.WTWVE...........................................................................................................................--------..---..----.-..-....--.--..--.A..D...AE..AQ.P..QDDE..........................................................AEDAQAGADGYWADENGQKVQGS..iTFR..LRDFE..SAP..................tTERDRGFVSLEGTML........................................................................................................................................................................................................................
A0A4S4LEZ3_9AGAM/130-263              .........................PQIGMKL.NGKI..NLCSPDHVSLLVHQTFNVS..I.P.R.H.H.........................I..PI......................D.-SWEFehgp...................................................................................................................aendPEFGPNIS..GID..ISEE.V..K....TT.VD..AD.A..M...DT..DG.K..AIVE..........................................................RDPSTAESIGSWVHRITNDKLGG...PDG..NLEFT..VIG...................LTVANQMLSLVASI-q.......................................................................................................................................................................................................................
A0A0E9NGD8_SAICN/141-190              .........................PERGGKL.EGYV..NLQSPDHIGLLVHGIFNAA..I.S.R.K.K.........................I..PK......................N.WSFNE...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------dfetge..................................................................................................................................................................................................................
A0A0D2HKI2_9EURO/250-387              .........................PERGDEL.CGWT..NVTSEGFVGLVSYNYFQTA..I.G.K.S.R.........................I..PA......................E.WKWNGpsre...................................................................................................................qlpkTKKGRKGR.lRDE..NGLD.E..E....EE.AG..TQ.E..T...AT..TL.A..EAPS..........................................................SQTLLADDGGYFADASGTKIKST..lKFR..VADTE..IVP..................aHDRNKWSLQIDGTLL........................................................................................................................................................................................................................
A0A5E3XAM2_9AGAM/108-222              .........................PEIGMRL.TGNV..SLSSPDHVSLLVHRTFNVS..I.P.R.H.H.........................I..PT......................E.-NWEF...........................................................................................................................--------..---..EYGP.A..E....ND.PE..YG.T..K...PE..GE.A..PVEG..........................................................QEGEEPADRGQWIHSVTAEPLGG...RKG..RLEFT..VVG...................LTIANNMLSLVGSLQ........................................................................................................................................................................................................................
A0A4P9WZ69_9FUNG/106-393              .........................PDVGSTM.VGIV..NHVSPDHIGLLCFGVFNAS..I.P.A.D.T.........................I.dRT......................K.YKWDRtrlywrrtdcgdpdamdahairtdavlkftvsdmaksstmsai....................................vgslvahaddtglllgevvpeglteslasvreaakqaeaeaeqaKA------..EQA..KAEQ.A..A....EQ.TD..AS.D..E...A-..--.-..---Tetanvk..............................................sendvdD----------------------...---..-----..---...................---------------dddddddagsdadifkgessatsphpgsesdsdsdsdsdgdgdgdgdgdgdaddatassasasasepdvkqaasaaasdadsegedqlkqedevdpsaikteeaaakraadavdtkpaskrs..............................................................................................
A0A094GZB8_9PEZI/164-261              .........................PTRGGWL.EGYV..NLQNEGHLGIVCWNLFNAS..I.E.R.Q.R.........................L..PK......................D.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.A..EDLE..........................................................GDGYAEDGVGYYVDGAGTKIEGI..vKFR..VKDIE..-SS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A372QZT0_9GLOM/130-234              .......................st---GYKL.FGRV..ANQSLSHIHLHLYDQFYVK..I.P.R.Q.H.........................I..PL......................D.-VFLW...........................................................................................................................--------..---..----.-..-....--.KD..ND.E..F...YD..AM.F..LDKQ..........................................................LDLDRMYAEGQWVFSDTGATIEE...-DA..WLEFE..VTG...................ADTNNGQLYLIGSLL........................................................................................................................................................................................................................
A0A287R900_HORVV/79-231               .........................PQPEMIL.EGKV..EMLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..PE......................T.FKFKRrghggkfisqldkqhvikkgsmirfsvkrvdte.........................................................mnchitgslmpphtgcmrwlsvhdaeyaseissG-------..---..--KR.K..S....RD.HT..KT.E..H...NV..QG.R..ATVN..........................................................-----------------------...---..-----..---...................---------------sedsvvnserprkskkrsvee...................................................................................................................................................................................................
G1XR41_ARTOA/160-283                  .........................PTVGMVL.EGYV..NNVSPSHLGMLYGNVFSVS..V.T.Q.A.G.........................I..PQ......................D.WKFVA...........................................................................................................................AKEDDASL.vIEA..ENDP.Y..S....NV.GR..GR.R..E...KQ..KP.V..GGTD..........................................................PIEGLTKAMGRWFDSEGNEVEGL...---..-RKFV..VTA...................VKAEGGMLSLEGSF-r.......................................................................................................................................................................................................................
A0A341AXK8_NEOAA/125-326              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................E.-QWQTleinmgdelefevfrldsdaagvf..........................................................................cirgklnitslqtkcsaiseevtetG---TEEA..TEK..PQKK.K..K....KK.KK..DP.E..Q...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------yevesgiteldvtmkeetdlqinnnvnglweeepkkkkkhqdpvfqgsdssgyqsdhkkkkkkrkhseeaefaplfehapkrkgksn.................................................................................................................................
A0A1Q3E3L9_LENED/139-253              .........................PLVGMQL.VGKI..SLCSPDHISLLVHKTFNVS..I.P.R.H.H.........................I..PT......................Q.-EWEF...........................................................................................................................--------..---..EYGA.A..E....ND.PE..FG.V..G...AG..VE.G..MGTG..........................................................SELDDGEGNGRWIHKVTASSIGG...EDG..YLEFT..VIG...................LTVANEMLSLIGSLQ........................................................................................................................................................................................................................
A0A0P5FHP0_9CRUS/103-283              .........................PEVNQEL.VGIV..NRISVDHIGCLVHGLFNIS..L.P.K.PfN.........................V..AS......................E.-NWLGkpaklldkvkfsitkv..........................................................................................dlysivpyiegkiveliPQAEPSTE..SRQ..RTSS.D..S....GV.EF..AS.E..E...ST..NI.A..LSPE..........................................................ESMEQKRSK--------------...---..-----..---...................---------------lslsqrkneaklsltsklntvptqnetckimdefndqdkkrkrkisedsvmketpkkkkak...........................................................................................................................................................
A0A024U6U7_9STRA/71-126               .........................PTPGMQL.TGTV..SKVGSNHIGLLLAGVFNVS..I.A.A.T.E.........................M..PS......................G.FVHNY...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------hedawigqdssa............................................................................................................................................................................................................
Q6BX66_DEBHA/184-282                  .........................PQVGDTL.EGYI..YMQTASHIGLLVHDTFNAS..I.K.K.F.N.........................I..PV......................D.WNFIP...........................................................................................................................--------..---..----.-..-....--.--..--.-..S...QE..DE.Y..SEEV..........................................................NDSNKFKSFGYWADENNVKIEGK...---..-LKFT..IKS...................IHTTGKVVSLDGTL-i.......................................................................................................................................................................................................................
A0A1B9IDC0_9TREE/131-242              .........................PKIGQKL.YGSH..SLSSPSHLSLLFSKTFNVS..I.P.L.H.H.........................I..PT......................D.-LYEF...........................................................................................................................--------..---..---E.H..T....DE.AA..DS.D..S...ED..EE.E..EGFI..........................................................LGNGVVEDVGRWKEKSSGKSLGE...GGK..GIKFT..VIG...................MQVTNQMLSLTGSLL........................................................................................................................................................................................................................
A0A3Q3XIZ0_MOLML/141-383              .........................PKKGQKL.LGIV..NKLGVGHIGCLVHGCFNAS..I.P.R.P.N.........................L.vPV......................E.-TWRDagprigaelhfevnaldadnvgvllirgrldrtrviygstlsslslnycaiessesiv......ttdqpepsekevnseptegfpvhtpkkkkkkrdkikeeeteevvtsspscevdgntapeF-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------seangnetferkkkkkkekhpkveeeeelsvspvevhnsdssgyisdksskkrkcemhtgdtssfseepeptkskkkrkra.......................................................................................................................................
A0A448YQF5_BRENA/141-244              .........................PQVGDTV.EGWC..YMQSQSHIGLLIHDTFNAS..I.K.K.Y.N.........................V..PN......................E.WEFVP...........................................................................................................................--------..---..----.-..-....--.SQ..AD.E..E...GG..EG.G..EVVK..........................................................DSSHFGKSLGQWVDGQGVPVEGK...---..-VRFR..IKS...................LQPAGRGISIEGSMI........................................................................................................................................................................................................................
W7TIX5_9STRA/111-158                  .........................PEPGMSL.TGVV..IKVTSTHVALLVYGLFNAA..I.A.R.E.D.........................M..PD......................A.YAFDY...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------drea....................................................................................................................................................................................................................
A0A2Y9DMM2_TRIMA/125-337              .........................PEAGQKL.VGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................E.-QWQTleinvgdelefevfrldsdaagvfcirgklnttslkakcsevseevtetiteea...............vekppkrkkkrkedqytcgsilvedgtaelldvttkeetdlqtnnnvdglwveeSKKKKKKR.kHQE..DQDQ.D..P....VF.QG..SD.S..S...GY..QS.D..HKKK..........................................................KKKRKHSEEAEF-----------...---..-----..---...................---------------tpilehspkkkrkk..........................................................................................................................................................................................................
D0NQP5_PHYIT/46-231                   .........................PKEGMKL.RGVV..NKIGSNHVGMLFAGVFNGS..V.A.E.A.E.........................L..PK......................G.YVHNYaqdcwlgedgssisvedevevkvlrvhvaggmiaiea.................................................tmrfdaagvaktttskkakkathlnlaagepvtkptkK--KKARK.sKQS..EVEV.K..D....KK.ET..KS.K..K...RK..HE.K..SADE..........................................................EV---------------------...---..-----..---...................---------------aedatapavdkvkpskhkdkdakkkkhkkskhd.......................................................................................................................................................................................
A0A0L0VM36_9BASI/154-273              .........................PTIGHKL.IGRP..TLSSPSHLSLVIYRTFNAS..I.N.E.N.H.........................L..KA......................A.-GFHY...........................................................................................................................-----DIN..FEV..PAHW.K..S....IG.EL..SN.N..N...NT..NK.D..QEPS..........................................................LSDLDHKERGCWVDANGVVIGGD...-EG..TVSFT..VIS...................LTIANHMISVVGSLL........................................................................................................................................................................................................................
W4GCA7_9STRA/71-118                   .........................PTPGMQL.TATV..NKVGSNHIGLLLAGVFNVS..I.A.A.T.E.........................M..PS......................G.FVHNY...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------heda....................................................................................................................................................................................................................
A0A6J1US52_9SAUR/132-319              .........................PKPGKKL.MGII..NKVAPSHIGCLVHECFNAS..I.P.KpD.H.........................I..TT......................E.-EWKNfgfqigirlvfkvlhfdsdsagvfcirgklcknslg...................................................eemlkekckkkyekhcdvhigseemevdissvgiedR---E---..MHS..GDDE.D..D....HG.IY..DK.P..E...TE..NG.Q..DGAE..........................................................VGMHASDSSGYHSDH--------...---..-----..---...................---------------gkskkkkrkifeeenghsgllkskakkkr...........................................................................................................................................................................................
A0A1E3HI08_9TREE/121-234              .........................PKIGQKL.FGAH..SLSSPSHLSLLFSKTFNVS..I.P.L.Q.H.........................I..PA......................D.-LYEF...........................................................................................................................--------..-EH..TDET.A..P....EE.DS..DS.E..D...EV..EY.L..GGLG..........................................................NLASAVEEVGRWREKANGKALGG...---..DIKFT..VIG...................MQVTNQMLSLTGSLL........................................................................................................................................................................................................................
A0A094ADF3_9PEZI/164-261              .........................PTRGGWL.EGYI..NLQNEGHLGIVCWNLFNAS..V.E.R.Q.R.........................L..PK......................D.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.V..EDLE..........................................................GDGYAEDGVGYYVDGAGTKIEGT..vKFR..VKDIE..-SS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A1A0HCL7_9ASCO/126-228              .........................PQIGDLL.EGFV..YMQTASHIGLLIHDTFNAS..I.K.F.R.N.........................I..PQ......................D.WEFVP...........................................................................................................................--------..---..----.-..-....--.-V..QA.D..E...YA..ES.E..ASPE..........................................................NNSSKFKSFGYWTDASGAKIEGK...---..-VPFT..VKA...................IHTSGRMLSIEGTLL........................................................................................................................................................................................................................
A0A4W5KE19_9TELE/140-351              .........................PQRGQKL.LGTV..NKLGVSHVGCLVHGCFNAS..V.P.KpA.R.........................V..TI......................D.-TWREagprigaelefevcqldadtvgvllirgrldrtrvqelmaagessdptdpa.....................eqleepdtepalepnqdspdatvkpkkkkkkkekhreevasvpapgdavngTAEDSSTN.gHTE..KRKK.K..K....EK.RQ..NE.E..D...EE..REvG..GRGP..........................................................VEVQGSDSSGYLSDKPNRK----...---..-----..---...................---------------rkqgdditscl.............................................................................................................................................................................................................
A0A0F7TI00_PENBI/171-316              .........................PQRGQLL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PT......................S.WTWVP...........................................................................................................................PGEDGEMP.dNAV..NDLT.T..D....DE.NG..AN.A..V...PP..TF.D..AEKEmfqpaala..........................................adeldiegEAEEEEAASGHFQSISGHTVRGN..iKFR..VVDID..VIP..................gSERDRGFLSIEGTML........................................................................................................................................................................................................................
RPA43_SCHPO/83-130                    .........................PKKGDCL.EGKI..NLVSPSHIGLLILGIFNAS..I.P.R.K.S.........................I..PK......................D.WIFIE...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------pdtt....................................................................................................................................................................................................................
#=GR RPA43_SCHPO/83-130         SS    .........................-SSTSEE.EEEE..EEEETTEEEEEETTTEEEE..E.E.T.T.T.........................S..-T......................T.SEE--...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................----------------SS-....................................................................................................................................................................................................................
RPA43_MOUSE/125-330                   .........................PEPGQTL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.K.P.E........................qM..SY......................E.-EWQTleihvgdelefdvfrldsdsagvfcirgklsttslqlkhsavsedvaetvveev..............vektpkkkkkkkdkdtdtcgtvdsvtevadvtdvtpqeetdipcsdnvndffeeeP-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------kkkkkkkkrhqedqdpifqasdssgyqsdhnkkkkkrkhseeanfespkkrq....................................................................................................................................................................
A0A2S6BUY7_9PEZI/137-187              .........................PAPNTYL.KAEV..NLQNESILGLLYLNYFTVS..I.P.K.E.N.........................L..PE......................D.WKWDG...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------sqwvdaq.................................................................................................................................................................................................................
A0A4W3HBA7_CALMI/127-287              .........................PEKGQKL.VGVV..NKVAPSHLGCVVHGCFNAS..I.P.K.P.Y.........................H..EN......................G.-TWPGfevkvgnnlqfevvhldadv...................................................................................vgvlcirgkldpnsvqaeynVESEKTLE.nNSN..ETPL.E..N....GN.NH..TA.D..Q...TP..GK.K..KKKK..........................................................KKKHKRKNDEEFSTQDTPEEASE...TVE..LMD--..---...................---------------lslledgvhktngk..........................................................................................................................................................................................................
A0A024U7F7_9STRA/84-138               .........................PTPGMQL.TGTV..SKVGSNHIGLLLAGVFNVS..I.A.A.T.E.........................M..PS......................G.FVHNY...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------hedawigqdss.............................................................................................................................................................................................................
A0A671FC48_RHIFE/140-367              .........................PEPGQKL.VGTV..NKMSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PI......................E.-QWQTleinvgdelefevfrldsdaagvfcirgklnitslqtkcsgvseevtetgtkeav.............ekppkkkkkkkkdsepydeveggitdladcadvtmkeetdpqinnnvnglwedepK-------..---..---K.K..K....KK.KQ..QQ.Q..Q...EA..QE.A..KDPD..........................................................PIVQDSNSSGYQSDHKKKKKKRK...HSE..EADF-..---...................---------------tpllehspkkkrkkiysvksssr.................................................................................................................................................................................................
Q6C2P5_YARLI/121-218                  .........................PQVGDRL.EGYV..NMQTPSHIGLLVHDTFNCS..I.K.Y.A.N.........................I..PE......................D.WVFTP...........................................................................................................................--------..---..----.-..-....--.--..--.-..F...AE..SG.Q..PTAA..........................................................KKDRVRQSMGYWSDGSGKRVEGK...---..-LEFI..IKS...................VHTA-NMVYLSGSL-v.......................................................................................................................................................................................................................
W6YR90_COCCA/119-223                  .........................PVQNAYL.QAHI..TDHAKTHITLAHLNTFPVS..I.L.K.E.N.........................M..PA......................D.WSWHQ...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...NE..SG.K..VKKG..........................................................WDDKLSDEGGWWVNGKGKKVEGElrvRIR..NIDGR..MDG...................KGKGKGFLRVDGSLL........................................................................................................................................................................................................................
M7Z8N7_TRIUA/98-248                   .........................PQPEMIL.EGKV..EMLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..PE......................T.FKFKRrghggkfisqsdkrhvikkgsmirfsvkrvdte........................................................mnchitgslmpphtgcmrwlsvhdteyaseissgK-------..---..---R.K..P....RD.HT..KS.E..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------qkvqdcttanredsvvnserprksrkrav...........................................................................................................................................................................................
G8Y1N0_PICSO/130-228                  .........................PQVGDVL.EGYI..YMQTPSHIGLLLHDTFNAS..I.K.K.Y.N.........................I..PQ......................T.WRFVP...........................................................................................................................--------..---..----.-..-....--.--..--.-..N...QE..DE.F..AEDT..........................................................KSSGTFKSYGYWVNENDLKVEGK...---..-LKFS..VKS...................IHTTGRVVSVDGTL-i.......................................................................................................................................................................................................................
T5ACZ6_OPHSC/388-501                  .........................PSRGAWM.EGSV..NMQTEGHIGVVCFGKFNAS..I.E.A.S.R.........................L..PP......................A.WKWVS...........................................................................................................................--------..---..--SE.S..S....DA.QD..FE.E..T...AS..VM.T..ADDH..........................................................GVVHQIHSTGFWVDGSGARVKGR..mRFR..IRNFD..A-G...................TSDDTSYLSLEGTML........................................................................................................................................................................................................................
A0A177WU78_BATDL/151-210              .........................PKVGSIL.YGVV..NKVSPDHIGLLVYGVFNTS..I.P.S.S.H.........................I.cNK......................K.FSWDA...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------egyawkfesaidhst.........................................................................................................................................................................................................
A0A226PBZ8_COLVI/114-335              .........................PKKGKKM.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.KpE.H.........................M..SV......................A.-EWQElgfkvgdelkfravhldsdaagvffirgqltknrcfcfslppvfpysmqpk.....................qsetvtdavtdgtngeqiqnfdneknglndpgadnvtedllggtdntgggnTEEQSIDA.vNET..CDDK.K..K....KK.KK..KR.K..Q...EE..QE.-..----..........................................................-----------------------...---..-----..---...................---------------hvlpvsdssgyqsdlkkskkkkrkhceveeselpelsqkpkakkkr..........................................................................................................................................................................
A0A1Y2EVY3_PROLT/76-125               .........................PRQGDDL.EGTV..KLMGPSHIGLLILGTFNAS..I.P.R.H.L.........................I..PP......................D.WVFEE...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------dleene..................................................................................................................................................................................................................
N4UHD6_FUSC1/283-396                  .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................D.WKWVP...........................................................................................................................--------..---..--NE.S..P....EA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWADGNGDKVKGK..iRFR..IRNFD..V-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
G3B606_CANTC/122-222                  .........................PQLGDVL.EGYI..YMQTASHMGLLVHDTFNAS..I.K.K.F.N.........................I..PS......................D.WKFIP...........................................................................................................................--------..---..----.-..-....--.--..-S.Q..I...DE..YG.E..DNET..........................................................ENSSQFKSLGHWVDENEIKIEGK...---..-LKFN..VKN...................IHSSGRFVSIEGTL-i.......................................................................................................................................................................................................................
S7QCD2_GLOTA/131-254                  .........................PSVGMKL.LGRV..NLCSPDHVSLLVHRTFNVS..I.P.R.H.H.........................I..PT......................D.-HWEF...........................................................................................................................---EYGPA.eNDP..EFGP.H..A....VR.ED..GD.D..A...MN..EG.D..NAKG..........................................................EDTHEIEGGGRWVHKVTGDRLGG...PDR..QLEFT..VIG...................LTVANNMLSLIGSI-q.......................................................................................................................................................................................................................
A0A653DAL6_CALMS/104-330              .........................PEIGKEM.KGIV..NRKSKDHVGLLVYNALNVS..I.L.K.P.K.........................D..NE......................D.--WIGgfvelgaevlfrityisltsfmpyirgeiisiltdvn.................................................plsepedktqkskkrkkdtltegtlnskrrkvdhsvnD-------..---..----.-..-....--.--..--.-..-...--..--.-..---EleqklikkkhsknfisdldqslsdlvnnnsskkktkqhedssslqnstgyttfeenllE----------------------...---..-----..---...................---------------smdspeetpvkekkakkdktnkkdsytestvipsiterskrfssiespml......................................................................................................................................................................
A0A2G7G1R0_9EURO/188-336              .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEGSVS.gDQQ..KTAT.A..S....ED.DE..SE.P..S...AS..FD.Q..EK-Ehfnpvslanp......................................vsdtlneeanAEDDESAAEGYFQSVSGHRVRGT..vRFR..VVDVD..VIP..................gSERDRSFLSIEGTML........................................................................................................................................................................................................................
A0A4Q9Q341_9APHY/136-249              .........................PQVGMKL.SGKI..NLCSPDHISLLVHRTFNAS..I.P.R.H.H.........................I..TT......................D.-SYGF...........................................................................................................................--------..---..-EYG.P..A....EN.DP..EF.G..A...RQ..EG.K..AEGE..........................................................AAEEGVDGGGRWVHKITGTKLGD...ADG..SLEFT..VVG...................LTVANQMLSLVGSI-q.......................................................................................................................................................................................................................
A0A671RRT5_9TELE/137-348              .........................PKKGSKL.VGVI..NKMGVGHVGCLVHGCFNAS..V.V.K.P.S.........................L..LS......................S.EQWRDsglsvgqnlefevfqldadtagvllirgrleksr.......................................................vqelvaqteqmestvesttepeptedtidsakpkKKKKKDKR..---..---E.K..E....SQ.ND..RG.L..E...QT..SE.N..HQTA..........................................................-----------------------...---..-----..---...................---------------adtaeidsnanghhkekkrkkkdrrqesdeilpselstsdfsryvsdktsrkraaesndglqdvpaakkkkk................................................................................................................................................
A0A0M8PAQ7_9EURO/189-328              .........................PKRGQTL.DGWV..NVQSEGFLGAVVFNLFSVG..V.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEAETP..AET..DDDS.G..S....DK.DM..TD.F..D...AE..KE.C..FKPAslsee...............................................eiainaEEDDESAHTGYFQSVSGHRVSGS..vRFR..VVDVD..VIP..................gSERDRGFLSIEGTML........................................................................................................................................................................................................................
A0A6J0SMK6_9SAUR/147-318              .........................PKAGKKL.VGVI..NKVAPSHLGCLVHGCFNAS..I.P.KpD.H.........................I..ST......................D.-EWKNvgfqignrlvfkvlqfd.........................................................................................sdaagvfcirgrlcrnsIEEETPRE.kHKK..KHDK.H..C....DM.QN..GV.E..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------emetdmaaigiesgdianhdidsriqdvpdredgqniadlgthasdssgyhsdhgkskkkkrklceedd...................................................................................................................................................
U3K594_FICAL/77-304                   .........................PRKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................H..MS......................I.VQWQElgfkigdelkfqvlhldfdta.................................................................................gvffirggltkssmrpkksvtV-------..TES..TNGD.E..I....QK.LE..QQ.E..N...GL..ND.S..EEDN..........................................................VTEEPLNETGNLERENEQEPSVD..aVNG..V----..---...................---------------cddekkkkkkkkkdrqgeqelvlpteeqelvlptgeqelvlptsdssgyqsdhkkskkkkrkhcdeveeselpqlseepkakkkrtk.................................................................................................................................
A0A094F347_9PEZI/164-261              .........................PTRGGWL.EGYV..NLQNEGHLGIVCWNLFNAS..I.E.R.Q.R.........................L..PK......................D.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.A..EDLE..........................................................GDGYAEDGVGYYVDGAGTKIEGI..vKFR..VKDIE..-SS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A3D8S6P2_9HELO/152-256              .........................PEKGAEL.EGYI..NLQNEGHLGLVCWNLFNAS..V.E.R.Q.R.........................L..PS......................D.WRWVG...........................................................................................................................--------..---..----.-..-....--.--..-V.Q..D...EE..NE.E..DAQA..........................................................GETYAEDGIGYYVDADGKKIEGT..iKFK..VREIE..S-S...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A453KKA3_AEGTS/98-162               .........................PQPEMIL.EGKV..EMLGKESIHAIVLGVFSAA..I.M.A.D.D.........................I..PE......................M.FKFKRrgh....................................................................................................................ggkfI-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------sqsdkrhvikkgs...........................................................................................................................................................................................................
K1PN01_CRAGI/47-195                   .........................PTVGSTL.TGVV..HRVFKNHVSLLVYGIFNVS..I.R.K.S.E.........................L..NE......................D.-QLMEgnevefkveriyvnnr...........................................................................................ilsmhgslwseegsweK-------..KKT..KRKS.H..I....KF.TD..EP.T..A...EE..DS.-..----..........................................................-----------------------...---..-----..---...................---------------nlavegmevdadiqgengvtenasfngldetsedvkmtadetslrkskengc....................................................................................................................................................................
A0A2S7Q3I2_9HELO/160-264              .........................PEKGAWL.EGYI..NLQNEGHLGLVCWNLFNAS..I.E.R.A.R.........................L..PK......................D.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..-V.A..E...QA..KD.A..EAGE..........................................................GESYAEDGIGYYVDGEGKKVEGT...VKF..RVKEI..ESN...................HDKERGFLTVDGTML........................................................................................................................................................................................................................
A0A179UM13_BLAGS/251-414              .........................PERGQLL.EGWI..NVQSDGFLGAVVYNLFSVG..I.E.R.R.R.........................L..PA......................D.WQWVApgees................................................................................................................ttaalgT-------..--T..TPKR.S..S....GT.DD..DD.D..D...DN..ED.K..DSDFdsdkenfrplpatsst.........................ildlnaqnhnhegmeppFEAFEDAAAGYFRTRSGRRVRGM..vRFR..VRDVD..VIP..................gAEHDKGFLSIEGTML........................................................................................................................................................................................................................
G1PCC7_MYOLU/98-300                   .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PT......................E.-QWQTleingdelefevfrldsdaagvfcirgk..................................................................lnitssetecpavseevtetgteeavvkpP-------..---..-KKK.K..K....KK.KE..PD.E..V...E-..--.-..----..........................................................-----------------------...---..-----..---...................---------------ggateladlsdvtgreetdlqidnnvnglweeepkkkkkkkkkdpepdedpvflgsdssgyqsdhkkkkkkrkhseesdltpllehs.................................................................................................................................
S7ZQK7_PENO1/167-312                  .........................PQRGQTL.EGWV..NVQSEGFMGAVVFNLFSVG..I.E.R.K.R.........................L..PT......................S.WTWVPpgedgemp...........................................................................................................enthkdltTDDESGVS.gVPP..SFDA.A..K....--.--..--.-..-...--..--.-..---Elfqpaaka..........................................idevdidgEAEEEEAASGHFQSVSGHKVRGT..iKFR..VVDID..VIP..................gSDRDRGFLSIEGTML........................................................................................................................................................................................................................
A0A316VJN4_9BASI/112-147              .........................PKIGMRL.EGKI..KLSTPSHVSLLVHGIFNAS..I.T.S.A.H.........................L..--......................-.-----...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------........................................................................................................................................................................................................................
R0K3I7_ANAPL/46-240                   .........................PKKGKKM.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................A.VEWQElglkvgdelkfrvshldsdaagvffirggltktsmqpkisesitdcangee.....................tqnleheknslndsggvnvmeeppdetgnterdnaeeqsvdpvngicddknK-------..---..----.-..-....--.--..KK.K..K...KK..RK.Q..E---..........................................................-----------------------...---..-----..---...................---------------eqqqvlpasdssgyqsdhkkskkkkrkhceveeselpq..................................................................................................................................................................................
A0A2U3V9L8_TURTR/125-326              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................E.-QWQTleinmgdelefevfrldsdaag...............................................................................vfcirgklnitslqtkcsavseE-------..--V..TETG.T..E....EA.TE..KP.Q..K...KK..KK.K..KKDPepy...................................................evesG----------------------...---..-----..---...................---------------iteladfadvtmkeetdlqinnnvnglwkeepkkkkkhqdpvfqgsdssgyqsdhkkkkkkskhseeaefapllehapkkk.......................................................................................................................................
A0A367K5I4_RHIAZ/126-242              .........................PKKGSKL.VGRI..NLQSEDHIGLLIYGTFNAS..I.P.K.S.R.........................I..PS......................S.-MYEW...........................................................................................................................--------..KVS..EEDD.A..P....VQ.EE..SS.I..D...ED..ED.G..KEST..........................................................PEERKRTQYGEWVNKQTGASIGG...DDG..TVEFT..VID...................IIEANDILTVTGSL-........................................................................................................................................................................................................................
A0A5E4NQ91_9HEMI/33-265               .........................PPVGSIL.KAVV..NQTSDNHISCLVHNLFNVS..I.V.R.P.E.........................D.qPY......................D.-QWPGskikkediinvrvls.............................................................................................fdltkklphitgdivN-KNDRCS.kPEN..ELDN.Y..S....SQ.CS..ST.D..K...SA..KG.L..QKDS..........................................................-----------------------...---..-----..---...................---------------tsllkqlsrdselsdemhiitspfknknklkmspiykktsinnreyiknqlysstpisnsensvnditvirnkpfeqfknnlvkhnaeklsikqlkkyekdddsyakhnidvlnqervkqdseke...........................................................................................
A0A5J5CXU4_9PERO/141-383              .........................PQRGQTL.LGNV..NKLGVSHVGCLVHGCFNAS..I.P.K.P.N.........................L..VS......................V.ETWRDagprigaelkfevtaldadtagvllirgrldrtrqv..................................................cgtchrvqellamgessdfgvpadepeltetepnpepTEESLEDT.pKKK..KKKK.K..D....KE.EN..GD.E..E...--..--.-..---Vtstpscqldgntrp.............................dlngtlsdsngneagEKKKKKRKKEKHVKEEEEEVEI-...---..-----..---...................---------------spvevhasdssgylsdkpskkrrhetgtdvtsssfseaseppklkkkr........................................................................................................................................................................
A0A2T3Z8L1_9HYPO/256-369              .........................PSRGAWM.EGSI..NLQTEGHIGVVCFGQFNAS..I.E.A.R.R.........................L..PS......................A.WKWVS...........................................................................................................................--------..---..--NE.D..P....EA.HG..ME.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWVDGSGKKVKGK..iRFR..IRNFD..V-G...................VSGETSYLSLEGTML........................................................................................................................................................................................................................
F7C1U5_HORSE/125-323                  .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PS......................E.-QWQTleinvgdelefevfrldsdaagvfcirgklnis.........................................................slqtkcsavseevtetgteeavekppkkkkkkkK-------..---..----.-..-....--.--..--.-..-...--..--.-..---Dpepyeveggste..................................ladfadgtvtdkTDLQINNVNGLWEE---------...---..-----..---...................---------------epkkkkkkkkhqevqdqdpvfqgsdssgyqsdhkkkkkkrkhseeielt.......................................................................................................................................................................
A0A7H9HYZ8_9SACH/127-237              .........................PQIGDVL.EGWI..FIQSASHIGLLIHDTFNAS..I.K.K.N.H.........................I..PS......................D.WTFVH...........................................................................................................................--------..EEE..EVQE.G..S....--.--..DS.Q..S...RD..ET.D..EKND..........................................................GSQFERRSMDHWVDADGEKVDGK...---..-LKFV..VRN...................VYTTGRVISIEGSL-i.......................................................................................................................................................................................................................
A0A6J2WKA0_CHACN/140-290              .........................PKKGQRL.VGVI..NKVGVSHVGCLVHGCFNAS..I.L.KpS.Q.........................M..TT......................E.-MWRDcglnvgdhlqfevfqldadtagvllirgrle............................................................ksrveellavsepsndsvdvavesanesvlepASESTDSS.pSKK..KKKK.K..H....KH.KD..EE.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------aadnsvvvesslggetinqd....................................................................................................................................................................................................
Q2GYW2_CHAGB/300-427                  .........................PSRGKWM.EGVV..QLQSEGHIGVVCWGKFNAS..I.E.A.K.R.........................L..PE......................S.WKWID...........................................................................................................................LAKGGARP.nAFA..ASEE.N..E....GE.QG..GQ.E..A...ED..VL.D..GEEL..........................................................QVVEQIHTTGYWVNGEGKKLSGK..lRFR..IKNFD..V-G...................LAGDYGYLSIEGTCL........................................................................................................................................................................................................................
A0A094N149_ANTCR/41-246               .........................PKKGKKL.VGII..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................V.VQWQElgfkigdelkfqvlhldsdaagvffirggltkssmrpkqset.......................................vtgstnggetqefdhqenglnysggnnvteeslcetentvreN-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------aeepsvdavngicddknkkkkkkkhkqepahtlptsdssgyqsdhkklkkkkrkhcneaeeielsqlsqepkakkkr...........................................................................................................................................
A0A1Y2CIX1_9FUNG/81-157               .........................PREGTEI.VGIV..NKVSSDHIGLLVHGVFNAS..I.A.A.D.Q.........................I..RK......................K.-EFHF...........................................................................................................................--NHGAKA.wRRV..DE--.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------dgeaipgqaigagsvvkftivg..................................................................................................................................................................................................
W5PJ89_SHEEP/121-315                  .........................PEPGQKL.MGTV..NKVSSSHIGCLVHRCFNAS..I.P.KpE.Q.........................M..PA......................D.-QWQTlqinvgdelefevfcirgklsitslqtkcsavpeeapetgtdepvekppkk.....................kkkkkkdlepcevqggstepagladatmkdetdlhvsnsvnglweeeppkkKKKKKKHQ.eDQD..QEPV.Y..Q....GS.DS..SG.Y..Q...SD..HT.K..KRKK..........................................................RK---------------------...---..-----..---...................---------------reeaestplver............................................................................................................................................................................................................
A0A6P8XA39_GYMAC/141-348              .........................PEKGQTL.LGNV..NKLGVSHVGCLVHGCFNAS..I.P.R.P.N.........................L..VS......................V.ETWRDagprigaelefevtaldadmmgvllirgrlnrtr.......................................................vqellamaessesgvpadqpepepepmeespedtPKKKKKDK.vKEE..MTTP.S..C....QD.TT..AE.L..N...GT..MN.E..ENGN..........................................................KAGEKKKKKKKKKHLKEEEVEV-...---..-----..---...................---------------elsrmevngsdssgylsdkpstkrkletdtdvpsslsee.................................................................................................................................................................................
A0A1E3PGM9_9ASCO/133-237              .........................PQVNDFI.EGHI..NMSSPSHIGLLVHDTFNAS..I.K.H.W.G.........................I..PK......................D.WQFIA...........................................................................................................................--------..---..----.-..-....-S.QA..DE.A..T...EE..AD.E..EQET..........................................................SAASDTNSLGHWVDAEGKRVEGL...---..-LQFT..VKT...................VHNSGKVISLDGSL-i.......................................................................................................................................................................................................................
A0A699YPV8_HAELA/13-65                .....................sssm-------.-GSV..TKIGMDYVGLLVLGVLNAS..I.P.R.D.N.........................I..RK......................D.FTHHS...........................................................................................................................QA------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------gewrskkqpgh.............................................................................................................................................................................................................
B8NJ07_ASPFN/24-172                   .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEGSVS.gDQQ..KTAT.T..S....ED.DE..SE.P..S...AS..FD.Q..EKEHfnpvslanp.......................................vsdtlneeanAEDDESAAEGYFQSVSGHRVRGT..vRFR..VVDVD..VIP..................gSERDRSFLSIEGTML........................................................................................................................................................................................................................
A0A453KJY5_AEGTS/81-231               .........................PQPEMIL.EGKV..EMLGKESIHAIVLGVFSAA..I.M.A.D.D.........................I..PE......................M.FKFKRrghggkfisqsdkrhvikkgsmirfsvkrvd............................................................temnchitgslmpphtgcmrwlsvhdaeyaseI-------..--S..SGKR.K..P....RD.HT..KS.E..Q...KV..QG.R..TTAN..........................................................RED--------------------...---..-----..---...................---------------smvnserprksrkrav........................................................................................................................................................................................................
A0A5M6C653_9TREE/138-247              .........................PKIGQKL.YGTH..SLSSPSHLSLLFSKTFNVS..I.P.L.Q.H.........................I..PT......................D.-FYEF...........................................................................................................................--------..---..----.-..E....HT.DE..AD.D..L...SS..DS.E..DEDD..........................................................DLVVGVHDVGRWKEKSSGKLLGE...GGK..GIKFT..VIG...................MQVTNQMLSLTGSLL........................................................................................................................................................................................................................
M7NS26_PNEMU/131-185                  .........................-KRGDYL.EGII..NLQSPSHIGLLVSGFFNAS..I.P.K.N.G.........................I..PK......................T.WSYQE...........................................................................................................................IMSQKEVE..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------qnkn....................................................................................................................................................................................................................
A0A1V9ZJD1_9STRA/81-128               .........................PKAGMTL.SANV..NKVGSSHIGLLLAGVFNVS..I.A.A.A.D.........................M..PK......................G.YAHS-...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------ysdda...................................................................................................................................................................................................................
A0A2Z6S601_9GLOM/87-191               .......................sa---GYKL.FGRV..ANQSLSHIHLHLYDQFYVK..I.P.R.H.H.........................I..PL......................D.-VFLW...........................................................................................................................--------..---..----.-..-....--.KD..ND.E..F...YD..AM.F..LDKQ..........................................................LDLDRMYAEGQWVFSDTGATIEE...-DA..WLEFE..VTG...................ADTNNGQLYLIGSLL........................................................................................................................................................................................................................
A0A2C5YUI0_9HYPO/299-406              .........................PRRGSWM.EGTI..NLQTEGHIGVVCFGKFNAS..I.E.A.V.R.........................L..PQ......................T.WRWVP...........................................................................................................................--------..---..----.-..-....--.ED..HE.F..E...HV..TA.A..PDEY..........................................................GVVPQLDTTGFWVDGKGARVQGK..iCFR..IRNFD..A-G...................TSGESSYLSLEGTML........................................................................................................................................................................................................................
A0A163D3L8_DIDRA/922-1029             .........................PRPNRFI.TGRV..SHQSKTHLTLSCLNLFPVS..I.L.A.T.H.........................L..PQ......................G.WTFAQ...........................................................................................................................--------..---..----.-..-....--.--..RD.A..T...AA..AA.A..AAGA..........................................................NDGRLADEGGVWVDQDGEEVGGD..lRVR..LLDFD..ART..................dGKSRGKGLRLEASLL........................................................................................................................................................................................................................
A0A5N6EHB8_9EURO/188-336              .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEGSVS.gDQQ..KTAT.A..S....ED.DE..SE.P..S...AS..FD.Q..EK-Ehfnpislanp......................................vsdtlneeanAEDDESAAEGYFQSVSGHRVRGT..vRFR..VVDVD..VIP..................gSERDRSFLSIEGTML........................................................................................................................................................................................................................
A0A2P4ZJ00_9HYPO/252-365              .........................PSRGAWM.EGSI..NLQTEGHIGVVCFGQFNAS..I.E.A.R.R.........................L..PS......................A.WKWVA...........................................................................................................................--------..---..--NE.D..P....EA.FG..IE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWVDGSGNKVKGK..iRFR..IRNFD..V-G...................VSGETSYLSLEGTML........................................................................................................................................................................................................................
A0A066XES9_COLSU/285-407              .........................PRRGAWM.EGSI..NLENEGHIGVVCWGRFNAS..I.E.S.S.R.........................L..PP......................E.WRWVH...........................................................................................................................----AGSA..--E..AASY.V..A....DP.FDggDD.G..G...AA..AE.A..EDEH..........................................................GAVRQIHTTGFWVDGNGDKVKGR..vRFR..IKAFD..V-G...................VSGDHGYLSLEGTML........................................................................................................................................................................................................................
A0A0F4GB66_9PEZI/130-195              .........................PERGSLL.DGFV..NLQSESMLGLLCYNYFNVA..I.A.R.E.G.........................L..PE......................G.WNWDG...........................................................................................................................ESWND---..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------aegnpvgegrkvkckve.......................................................................................................................................................................................................
A0A2S4PJR5_9PEZI/148-252              .........................PKKGTWL.EGVI..SLQNDGFLGVVCWNLFNAS..I.E.R.S.K.........................L..PR......................D.WKWRE...........................................................................................................................--------..---..----.-..-....--.--..-A.G..D...LN..QF.E..DLNQ..........................................................IIPHGEEYTGFYVDGQGKKIDGT..iRFR..VAEIE..-SN...................QDSERGFLTIVGTML........................................................................................................................................................................................................................
J8PYL0_SACAR/127-250                  .........................PQVGDVL.EGYI..FIQSASHIGLLIHDAFNAS..I.K.K.N.N.........................I..PT......................D.WTFVH...........................................................................................................................NEVEEDAD.vVDT..DEND.G..S....RN.NE..DN.K..E...NY..SG.N..NSLG..........................................................KFSFTNRSLGHWVDSNGEPIDGK...---..-LRFS..VRN...................VHTTGRVVSVDGTL-i.......................................................................................................................................................................................................................
J3NDW1_ORYBR/81-230                   .........................PQPDMIL.EGKV..ELLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..NE......................R.FKFKRrgdrgkf.............................................................................................................isrsdkhH-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------virkgsmirfsvkrvdtemnchitgslipphtgsmhwlsihdaeytseinshirrsgnirikieqneqdhrtldnedgvisserphksrkr.............................................................................................................................
A0A4U6VH83_SETVI/101-254              .........................PQPDMIL.EGKV..EMLGKESIHAIVLGVFSVA..I.M.S.D.D.........................I..HE......................K.FKFKRrgdggrfvsrsdrehmikkgtmirfsvksvdte........................................................mnchitgslippqtgsmrwlsvhdaeyasqinsgKRKSRDIS.iKIE..QNEQ.E..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------hrilqnensmvkserphksrkrsied..............................................................................................................................................................................................
A0A063BUF8_USTVR/347-460              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGRFNAS..I.E.A.R.R.........................L..PP......................S.WKWVS...........................................................................................................................--------..---..--NE.S..T....EA.HG..FE.E..T...AS..VV.T..ADDH..........................................................GVVRQIHSTGFWTDGSGGRVKGR..iRFR..IRNFD..V-G...................MSGDTSYLSLEGTML........................................................................................................................................................................................................................
A0A2T7EHK8_9POAL/95-248               .........................PQPDMIL.EGKV..EMLSKESIHAIILGVFSVA..I.M.S.D.D.........................I..RE......................K.FKFKRksdggrfvsrsdrqhvikrgtmirflvkgvdte........................................................mnchitgslipphtgsmrwlsvhdaeyaaeinsgN-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------rrsrnvsikieqneqehrilknedsmvkserahksrkrsien..............................................................................................................................................................................
A0A397ST96_9GLOM/130-234              .......................sa---GYKL.FGRV..TNQSLSHIHLHLHDQFYVK..I.P.R.H.F.........................I..PL......................D.-VFLW...........................................................................................................................--------..---..----.-..-....--.KD..ND.E..F...YD..AM.F..LNKQ..........................................................LNLDRMYAEGQWVFSDTGAIIEE...-DS..WLEFE..VMG...................ADTNNGQLYIIGSLL........................................................................................................................................................................................................................
A0A0P7BIU0_9HYPO/278-391              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................S.WKWIS...........................................................................................................................--------..---..--NE.A..P....EA.QG..FE.E..T...AS..VI.T..SDDH..........................................................GVVRQIHSTGFWADGTGEKIKGK..vRFR..IRNFD..V-G...................MSGETSYLSLEGTML........................................................................................................................................................................................................................
Q0ULW6_PHANO/106-210                  .........................PEANKYL.TGRI..THQSKTHITLSHLNTFPVS..V.T.K.D.H.........................L..PD......................T.WTWQQ...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...AQ..SG.K..VSKG..........................................................WDGRLNDEGGCWVDVNGEKIEGE..lKIR..IRDFD..GRMd.................gRGKGKGFLKVEGSLL........................................................................................................................................................................................................................
A0A371D5V5_9APHY/160-282              .........................PQVGMKL.SGKI..NLSSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..TT......................D.-SYEF...........................................................................................................................---EYGPA..END..PEFG.A..G....QD.GP..AA.A..A...AA..EG.E..ATEE..........................................................GTEGHVDSGGRWVHKTTGTKLGD...ADG..YLEFT..VVG...................LTIANQMLSLVGSI-q.......................................................................................................................................................................................................................
A0A5N7CVH9_9EURO/188-336              .........................PQKGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEGSVN.gDQQ..KTAT.A..S....ED.DE..SE.P..S...-A..SF.D..QEKEhfnpvslanp......................................vsdtvneevnAEDDESVAEGYFQSVSGHRVRGT..vRFR..VVDVD..VIP..................gSERDRSFLSIEGTML........................................................................................................................................................................................................................
G2QUF7_THETT/318-444                  .........................PSRGKWM.EGVV..QLQSEGHIGVVCWNRFNAS..I.E.A.K.R.........................L..PA......................G.WSWVD...........................................................................................................................LTTGGAKQ..SAS..PVAN.E..D....GS.GQ..DD.Q..E...ED..ML.D..GEEL..........................................................QVVEQIHTTGYWVNERGRKVSGK..lRFR..IKNFD..V-G...................LAGDYGYLSIEGTCL........................................................................................................................................................................................................................
A0A4Q4W3I2_9PEZI/308-433              .........................PKRGSWM.EGSL..NLQSEGFIGVICFGMFNAS..I.E.A.S.R.........................L..PS......................G.WKWVD...........................................................................................................................--LLSKKG.gKQQ..NGKS.A..A....EA.KL..PT.P..E...PQ..DE.N..GEED..........................................................DGTDQAHSTGYWVDERGSKVGGK...LRF..RIKNY..EVG...................SVGDYGYLSIEGTML........................................................................................................................................................................................................................
A0A0D2MQI4_9CHLO/96-268               .........................PRPGQHL.VGRV..IKVGTDYVGLLVLGVFNAA..I.G.A.E.R.........................I..RR......................E.FKCSPeagcwvslrdathrilvgsyvrfvvdsvldha..........................................................slfsivgslldagtgeeghcssitgtqqalaskKAEQQQRP.gSKD..RHRR.R..D....GE.QQ..QQ.Q..Q...QQ..DG.K..AGKG..........................................................KRKEKQVDKG-------------...---..-----..---...................---------------egmdkrrkhgagdgtpaak.....................................................................................................................................................................................................
A0A2V1AKS6_9ASCO/126-226              .........................PQPGDVL.EGYI..YMQTQSHIGLLIHDTFNAS..L.K.F.K.N.........................L..PQ......................D.WQFVP...........................................................................................................................--------..---..----.-..-....--.--..-S.Q..A...DE..YG.E..EQGD..........................................................SGNSKFRSYGYWTDENGTKVEGK...---..-IKFT..VKV...................VNTSGRMVSLEGTL-v.......................................................................................................................................................................................................................
A0A7E5VAI7_TRINI/100-302              .........................PYVGATL.TGIV..NKKTMTHLGILVHRVFNVV..I.P.R.P.T.........................E.ePG......................N.-MWVGsnvqegqevvfrivvldlygalpyirgeldersik.....................................................latdadddeeidskqahpmnvtyvdfdktkpysqkQ-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------igdclpqstsknstkplnsskhqlknlstdnhvpmhngksgsaktknvdsemsvsdknkakrqnkllseseqkqmetptkpskkhkrd................................................................................................................................
A0A6P7Y3S8_9AMPH/129-270              .........................PKKGHKL.VGVV..NKVALSHIGCLVHGCFNAS..I.P.K.PpQ.........................M..SV......................E.-EWQNfgvnvgdqlefevfqldsdavgvfc.........................................................................irgklineitdvsaedavnglhtekPKKKKKEK.lQGS..DSSG.Y..Q....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------sdhtspkkrkrkllqeecelletnqepkak..........................................................................................................................................................................................
A0A2I1BY73_ASPN1/123-281              .........................-RRGQIL.EGWI..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEEEEN.gFNS..GEKP.K..K....KV.FS..ST.E..D...ED..DS.E..P--Sshfdpekehfkpisla..........................sdanpfsetmdldngsAEDEDSAAEGYFQSLSGHRVRGT..vRFR..VVDID..VIP..................gSDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A6G0XIV8_9STRA/82-129               .........................PTPGMKL.SATV..NKIGSNHIGLLLAGVFNVS..I.A.A.T.E.........................M..PS......................G.FVHNH...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------feea....................................................................................................................................................................................................................
A0A177UGA8_9BASI/218-327              .........................PSIGMRL.EGKI..VYSNTDVVSLLLNGTFNAA..I.P.A.A.H.........................L.pPN......................Q.YEFVH...........................................................................................................................--------..---..----.-..-....-N.DY..SG.T..A...DS..QV.V..DGAE..........................................................DEDFGAHSPGFWRRKRDKTQLGG...SSG..QLTFT..CFG...................ITVANQLLFLRGSLL........................................................................................................................................................................................................................
A7TPJ9_VANPO/126-231                  .........................PNIGDFL.EGWI..FIQSVSHIGLLIHDAFNAS..I.K.K.N.F.........................I..PE......................G.WTFVQ...........................................................................................................................--------..---..----.-..-....NE.EI..DN.A..S...QS..GE.N..QNDD..........................................................KKSNFSSSMGYWVDENGEKIEGK...---..-LKFT..VRN...................IYTKGKVVSIDGTL-v.......................................................................................................................................................................................................................
A0A1V6NCW4_9EURO/155-293              .........................PKRGQTL.DGWV..NVQSEGFLGAVVFNLFSVG..V.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEAETP..ALT..DDDS.G..S....DK.DM..AD.F..D...AE..KE.C..FKPAslsee................................................diaidGEEEDESHTGYFQSVSGHRVSGS..vRFR..VVDVD..VIP..................gSERDRGFLSIEGTML........................................................................................................................................................................................................................
G1NCZ6_MELGA/35-243                   .........................PKKGKKM.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.KpE.H.........................M..SA......................A.-EWQElgfkigdelkfqvvhldsdaagvffirgqltktsmqpkqsdpitdavtdgt.....................ngeqiqdfdnekndlndsgggnvtedppgeadnfvggnteeqsigveneicD-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------dkkkkkkkkkhkqeeqehvlpasdssgyqsdlkkskkkkrkhceieesellelsqepkakkk..........................................................................................................................................................
C5DG18_LACTC/129-229                  .........................PQIGDVI.EGWI..FIQSPSHIGLLIHDAFNAS..I.K.K.T.S.........................I..PQ......................D.WTFIH...........................................................................................................................--------..---..----.-..-....--.--..-N.E..D...AD..NN.S..DSGV..........................................................GNSAQSRSLGHWVDENGQRLDGK...---..-LKFS..VRN...................VYTTGRVVSLEGSLL........................................................................................................................................................................................................................
A0A179I748_CORDF/258-371              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................S.WKWVS...........................................................................................................................--------..---..--NE.D..P....EA.EG..ME.E..T...AS..IV.A..PDEH..........................................................GVVHQIHSTGFWVDANGDKVKGK..iRFR..IRNFD..V-G...................VSGETTYLSLEGTML........................................................................................................................................................................................................................
A0A1V8TX05_9PEZI/312-417              .........................PRKNTVM.EGFV..NLQNESMLGLICYNYFNAG..V.E.R.S.R.........................L..PK......................D.WRWVE...........................................................................................................................--------..---..----.-..-....--.--..--.D..E...SA..AD.D..AGAM..........................................................ARRGRRSAAGYYVDGKGKKVEGR..vVFR..VKDFE..ASP..................gAETGGGTINIYGTA-l.......................................................................................................................................................................................................................
A0A3M7N209_9EURO/316-451              .........................PQRGDQL.YGVN..NVASEGFVGLVSYNYFQIS..V.G.A.K.R.........................I..PS......................E.WKWRGpet.....................................................................................................................sqgRKQKRRTK.gKMD..QNGR.W..S....QS.SP..AP.A..E...PS..QS.S..VADE..........................................................RSRAEIESDTGFYLESGDKVDNV..mKFT..VVDTD..MVA..................gSHKGEWALHVDGSLL........................................................................................................................................................................................................................
A0A091T9K0_PHALP/41-248               .........................PKKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................I.VQWQElglkigdelkfqvlhldsdaagvffirggltksrmqpkrse.........................................tvtdstngdeiqkldhqeyglndsggdnvtedplgetdntgRENAEEQS.vDAV..NGLC.D..D....KN.KK..KK.K..K...KK..HK.Q..EEQE..........................................................L----------------------...---..-----..---...................---------------vlptsdssgyqsdhkkskkkkrkhcdeveeselsqlsrkpkakkkr..........................................................................................................................................................................
A0A0L6WY41_9AGAR/49-164               .........................PRVGMKL.MGKI..SLSSPDHVSLLLHRTFNVS..I.P.R.H.H.........................I..PK......................N.-EWEF...........................................................................................................................--------..--E..YGPA.E..N....DP.EY..GA.G..A...TT..ED.T..EEGP..........................................................SKSTEGDVGGKWVHHLTHAKLGD...ADG..YLTFT..VIG...................LTVANEMLSLLGSI-q.......................................................................................................................................................................................................................
F8PUM5_SERL3/111-226                  .........................PRVSMKL.AGKV..NLCSPDHVSLLVHRTFNVS..I.P.R.N.H.........................I..PT......................D.-HWEF...........................................................................................................................--------..--E..YGPA.E..N....DP.EF..GA.G..V...TP..EE.D..GEDG..........................................................EKDGNEDGNGRWIHKITGEKLGG...PEG..YLEFT..VIG...................LTVANEMLSLQGSI-q.......................................................................................................................................................................................................................
A0A2S4KNT4_9HYPO/296-409              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................A.WKWVS...........................................................................................................................--------..---..--NE.S..P....DA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWVDSSGARVKGK..iRFR..IRNFD..A-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
A0A2R9AZY1_PANPA/125-322              .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWQTmeinmgdelefevfrldsdaagvfcirg..................................................................klnitslqfkrsevseevtengteeaakkPKKKKKKK..DPE..TYEV.D..S....GT.TK..LA.D..D...AD..DT.P..MEES..........................................................ALQNTNNVNGIWEEEPKKKKKKK...---..-----..---...................---------------khqevqdqdpvfqgsdssgyqsdhkkkkkrkhseeaeftp................................................................................................................................................................................
A0A3A3A8Z8_9EURO/172-324              .........................PQRGQVL.EGWI..NVQSEGFLGAVFLNLFTVG..I.E.R.K.R.........................L..PS......................D.WKWIP...........................................................................................................................PGDEQSAE..ERK..KNRS.S..M....AS.AT..AS.E..D...ES..EA.P..KFDAekehfnpvtlas..................................denpladalnqdGADEADSAEGYFQSVSGHRVRGT..iRFR..VVDVD..VIP..................gTDRDRGFLSIEGTML........................................................................................................................................................................................................................
A0A1W2TRU3_ROSNE/299-418              .........................PSRGAWL.EGLV..NIQSGGHIGVVCWGKFNAS..I.E.A.E.R.........................L..PR......................D.WRWID...........................................................................................................................--------..-HH..PGNE.E..N....SD.AE..TE.S..P...SE..SP.G..DDAG..........................................................ADHGEVHTTGHWVDGQGSKITADt.pIRF..RIKNY..EVG...................NSGDYGYLSIEGTML........................................................................................................................................................................................................................
W5PJ88_SHEEP/121-335                  .........................PEPGQKL.MGTV..NKVSSSHIGCLVHRCFNAS..I.P.KpE.Q.........................M..PA......................D.-QWQTlqinvgdelefevfrldsdaagvfcirgklsitslqtkcsavpeeapetgtdepve...........kppkkkkkkkkdlepcevqggstepagladatmkdetdlhvsnsvnglweeeppkkKKKKKKHQ.eDQD..QEPV.Y..Q....GS.DS..SG.Y..Q...SD..HT.K..KRKK..........................................................RKR--------------------...---..-----..---...................---------------eeaestplverapkkkrektg...................................................................................................................................................................................................
A0A6P6RIA6_CARAU/136-332              .........................PKKGSKL.VGVI..NKMGVGHVGCLVHGCFNAS..V.V.K.P.G........................pL..SS......................E.-QWRDcglsvgqslefevfqldadnagvllirgrleksrvqel..............................................vaqtepkestteaectedtidspkpkkkkkkdkrekeslN-------..---..----.-..-....--.DS..GL.E..E...MS..EN.T..QNTA..........................................................DTAEIDSNTNR------------...---..-----..---...................---------------hhkekkkkkkkdkgqesdeistsdssrkraaesqddlqdapaakkkrks.......................................................................................................................................................................
S8G2K8_FOMPI/128-242                  .........................PQIGMKL.VGKV..NLCSPDHVALLVHRTFNVS..I.P.R.H.H.........................I..PK......................D.-QWEF...........................................................................................................................--------..---..EYGP.A..E....ND.PE..FS.A..E...VA..PD.A..ADDA..........................................................GSGANVESGGRWVHSITTSKLGG...DDG..YVEFT..VVG...................LTIANQMLSLVGSI-q.......................................................................................................................................................................................................................
A0A1A6AFV0_9TREE/130-241              .........................PKIGQKL.YGTH..SLSSPSHLSLLFSKTFNVS..I.P.L.H.H.........................I..PT......................D.-LYEF...........................................................................................................................--------..---..---E.H..T....DE.AA..DS.D..S...ED..EE.E..EGFI..........................................................LGNGIVEDVGRWKEKSTGKSLGD...GGK..GIKFT..VIG...................MQVTNQMLSLTGSLL........................................................................................................................................................................................................................
A0A2R6WB80_MARPO/82-338               .........................PSPGMLI.EGKV..NKIEKDYIGVVVLGLFNAA..I.G.V.S.D.........................I..RE......................D.LYYDEnpqgrawvsesderhsirlgstirfavksl...............................................................qetehiidlcgsladpktgcvnwielpsltPRKKSKSK.sAED..RSTH.D..A....DR.KH..KT.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------pkkeklllksegssdaidvgtalktpkeehgvhnsyetphsndvarkvktpkserdhansfetpdvykkkkrghvleepikpmvidlepdvmptpstssghkhkkrkeaesvqtpdgvhhkkkkkrrdv.......................................................................................
A0A507C070_9FUNG/106-153              .........................PQLRSNL.VGIV..NKTSPDHIGLLVFGTFNAS..I.P.A.D.A.........................I..RR......................D.-EYIW...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------nedew...................................................................................................................................................................................................................
D7FQC3_ECTSI/85-145                   .........................PRPGHVL.QGRV..NKVTSTHVGMLVCGIFNAS..V.A.S.E.S.........................M..GE......................G.FRFDM...........................................................................................................................T-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------arewqrsrggkhgage........................................................................................................................................................................................................
W2Z2G7_PHYPR/83-269                   .........................PKEGMML.RGVV..NKIGSNHVGMLFAGVFNGS..V.A.E.A.E.........................L..PK......................G.YVHNYaqdcwlgedgssisvedevevkvlrvhvaggmiaiea................................................tmrfdaagvakstapkkvkktshlnlaagepvtkpikeK---KTKT.tKKV..DEAE.D..K....QE.KK..SK.K..R...KH..EK.P..DEEV..........................................................VEEEPVEAEEVKVKSKKH-----...---..-----..---...................---------------khkdkdakkkkhkktkhd......................................................................................................................................................................................................
A0A5C5FQU9_9BASI/181-347              .........................PRVGMKL.LGTL..TLSSPSHVSLLLHNLFNAS..I.P.S.S.H.........................L..PT......................D.-QWEFdpdcavppivlerrnahvplqga.............................................................................vegvrrtaeeetearaggggdglVAE-----..GEE..AEAD.E..A....VA.EE..DD.D..Q...AA..EA.E..AEEE..........................................................EDEALYAERGWWVHRTSREPLGG...SDG..RIEFT..LVD...................LTTTNSLLSCTGSLL........................................................................................................................................................................................................................
A0A1E4SRR1_9ASCO/125-222              .........................PQVGDEL.EGYI..YMQTASHLGLLVHDTFNAS..I.K.K.Y.N.........................I..PS......................G.WSFIP...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...NQ..ED.E..VQEE..........................................................TTTPKFKSFGYWVDENEVKIEGK...---..-LKFT..IKA...................IHSAGRVVSVEGTL-i.......................................................................................................................................................................................................................
A0A1D2VP88_9ASCO/144-240              .........................PEINDKI.QGWC..YMQTPSHIGLLIHDIFNAT..I.K.R.N.S.........................I..PS......................N.WQFIS...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...-N..QI.D..EIDP..........................................................NDDSTTHSLGHWLDSEGNKIDAK...---..-LDFF..VKS...................IHSAGRAISIEGLL-i.......................................................................................................................................................................................................................
A0A409VWS9_9AGAR/81-205               .........................PRIGSTL.SGKI..NLSSPDHVSLLVHKTFNVS..I.P.R.H.H.........................I..PT......................D.-QWEF...........................................................................................................................--------..---..-EYG.P..A....EN.DP..EF.G..Q...EA..LG.D..DEQD..........................................................AETKEHQTTGKWIHKLTAEPLGG...PSG..AVEFT..VIG...................LNNPAALLS------sptethaaasgifrssg.......................................................................................................................................................................................................
A0A4Q4YY92_9PEZI/301-426              .........................PKRGSWM.EGSL..NLQSEGFIGVICFGMFNAS..I.E.A.S.R.........................L..PS......................G.WKWVD..........................................................................................................................lL---SKKG.gKQQ..NGKS.A..A....EA.KL..PT.P..E...PQ..DE.N..EEED..........................................................DATDQAHSTGYWVDESGSKVGGK...LRF..RIKNY..EVG...................SVGDYGYLSIEGTML........................................................................................................................................................................................................................
A0A2B4ST39_STYPI/105-245              .........................PTIGSTL.VGTV..NKLGIDHVGCLVHNCFNAS..I.A.K.S.Nftngl..............lfdsldI..GS......................E.FTFKVigteavn............................................................................................................gvlaiigeVKEPKD--..NKR..KRKH.K..D....IE.TV..EK.Q..S...ND..EG.D..QP--..........................................................-----------------------...---..-----..---...................---------------revtklypkrlnqnglnipdgnikvkkrekvdkhsrekdrm...............................................................................................................................................................................
A0A010QLK4_9PEZI/282-401              .........................PRRGAWM.EGSI..NLENEGHVGVVCWGKFNAS..I.E.S.S.R.........................L..PP......................E.WRWVH...........................................................................................................................-------A.gSAE..AASY.V..A....DP.FD..VE.N..T...EA..AA.E..-DEH..........................................................GAVRQIHTTGFWVDGAGDKVKGR..vRFR..IKAFD..V-G...................VSGDHGYLSLEGTML........................................................................................................................................................................................................................
B6HL93_PENRW/156-295                  .........................PKRGQTL.DGWV..NVQSEGFLGAVVFNLFSVG..V.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEAETP..ALT..DDDS.G..S....DK.DM..AD.F..D...AE..KE.C..FKPAalsae...............................................eiaidgEEEDESAHTGYFQSVSGHRVNGS..vRFR..VVDVD..VIP..................gSERDRGFLSIEGTML........................................................................................................................................................................................................................
A0A165N0P2_9APHY/128-261              .........................PQIGMKL.VGKV..NLCSPDHVALLVHRTFNVS..I.P.R.H.H.........................I..PT......................D.-QWEF...........................................................................................................................--------..--E..YGPA.E..N....DP.EF..GA.E..V...VQ..DP.V..DEPS..........................................................GEAAAVDGGGRWVHSLTTSKLGG...DDG..YLEFT..VVGyvtlpchht.ngcnsscnsLTIANQMLSLVGSI-q.......................................................................................................................................................................................................................
A0A0C3SDA8_PHLGI/52-168               .........................PYVGMRL.VGKV..NLCSPDHVSLLVHRTFNVS..I.P.R.H.H.........................I..PT......................D.-NWEF...........................................................................................................................--------..-EY..GPAE.N..D....PE.YG..GD.E..A...EG..EG.E..AEGA..........................................................DAQAQAEDSGRWVHKLTSDNLGG...KDG..NLEFT..VIG...................MTIANQMLSLIGSI-q.......................................................................................................................................................................................................................
A0A553HZU7_9PEZI/599-720              .........................PSRGAWL.EGLV..NIQSGGHIGVVCWGKFNAS..I.E.S.G.R.........................L..PR......................D.WRWVD...........................................................................................................................-------Q..HPG..EKKK.Q..S....SN.PE..DT.E..S...SS..SP.Q..GNTE..........................................................AESTEVHTTGYWVDGQGAKVTSEt.pICF..RIKNY..EVG...................SSGDYGYLSIEGTML........................................................................................................................................................................................................................
A0A1S8W3U8_9FUNG/151-211              .........................PKVGSTL.YGVV..NKVSPDHIGLLVYGMFNAS..I.P.S.S.H.........................I..RH......................D.-EFYW...........................................................................................................................--DTDGHA..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------wrfssakdkstl............................................................................................................................................................................................................
A0A0E0BTJ5_9ORYZ/81-152               .........................PQPDMIL.EGKV..ELLGKESIHAIVLGVFSAA..I.M.A.D.D.........................I..NE......................K.FKFKR...........................................................................................................................--KGD---..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------ggkfisrsdrhhvirkgsmirfsvk...............................................................................................................................................................................................
A0A094DG24_9PEZI/169-266              .........................PTRGGWL.EGYV..NLQNEGHLGIVCWNLFNAS..I.E.R.Q.R.........................L..PK......................D.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.A..EDLE..........................................................GDGYAEDGVGYYVDGAGTKIEGI..vKFR..VKDIE..-SS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A0F7ZTW5_9HYPO/315-428              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................A.WKWVS...........................................................................................................................--------..---..--NE.S..P....EA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWVDGSGSKVKGK..vRFR..IRNFD..A-G...................TSGDTSYLSLEGTML........................................................................................................................................................................................................................
A0A4S4KXG5_9AGAM/1-130                ........................m---GMKL.AGKI..NLCSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..PT......................D.-QWEFeygp...................................................................................................................aendP---EFGA.tAVE..EDAV.A..A....DI.TA..DK.A..G...GG..GG.E..EGEG..........................................................GASQNVDRGGRWIHKVTGDLLGG...EDG..RLEFT..VIG...................LTIANQMLSLIGSLQ........................................................................................................................................................................................................................
A0A058ZEH9_FONAL/106-167              .........................PKVGSQL.VGSV..IKIGPDQVGMLVLGLFNAS..I.P.T.E.N.........................L..GS......................E.FAYDYse.......................................................................................................................gvY-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------rkasksgsevaia...........................................................................................................................................................................................................
A0A0D2X4M3_CAPO3/83-126               .........................PIIGNKL.VGQV..DKIGVDHIGLLIYGTLNAS..I.P.R.D.S.........................I..GT......................N.-----...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------lecdg...................................................................................................................................................................................................................
A0A4P9ZCM6_9ASCO/126-228              .........................PQIGDTL.KGYI..FMLTATHLGLLVHDTFNAH..I.K.S.R.F.........................I..PQ......................S.WKFAP...........................................................................................................................--------..---..----.-..-....--.-N..QA.D..E...YN..DS.E..PSED..........................................................QRRSHFRSYGYWVDHTGIKVEGK...---..-IAFT..VRA...................INTSCKMISLEGTL-v.......................................................................................................................................................................................................................
A0A2J6TS94_9HELO/159-263              .........................PEKGALL.EGYI..NLQNQGHLGIVCWNLFNAS..I.E.S.K.R.........................L..PS......................E.WKWKD...........................................................................................................................--------..---..----.-..-....--.--..-V.S..D...MK..NR.R..NAEQ..........................................................GETYAEEGPGFWVDGEGNKVEGM..vKFR..VREIE..-SS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A061H5L2_9BASI/156-257              .........................PKIGHRL.EGTI..TLSSPSHVSLLLYGTFNAS..I.P.A.S.H.........................L.sKD......................S.WEFVI...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...-D..AE.A..DLHV..........................................................HGMGADRGLGHWRSKADGSRLGG...DDG..RLSFT..VIS...................MTVANHILSLHGSLL........................................................................................................................................................................................................................
W1QIM7_OGAPD/130-228                  .........................PQVGDVV.EGWS..YMQSQSHIGLLINDTFNAT..I.K.K.G.G.........................I..PP......................E.WRYIP...........................................................................................................................--------..---..----.-..-....--.--..--.-..N...QV..DE.F..NAEG..........................................................DAEKFGKSLGQWVDENGVPVEGK...---..-IRFT..IKA...................LHAAGKVVSMEGTL-v.......................................................................................................................................................................................................................
A0A0D2BCB9_9PEZI/255-370              .........................PKKGLEL.EGYL..NLQNESHITLILWNFFTVT..I.D.Y.K.H.........................L..PK......................S.WVWQE...........................................................................................................................--------..---..---Y.Y..E....EN.GK..LI.A..D...RE..VA.E..GGDK..........................................................PMRRSDEQWGAWYDGQGNAISGL..lRFR..IRDWD..CAPp.................gANGEGSFLSLSGSML........................................................................................................................................................................................................................
A0A0G4PU71_PENCA/155-295              .........................PKRGQTL.DGWV..NVQSEGFLGAVVFNLFSVG..V.E.R.K.R.........................L..PS......................N.WKWVPpge....................................................................................................................eaetP-------..ALT..DDDS.G..S....DK.DM..AD.F..D...AE..KE.C..FKPAslsaee..............................................iaingeEEEDESAHTGYFQSVSGHRVSGS..vRFR..VVDVD..VIP..................gSERDRGFLSIEGTML........................................................................................................................................................................................................................
A0A316YYZ6_9BASI/145-274              .........................PRIGMRL.EGQL..KLSTPSHISLLVHGIFNAS..I.T.A.A.H.........................L..PStkspt...........mtvedeQ.YEWHN...........................................................................................................................--------..-FE..DGEE.Y..A....EP.NE..DG.E..T...GA..EE.A..NGDE..........................................................EMMTGEKSTGYWRNRETGARLGE..dTDG..RVSFT..VVG...................LTIANNLLSLYGSLL........................................................................................................................................................................................................................
A0A135LSD9_PENPA/154-292              .........................PKRGQTL.EGWV..NVQSEGFLGAVVFNLFSVG..V.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEQAETP..ALT..DDDS.G..S....DK.DT..AD.F..D...TE..KE.C..FKPTtlseg................................................eiaigEEEEESAHTGYFQSVSGHRVHGS..vRFR..VVDVD..VIP..................gSERDRGFLSIEGTML........................................................................................................................................................................................................................
A0A1G4JL36_9SACH/126-227              .........................PQVGDVI.EGWI..FIQSPSHIGLLIHDAFNAS..I.K.K.T.S.........................I..PA......................G.WTFIH...........................................................................................................................--------..---..----.-..-....--.--..NE.D..V...DN..VT.S..EGSE..........................................................EGADKSRSLGNWVDENGQQLDGR...---..-LKFS..VRN...................VYTTGKVVSLEGSLL........................................................................................................................................................................................................................
A0A3N0XLU7_ANAGA/140-382              .........................PTKGSKL.VGVI..NKMGVGHVGCLVHGCFNAS..V.M.KpS.Q.........................M..SL......................E.-QWRDsglnvgqslefevfqldtdtagvllik....................................................................gwllesrvrellgqtkqrestvesatepE-------..---..----.-..A....TE.GT..TD.S..P...KP..KK.K..KKKD..........................................................EREKESAADESVNGNNLQQPSEN...NET..TVDTM..EVD...................---------------snsnrhhkekkkkkkdkkqeldeilpselpvsdssgyisdktsrkraaenedrpqddseimspakkkkkhkycrrvngclvqmpdsrvipv.............................................................................................................................
A0A1S7H814_9SACH/126-231              .........................PQVGDII.EGWI..FIQSASHIGLLIYDAFNAS..I.K.K.N.N.........................I..PA......................D.WTFVD...........................................................................................................................--------..---..----.-..-....KQ.SE..EE.P..S...RD..PN.E..TNEE..........................................................SQGFAYRSLGYWVDADGERIDGK...---..-IKFT..VKS...................VYTTGKVVSVEGTLL........................................................................................................................................................................................................................
D8U4R7_VOLCA/88-151                   .........................PTPGMTL.VGRV..NHIGEDYISALVMGVFNVT..I.P.A.R.S.........................V..MQ......................G.LQFIR...........................................................................................................................----EESK.wVHE..SQPQ.H..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------qiaehsy.................................................................................................................................................................................................................
G2WYB3_VERDV/284-401                  .........................PKRGAWM.EGSI..NLESEGHVGVVCWGKFNAS..I.E.S.A.R.........................L..PP......................A.WRWVH...........................................................................................................................--------..-LG..TDET.A..A....TS.AH..DD.T..V...SN..FT.A..EEQH..........................................................GAVRQIHATGYWVDEAGQKVKGR..vRFR..IKAFD..V-G...................VSGDHGYLSLEGTML........................................................................................................................................................................................................................
A0A194QCQ0_PAPXU/100-294              .........................PRVGATL.KGIV..NKKSVTHLGILVHRVFNVV..I.P.R.P.T.........................E.ePG......................N.-KWIGtnidegqevvfrivvldlygalpyirgelderwieneyeeeimd...................................skpsksrvidvsyvdfnktkpnvadraigdgceqatsqaktkslKRKDSRNK.nVSV..DDSS.Q..E....IT.NG..QH.D..D...VK..SV.A..TEKS..........................................................KSKRHSKHEDAVRQIETSTKVS-...---..-----..---...................---------------kkqkrt..................................................................................................................................................................................................................
A0A5M9J8U8_MONFR/154-258              .........................PEKGAWL.EGYI..NLQNEGHLGLVCWNLFNAS..I.E.R.A.R.........................L..PK......................E.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..-V.A..E...QE..ND.A..EAEG..........................................................GATYAADGVGYYVDGEGKKIEGT...VKF..RVKEI..ESN...................HDKERGFLTIDGTML........................................................................................................................................................................................................................
A0A0D7BVL8_9AGAR/124-232              .........................PRIGMRL.EGKI..SVCSPDHISLLIHRTFNVS..I.P.R.R.H.........................I..PE......................N.-TWEF...........................................................................................................................--------..---..----.-..-....EH.GP..AE.N..D...PD..FG.P..DAAS..........................................................EEKPSEEVGGKWIHSLTAKPIGD...AAN..NLSFT..VIG...................LTVANEMLSVTGSLQ........................................................................................................................................................................................................................
A0A6P3H5L0_BISBI/121-320              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................D.-QWQTlqinvgdelefevfrldsdaagvfcirgk.................................................................lsiaslqtkcsavpeeapetgadepvekpPKKKKKKK.kDRE..PCEV.E..G....GA.TE..PE.D..F...AE..VA.T..KDEA..........................................................DLHVSNSVNGLWEEEPKKKKKKK..kQ--..-----..---...................---------------qehqdqepvfqgsdssgyqsdhtkkkkkrkseeaeftp..................................................................................................................................................................................
W9HPW3_FUSOX/283-396                  .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................D.WKWVP...........................................................................................................................--------..---..--NE.S..P....EA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWADGNGDKVKGK..iRFR..IRNFD..V-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
A0A1J9R2K8_9PEZI/172-280              .........................PRKGIWI.EGSV..NLQNESHLGLVCWNLFSAS..I.D.R.K.R.........................L..PE......................D.WAWVA...........................................................................................................................--------..---..----.-..-....--.-A..GE.G..G...AD..DE.E..EEPE..........................................................GAGKLYGDQGHFVDAQGKKVDGV..iKFR..IRDFE..ASP..................rTEHDRGFITFEGSLL........................................................................................................................................................................................................................
A0A7N6AJG8_ANATE/141-372              .........................PKKGQKL.LGKV..NKLGVGHVGCLVHGCFNAS..I.P.K.P.N.........................L..VS......................V.ETWRVagpriggelefevtaldadtagvllirgrlertrvqelmalg......................................etsessipadhpdapdteptpevsgespedtpkkkkkkkkdkvKEEEREVE.vAPS..LEQN.G..T....--.--..--.-..T...DE..AN.G..NEAG..........................................................EKKKKKKKKDKHVKEEEEEVALS...---..-----..---...................---------------vtevhgsdssgyvsdkpskkrkhesgsevtpgfseepeppkskkkrksdaek....................................................................................................................................................................
A0A2K6QW86_RHIRO/125-332              .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWLTmeinmgdelefevfrldsdaagvfci......................................................................rgklnitslqfkssevseevtengteeA-------..---..----.-..-....--.--..AK.K..P...KK..KK.K..KKDPetyevdsgttkl..................................addagdtpmeesALQNTNNVNGLWEEEPKKK----...---..-----..---...................---------------krkkkhqevqdqdpvfqgsdssgyqsdhkkkkkkrkhseeaeftpplkcspkrk..................................................................................................................................................................
A0A3B5Q757_XIPMA/137-353              .........................PKKGQKL.LGKV..NKLGVSHVGCLVHGCFNAS..I.P.K.P.N.........................L..VS......................V.ETWRDsgprigtelefkvttldadtagvllirgqldrtrvqelmamsenv................................essvpagqeepqeaepapepqeaepapepqeaepepthdgtpkkkkK-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................----KKKEKEKIKEEETEE----...---..-----..---...................---------------qitktphclngsteqtnssdtpekkkkkekhmkeeeeqmavsamenhrgfgvklskkrklesgtda......................................................................................................................................................
A0A1B8GXM5_9PEZI/166-263              .........................PTRGGWL.EGYV..NLQNEGHLGIVCWNLFNAS..I.E.R.Q.R.........................L..PK......................E.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.A..EDLE..........................................................GEGYAEDGVGYYVDGAGTKIEGI..vKFR..VKDIE..-SS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A0Q3TST9_AMAAE/111-335              .........................PKKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................V.VQWQDlglkigdelkfqvlhldsdaagvffirgglt............................................................ksrclyvsxfciflxsmkpkksetvtdstngdETQKLDHQ.gNSL..NDSG.G..D....NV.TE..EP.H..D...ET..KN.T..GKEN..........................................................AEEQSVSAVNGLCDGKNKK----...---..-----..---...................---------------krktrkqeeqehilpxtdssxyqsdhknskqkkrkrcneveeselsqlsqepkakkxkkkrdys........................................................................................................................................................
A0A0D9XZY3_9ORYZ/81-217               .........................PRPDMMI.EGKV..ELLGKGSIHAIVLGVFSAA..I.M.S.D.D.........................I..NE......................K.FRFKRkgdr..................................................................................................................gkfisQ-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------sdkhhvikkgsmirfsvkrvdtemnchitgsllpphtgsmrwlsshdaeyvseinsgirrssnigikiekneqdqrtlddedg.....................................................................................................................................
A0A4U1FKV6_MONMO/1-196                .........................-------.-GTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..LA......................E.-QWQTleinmgdelefevfrldsdaag..............................................................................vfcirgklnitslqtkcsavseeV-------..---..TETG.T..E....EA.TE..KP.Q..K...KK..KK.K..KKDPepy...................................................evesG----------------------...---..-----..---...................---------------iteladfadvtmkeetdlqinnnvnglwdeepkkkkkhqdpvfqgsdssgyqsdhkkkkkekkhseeaefapllehapkkkre.....................................................................................................................................
I1BLC1_RHIO9/128-246                  .........................PKKGTKL.VGRI..NLQSEDHIGLLIYGTFNAS..I.P.K.S.R.........................I..PS......................S.-TYEW...........................................................................................................................-------K.vNEE..DAAL.E..Q....EE.NT..PD.D..D...VS..KV.S..EEST..........................................................TEIRKRTQYGEWVNKNTGAGIGR...EDG..SLEFD..VVD...................VIEANDILTVTGSL-........................................................................................................................................................................................................................
A0A4U0W4L6_9PEZI/294-393              .........................PTKGSWL.EGFV..NLQNESLLGLVCYNYFNAA..I.E.R.H.R.........................L..PK......................D.WRWVE...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.D..GSQG..........................................................STRVGKGSQGYWVDGNGQKMDGR..vVFR..VKDFE..AAP..................gSESGAGSLNTLGTLL........................................................................................................................................................................................................................
A0A2V0PAU3_9CHLO/95-140               .........................PRPGQRL.VGRV..VKVGSDYVGLLLLGVFNAA..I.G.A.D.R.........................I..RR......................E.FK---...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------capes...................................................................................................................................................................................................................
A0A485N8H4_LYNPA/92-299               .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................E.-QWQIleinvgdelefevfrldsdaagvfcirgklntsslqtkcstvseevtetgt.....................eeivekplkkkkkkktdpepyevesdnreladfadvtvkeetnlqinntngF-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------qneepkkkkkkrhqedqdpvfqgsdssgyqsdhkkrkkkrkhseeaeftpllehsskkkre...........................................................................................................................................................
A0A0V0Q969_PSEPJ/89-196               .........................PEKGDIL.PGTI..TQIYQSHIGLLCFNIFNVV..I.N.F.P.D.........................I..NQ......................K.-IFQQ...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------skdgnwtdlksgenlevgnelqfqiksiridqngdfqfvgsiqnsklcgltqnikqkytvqeneq.......................................................................................................................................................
A0A1J9Q724_9EURO/246-408              .........................PERGQPL.EGWI..NVQSDGFLGAVVYNLFSVG..I.E.R.R.R.........................L..PA......................D.WEWVA..........................................................................................................................pGEESTTSA.lETT..TSKN.S..S....GT.DD..DD.D..D...NE..DK.D..SDFDsdkenfrpmpatssam..........................ldmstqhqnhegmeppFEAFEDAAAGYFRTRSGRRVRGM..vRFR..VRDVD..VIP..................gAEHDKGFLSIEGTML........................................................................................................................................................................................................................
A0A093Q1A7_9PASS/69-274               .........................PKKGKKL.VGII..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................V.VQWQElglkigdelkfqvlhldsdtagvffirggltkksmrpkrsetvtdstng.........................neiqkldhqenglndsgednvteeplnetnnlgreneegqsvdavnglcD-------..---..----.-..-....ET.GK..KK.K..K...KK..KD.-..----..........................................................-----------------------...---..-----..---...................---------------kqeqeqvlptsdssgyqsdhkkskkkkrkhceieeselsqlsekpkakkkr.....................................................................................................................................................................
V8NVY4_OPHHA/124-189                  .........................PKPGKKL.MGII..NKVAPSHIGCLVHECFNAS..I.P.KpD.H.........................I..TT......................E.-EWKN...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------fgfqigirlvfkvlhfdsdsag..................................................................................................................................................................................................
A0A0C3QUQ9_9AGAM/154-287              .........................PRVGMRL.TGQV..ILFSPDHIALLVNRTFNVS..I.P.A.R.H.........................I..PD......................D.-EYEFdyqanev.............................................................................................................dgpingvG------E..RNR..KVPE.E..M....EG.DE..TL.K..D...SA..SS.Q..HEPA..........................................................VDDPQIDAMGRWVKRNTCERVGG...PNL..MVEFT..VVG...................MILANQMISLIGSLQ........................................................................................................................................................................................................................
A0A6P8H3Y1_CLUHA/150-363              .........................PNKGQKL.EGVI..NKIGQTFVGCLVHGCFNAS..I.L.K.P.R........................eM..TS......................E.-MWRDsglviggslefevvqldadaagvllirgrlhktwyee................................................mlrltdpgtddateepfmpadntateaaldgvdgvqpeKKKKKKKD.kSKD..KEAL.E..D....SV.VK..DS.Q..L...NG..SG.N..TELT..........................................................RTDSDVNSNGHVEKKKKKKKKDK...ETS..SQATE..GVP...................ASDSSGYLSDKGS--kkrkesdeandas...........................................................................................................................................................................................................
A0A6J2X7K1_SITOR/104-316              .........................PKIGATL.KGIV..TKSSRDHVGCLLYKTFNVS..L.P.K.S.E.........................C..PE......................N.-EWIGenvhignevdfkivfadlesrlpyirgqllsitdssempellsmf.................................ektnvlnkkikfeeadtedvpkskkskkkkresilgtdtiedevpKKKKKGKK.eAKS..QAEV.S..E....EE.IS..NK.R..E...KR..KE.K..KKK-..........................................................-----------------------...---..-----..---...................---------------qeaeeldisleeldikslfndipidvskstgsmansedvkkrkrsk..........................................................................................................................................................................
A0A0E0RI71_ORYRU/81-234               .........................PQPDMIL.EGKV..ELLGKESIHAIVLGVFSAA..I.M.A.D.D.........................I..NE......................K.FKFKRkgdggkfisrsdrhhvirkgsmirfsvkrvdtemnch................................................itgsllpphtgsmpwlsthdaeyaseissgtrrpsnvgI-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------kikneqdhktsdnedsvinserphkksrkrawee......................................................................................................................................................................................
A0A4T0LU31_9BASI/102-154              .........................PTNGQRM.RGKV..TLCSPDHISLLVHHTFNVT..I.P.R.E.Y.........................I.dCD......................N.FKYAS...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------dssetgsg................................................................................................................................................................................................................
A0A4U6XHJ1_9PEZI/289-414              .........................PRRGAWM.EGSI..NLENEGHIGVVCWGKFNAS..I.E.S.A.R.........................L..PP......................E.WRWVH...........................................................................................................................--AGSAEA.aSYL..ADPF.D..N....EN.GE..DD.N..A...SA..RA.A..EDEH..........................................................GAVRQIHTTGFWVDGAGDKVKGR..vRFR..IKAFD..V-G...................VSGDHGYLSLEGTML........................................................................................................................................................................................................................
B0D0C4_LACBS/123-241                  .........................PRVGMKL.VGKV..NLCSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..PA......................D.-EWDF...........................................................................................................................---EYGP-..A--..-END.P..E....YG.QG..AQ.E..N...ND..EM.V..ADNM..........................................................TKKQNNDGGGKWVRRITGHRIGN...KDG..FLEFT..VVG...................LTVANEMLSLLGSI-q.......................................................................................................................................................................................................................
A0A5E4Q802_9NEOP/100-192              .........................PYVGATL.KGVV..NKKYLTHLGVLVHRVFNVV..I.P.R.P.T.........................E..ES......................D.TEWEGtni....................................................................................................................eegqT-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------vlfeiaaldlygalpyirgslekrwselveddedpgdsmkp...............................................................................................................................................................................
W6PZI8_PENRF/159-297                  .........................PKRGQTL.DGWV..NVQSEGFLGAVVFNLFSVG..V.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEAETP..ALT..DDDS.A..S....DG.DM..AD.F..D...AE..KE.C..FKPAslsae................................................eiaieGEEDASAHTGYFQSVSGHRVTGS..vRFR..VVDVD..VIP..................gSERDRGFLSIEGTML........................................................................................................................................................................................................................
A0A4U5VJU9_COLLU/126-338              .........................PKRGQRL.LGTV..NKLGVSHVGCLVHGCFNAS..I.L.K.P.N.........................L..VS......................V.ETWRDagprigtqlefeellaigessksgvttdqpespeteakpelnpep.................................tedspvntpkkkkkkkkvkeeetemevvsvpscqvggdsapelngTMDEANGN..EAG..KKKK.K..K....KK.EK..HL.K..E...EE..EE.T..EVSP..........................................................MEVHGSDSSGYISDK--------...---..-----..---...................---------------pskkrkhesgtdvtsgfsedpeapkskkkr..........................................................................................................................................................................................
A0A4W6ETK0_LATCA/141-363              .........................PKKGQKL.LGKV..NKLGVSHVGCLVHGCFNAS..I.P.K.P.N.........................L..VS......................V.ETWRDagprigaelefevtaldadaagvllirgrldrtrvqelmamgesse..............................ssvpaeqidgaepnpetteespgdtpkkkkkkkkdkikeeeredevmP-------..---..----.-..-....--.--..--.-..-...--..--.-..---Scqqnssttpelng................................ttdeangneageeK----------------------...---..-----..---...................---------------kkkkkkkkekgvkeeqeevelspmevhgsdssgyvsdkpskkrkhetgsdvtsgfse...............................................................................................................................................................
A0A067NLG2_PLEOS/129-230              .........................PRVGMKI.TGKV..NLCSPDHISLLVHRTFNVS..I.P.R.R.H.........................I..PI......................N.-DWEF...........................................................................................................................--------..-EY..GPAE.N..D....PE.FG..AV.S..Q...DA..DE.E..KQDA..........................................................SEDASKGHSGRWIHKLTSEMVGG...ESG..FISFV..VVG...................---------------........................................................................................................................................................................................................................
A0A2I1FT95_9GLOM/130-234              .......................st---GYKL.FGRV..ANQSLSHIHLHLYDQFYVK..I.P.R.H.H.........................I..PL......................D.-VFLW...........................................................................................................................--------..---..----.-..-....--.KD..ND.E..F...YD..AM.F..LDKQ..........................................................LDLDRMYAEGQWVFSDTGATIEE...-DA..WLEFE..VTG...................ADTNNGQLYLIGSLL........................................................................................................................................................................................................................
A0A672SMR3_SINGR/132-342              .........................PKKGSKL.VGVI..NKMGVGHVGCLVHGCFNAS..V.V.K.P.S.........................L..LS......................S.EQWRDcglcvgqslefevfqldadaagvllirgrlekcr.......................................................vqelvaqaeqketivesatepestedtidspkpkKKKKKDKR..EKE..SLND.S..S....LE.QT..SE.N..Q...QT..AA.N..TTE-..........................................................-----------------------...---..-----..---...................---------------idpsanrhhkekkkkkdkrqeadeispselstsdssgyvsektsrtraaesdhglqdapaakkkkk......................................................................................................................................................
A0A1B8CUR4_9PEZI/150-206              .........................PTRGGWL.EGYV..NLQNEGHLGIVCWNLFNAS..I.E.R.Q.R.........................L..PK......................E.WKWVG...........................................................................................................................A-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------edlegegyaedg............................................................................................................................................................................................................
T1JF64_STRMM/681-845                  .........................PEIGKPV.RGVV..NKYGRNYVSCLVHEVYNAS..I.P.R.P.E.........................G..EA......................E.--WIGdcvdigysflftvtnvges....................................................................................clrgiiiddsvtvpqaaeneLEYEENED.vQIE..SENT.M..E....NE.EV..ID.E..N...KD..VD.D..KTND..........................................................LEERVDETKHH-HHKKKKRK---...---..-----..---...................---------------ldemlnngdntmndveisprkkkklklqse..........................................................................................................................................................................................
A0A3B6LKW5_WHEAT/98-249               .........................PQPEMIL.EGKV..EMLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..PE......................T.FKFKRrghggkfisqsdkrhvikkgsmirfsvkrvdte.........................................................mnchitgslmaphtgcmrwlsvhdaeyaseisrG-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------krksrdhikseqivqdrstvnsedgmvnserrrksrkktve...............................................................................................................................................................................
A0A0D9NSB3_METAN/279-392              .........................PSRGAWM.EGSV..NLQTEGHIGVVCYGKFNAS..V.E.A.R.R.........................L..PP......................A.WKWVS...........................................................................................................................--------..---..--NE.S..P....EA.HG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWVDGNGDRVKGR..vRFR..IRNFD..A-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
A0A194XCZ5_9HELO/178-281              .........................PERGVEL.EGYV..NLQNEGHLGVVCWNLFNAS..V.A.R.E.R.........................M..PA......................D.WVWKD...........................................................................................................................--------..---..----.-..-....--.--..--.V..S...EM..QN.K..EGGG..........................................................NEGYAEDGQGCWVDGNGEKVEGV..vRFR..VKEIE..-SS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A5J9WC87_9POAL/109-262              .........................PQPNMML.EGTV..EMLGKESIHAIVLGVFSAA..I.M.L.D.D.........................I..HE......................K.FKFKRkgdggsfvsrsdkhhvikkgsvirfsvkrvdt...........................................................dmnchitgslipphtgsmlwlslhddeyasgiN-------..--S..DKRR.S..R....DT.NI..KV.E..Q...DE..QE.Y..GKVD..........................................................NKD--------------------...---..-----..---...................---------------gvrnserphksrkrsfee......................................................................................................................................................................................................
A0A1S3AB57_ERIEU/121-332              .........................PEPGQKL.LGTV..NKVSSSHIGCLVHRCFNAS..I.P.KpE.Q.........................M..SA......................E.-QWQTleinvgdelefevfrldsdaagvfcirgklninslptkcsavleevietgiee................aikkppkkkkkkkdseinevedgtteladftdgtlkeepdlqgndsvsglwekePKKKKKKK.kHQE..DQDQ.D..P....VF.QG..SD.S..S...GY..QS.D..HKKK..........................................................KKKRKHREEGEFTP---------...---..-----..---...................---------------dleehtpkkkrk............................................................................................................................................................................................................
A0A1V6QM53_9EURO/155-295              .........................PQRGQTL.DGWV..NVQSEGFLGAVVFNLFSVG..V.E.R.K.R.........................L..PS......................N.WKWVPpge....................................................................................................................eaetP-------..ALT..DDDS.G..S....DK.DM..AD.F..D...AE..KE.C..FKPAslsaee..............................................iaingeEEEDESAHTGYFQSVSGHRVSGS..vRFR..VVDVD..VIP..................gSERDRGFLSIEGTML........................................................................................................................................................................................................................
A0A4V1M3G1_TREME/144-255              .........................PKLGQRL.YGTH..SLSSPSHISLLFGKTFNVS..V.P.L.Q.H.........................I..PL......................D.-RYYF...........................................................................................................................--------..---..---E.H..T....DP.MD..EP.S..D...SD..SE.A..ESET..........................................................QIVAGEVEVGRWKERGTGKLVGE...GGK..GIKFT..VIG...................LQVTNHMLSLTGSLL........................................................................................................................................................................................................................
A0A517L6A3_9PEZI/212-324              ........................r--KGITM.EANV..NLQNESHIGLILWNVFSVT..V.E.K.K.R.........................L..PS......................G.WKWIE...........................................................................................................................--------..---..----.-..T....TD.GD..TE.M..T...NG..DA.D..GDDR..........................................................PTKRPSEAWGHWKNEKDETVAGM..lRFT..VKDFD..VTLp.................nKDGEQSSLMVQGTLL........................................................................................................................................................................................................................
A0A2T0FL00_9ASCO/124-221              .........................PASGDHI.EGWV..SVQSPGHIALLIHDTFNAT..I.K.R.A.D.........................I..PE......................T.WQFVH...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..--SE..........................................................DDETDSKSLGYWVDSNGNRIEGK..lAFD..VKTFN..VSG...................---------------rtplvvgslltvkdvql.......................................................................................................................................................................................................
A0A5C3DYL8_9BASI/133-234              .........................PKIGQML.EGNI..CLSSPSHVSLLLYGLFNAS..I.P.A.S.H.........................L..PE......................E.-EWEF...........................................................................................................................--------..---..----.-..-....--.--..--.-..V...LN..DD.Q..AETT..........................................................EVDARDHGLGHWRNKVDGSKLGG...SSG..KLSFT..VIS...................LTVANHMLSLHGSLL........................................................................................................................................................................................................................
A0A3N4M4H9_9PEZI/158-279              .........................PQKGDFL.EGWV..NLQSESHIGLLVLNTFNVS..V.P.R.G.K.........................I..PR......................R.WSWCE...........................................................................................................................--KRVGFA.pAEV..KPVE.E..E....LK.DP..ES.M..E...GV..EG.A..EGLE..........................................................EEEEAEEDLGGWMDEKGEYVDGL...---..-LRFK..VET...................VKASGHIIAIEGNLL........................................................................................................................................................................................................................
K1VRR5_TRIAC/123-224                  .........................PRLGQVL.QGTH..SLSSPSHLSLLFGKTFNVS..I.P.L.Q.H.........................I..PQ......................D.-KYEF...........................................................................................................................--------..---..----.-..-....--.EH..TG.E..A...AE..SD.S..EDED..........................................................EPLGAVEEVGRWKVKSTGQTLGA...SGE..RVPFT..V--...................---TNNMLSITGSLL........................................................................................................................................................................................................................
M1WGV3_CLAP2/292-405                  .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.S.R.........................L..PP......................S.WKWVS...........................................................................................................................--------..---..--NE.S..P....DA.SG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWIDGSGTRVKGK..vRFR..IRNFD..A-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
A0A1S3IX91_LINUN/110-318              .........................PGKGSVL.KGVI..NKLGRDHIGCIVHRCFNAS..I.L.K.P.R.........................D.aDS......................D.WQNNFkvgqevifqvlnlysnnrvlslrgrlhhtgeesfqtpnrssqtvn................................qflsptpikgsslkrkndelsiafdtstpdhhskkqkvehiksesiGVETLTSS.vLES..TVDS.S..T....DD.PN..TS.K..K...HK..KK.K..KKKE..........................................................KDMS------D------------...---..-----..---...................---------------yissikseklgsddsgigshkshkkkkkrkhke.......................................................................................................................................................................................
C1GAN7_PARBD/248-411                  .........................PERGQQL.EGWI..NVQSDGFLGAVVYNLFSVG..I.E.R.R.R.........................L..PA......................D.WQWVA...........................................................................................................................PGEGSTAT.pKSN..NTSN.S..A....AV.TD..DD.D..D...ED..SD.F..DSDKenfrplptrslasvldl........................sthsqynhthndpiqlsANPDEAATAGFFRTRSGRRVRGM..iRFR..VRDVD..VIP..................gAEADKGFLSIEGTML........................................................................................................................................................................................................................
A0A2A4JKN2_HELVI/100-304              .........................PFVGATL.TGIV..NKKSTTHLGILIHRVFNVV..I.P.R.P.T.........................E.ePG......................N.-MWVGsniqegqevkfrivvldlfgalpyir.......................................................................gelddrsvnlgpdgdddeeiekkaaqT-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------invsyvdfdktkpysqkqigdglphstsknssrladaskyqlknnptsadnnmqavngksgstkthnvdseisvyektkvkrqsrlydseqkqseatpkpskkhkrdv............................................................................................................
A0A093ENN4_9AVES/41-247               .........................PKKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................I.VQWQElglkigdelkfkvlhldsdaagvffirggltkssmqskqsetitnsvsgd......................esqkldhqengldvsgadnvteehpgaidntgsenaeeqrvdavnglcddkN-------..---..----.-..-....--.-K..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------kkkkkkkhkqeeqehvlptsdssgyqsdhkkskkkkrkhcdeveeselsqlsqepkakkk............................................................................................................................................................
W3X4I0_PESFW/253-359                  .........................PTRGAWM.EGTV..NMQTEGHLGVVCWNMFNAS..I.E.A.G.R.........................L..PK......................G.WRWVS...........................................................................................................................--------..---..----.-..-....--.-L..LD.G..K...QG..SE.E..FTPE..........................................................DEDGQLHTTGYWVDKEGQRVRDK..iRFQ..IKNFE..V-G...................VSGDYGYLSIEGTML........................................................................................................................................................................................................................
A0A1Y2WMZ5_9PEZI/286-419              .........................PSRGASM.EGIV..NLQGEGHIGVVCWDMFNAS..I.E.A.S.R.........................L..PH......................G.WRWVDll.......................................................................................................................skDKDKGKDR.iKGK..KTDR.E..K....TV.EE..AK.L..P...TP..EP.L..EDQE..........................................................DDTTQMHTTGYWVDEAGQRIRGGa.kIYF..RIKHY..EVG...................VSGDYGYLSIEGTML........................................................................................................................................................................................................................
A0A2X0KGE6_9BASI/185-341              .........................PRVGQKI.VGSP..TLSTPSHVSLLLHNLFNAT..L.P.A.S.H.........................I..PS......................D.-EWRFdpdyvvpafirdrqk.............................................................................................mafpttsvtkaanedAEEAERTE.gGIE..ADAE.G..G....EE.KE..EE.L..A...QE..EE.A..RLAM..........................................................EEDEMYADRGWWVNVRTGEPMGG...EKG..SVEFT..IVS...................LTIANSMITITGSLL........................................................................................................................................................................................................................
A0A3P9BJ45_9CICH/166-382              .........................PQKGQKL.RGKV..NKLGISHVGCLVHGCFNAS..I.P.R.P.N.........................L..VT......................V.ETWRDagprigsevefdvtaldadtagvllirgrldktrvqellam.........................................cegtetsvpageedpeptqdaseetpkkkkkkkkvkeeeieE-------..---..----.-..-....--.--..--.-..-...--..--.-..---Eiptisacqldngvtpepng....................mrdevngneaaenkkkkkkKKEKRIKEEEEEMDVSQVAVHGS..dSNG..Y----..---...................---------------isdkpskkrkresgndvtssfse.................................................................................................................................................................................................
A0A1Y1XTL9_9FUNG/160-257              .........................PKKGIKL.VGII..NLQSQDHIGLLLYNTFNAS..I.P.A.E.C.........................I..PK......................T.-KYEW...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..RQ.E..TTEA..........................................................SESEEAPVTGEWVFKHNGTPIGT...-DG..WLEFT..VED...................LVKANDMITVSGSL-i.......................................................................................................................................................................................................................
A0A1D8PS34_CANAL/126-219              .........................PEVGDVL.EGDI..YMQTPSHIGLLICDTFNAS..I.K.K.Y.N.........................I..PN......................T.WSFVP...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.N..QIDE..........................................................VSSDDRKTFGHWVDESKTKVEGK...---..-LQFT..IKA...................IHTTGRIVSVEGTL-i.......................................................................................................................................................................................................................
A0A397GWE2_9EURO/180-338              .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PT......................N.WKWVPp.........................................................................................................................gE-EEEDGS.nSGE..KPKK.KvfS....ST.ED..DD.S..S...EP..SS.-..---Dfnpekehfkpialas............................danpfsetmesnngpAEDDEAAAEGYFQSVSGHRVRGT..vRFR..VVDID..VIP..................gSDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A5A8C9B1_CAFRO/86-305               .........................PQPGQEM.TAVV..TSVSAAHIGALVCGTFNAT..V.A.E.D.Q.........................L..GE......................Y.-AFDAeeaswnp............................................................................................................kagdgapvR-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------agdavtlrvvackagrglvtveaslvdclgsdhpvaraaaeepnfgagiiqsvpaargtkrpgkrsreaaaaaaaaavaaaaapgssataatadapsastsaasssaasgalaaegvdssgkrprlsadadvgataaaaatddavgkpakkskkskkskgs.......................................................
A0A179HL03_PURLI/277-390              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGRFNAS..V.E.A.R.R.........................L..PP......................S.WRWVS...........................................................................................................................--------..---..--NE.S..I....EA.HG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQVHSTGFWVDGQGERVKGK..vRFR..IRNFD..A-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
A0A5C3ESU8_9BASI/156-257              .........................PKIGHRL.EGTI..TLSSPSHVSLLLYGTFNAS..I.P.A.S.H.........................L.sKD......................S.WEFVI...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...-D..AE.A..DLHV..........................................................HGMGADRGLGHWRSKADGSRLGG...DDG..RLSFT..VIS...................MTVANHILSLHGSLL........................................................................................................................................................................................................................
A0A5C3PRV1_9APHY/155-278              .........................PQVGMKL.SGKI..NLSSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..TT......................D.-SYEF...........................................................................................................................---EYGPA.eNDP..EFGA.G..Q....DG.PA..AA.S..A...AA..EG.E..ATEE..........................................................GTEGHVDSGGRWVHKTTGTKLGD...ADG..YLEFT..VVG...................LTIANQMLSLVGSI-q.......................................................................................................................................................................................................................
A0A1L9T3P4_9EURO/189-359              .........................PQRGQTL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PQ......................T.WKWIP...........................................................................................................................PGEEDFAE..NSE..PTSN.N..T....SA.QT..SE.D..E...DD..EE.A..SN-Stpfdpakehfnpvptasdsnp...............faydstdqdqdatgagnaeqggDGSEEETYEGYFQSISGHRVRGT..vKFR..VVDID..VIP..................gSERDRGFLSIEGTML........................................................................................................................................................................................................................
K2QVW6_MACPH/181-289                  .........................PRKGVWI.EGAV..NLQNESHLGLVCWNLFSAS..I.D.R.R.R.........................L..PE......................D.WAWVE...........................................................................................................................--------..---..----.-..-....--.-A..GE.A..A...AE..AM.E..GDDA..........................................................AAQTSSAAQGHFVDGQGKKVDGV..iKFR..IRDFD..SSP..................rTENDRGFITIEGSLL........................................................................................................................................................................................................................
A0A095EJ74_CRYGR/130-241              .........................PKIGQKL.RGIH..SISSPSHLSLIFAGAFNVS..I.P.I.Q.H.........................I..PA......................D.-LFEF...........................................................................................................................--------..---..-EET.D..E....VV.AT..KS.E..D...GS..EV.E..YIDK..........................................................S-EMEMEETGRWRNKETGEFFGK...-RE..LVKFT..VIG...................MQVTNQMLSLTGSLL........................................................................................................................................................................................................................
G9MJU5_HYPVG/120-233                  .........................PSRGAWM.EGSI..NLQTEGHIGVVCFGQFNAS..I.E.A.R.R.........................L..PS......................A.WKWVS...........................................................................................................................--------..---..--NE.D..P....EA.HG..ME.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWVDANGKKVKGK..iRFR..IRNFD..V-G...................VSGETSYLSLEGTML........................................................................................................................................................................................................................
A0A0D1ZP40_EXOME/276-412              .........................PERGDEL.YGWT..NVTSEGFIGLVSYNYFQSA..I.G.Q.N.R.........................I..PQ......................E.WTWNGphkg...................................................................................................................qggkGRKGRKAR..LRD..EDGT.S..K....EQ.DI..DM.L..D...EG..SQ.P..QDPA..........................................................GPTESTDEIGFFTDETGNKVSST..lTYR..VLDTE..VVP..................gHDRHTWSLQIDGTLL........................................................................................................................................................................................................................
A0A2J6QBT7_9HELO/160-264              .........................PEKDALL.EGYV..NLQNPGHLGIVCWNLFNAS..I.E.S.K.R.........................L..PS......................D.WKWKD...........................................................................................................................--------..---..----.-..-....--.--..-V.S..E...LR..NK.E..GIEA..........................................................GETYAEEGPGFWVDGEGNKVEGI..vKFR..VREIE..-SS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A5D6Y8T1_9STRA/88-265               .........................PCEGMML.RGAV..NKIGSNHVGMLFAGVFNGS..V.A.A.S.A.........................L..PK......................G.FVHNYaqdawyvtqrlvhvaggmiaieasmrgvkqsaktass.................................................saavaskpakssttkiakapktvgkvekkakkstksgS-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------tgaeasatskpskkssksssepvesapkaskkrkssdaaaapvveepkkskkkkskkde.............................................................................................................................................................
G7DT34_MIXOS/166-310                  .........................PELLTRL.EGRI..TNSTPGHISLLVYDLFNAS..I.A.R.Q.H.........................I.dLR......................A.YRYDPdra.....................................................................................................................vprPREKKRKR.kERN..NSQD.H..V....LF.ET..AD.Y..E...AT..SD.S..QGDAgllrp................................................dptvpLEDTMHSEQGQWVHRKTNEVLGD...QTG..HLSFT..VVG...................LTFANLMISIKGSLL........................................................................................................................................................................................................................
A0A1Q5ULC8_9EURO/175-320              .........................PQRGQTL.EGWV..NVQSEGFLGAVLLNLFSVG..I.E.R.K.R.........................L..PT......................S.WTWVPpgedcets...........................................................................................................egavkdltT-------..---..----.-..D....DE.SG..VN.A..V...PP..SF.D..AEKElfqpaala..........................................adeldidgEAEEEEAASGHFQSISGHKVRGN..iKFR..VVDID..VIP..................gSERDRGFLSIEGTML........................................................................................................................................................................................................................
A0A6J2AEF5_ACIJB/125-332              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................E.-QWQIleinvgdelefevfrldsdaagvfcirgklntsslqtkcstvseevtetgt.....................eeivekplkkkkkkktdpepyevesdnreladfadvtvkeetnlqinntngF-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------qneepkkkkkkrhqedqdpvfqgsdssgyqsdhkkrkkkrkhseeaeftpllehsskkkre...........................................................................................................................................................
A0A4Q7JHM4_METCM/285-398              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................A.WKWVS...........................................................................................................................--------..---..--NE.S..P....EA.HG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWVDGNGDRVKGK..vRFR..IRNFD..A-G...................TSGDTSYLSLEGTML........................................................................................................................................................................................................................
A0A091VU76_OPIHO/41-247               .........................PRKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................I.AQWQElglkigdelkfqvlhldsdaaglffirggltkrsmqpkqsetvtdsangg.......................eiqkldhqenglndsggdtvteeplgetgnagredaeaqsvnavhglcddK-------..---..----.-..-....--.SK..KK.K..K...KK..HK.Q..KEQE..........................................................HVLPTSDSSGYQSDR--------...---..-----..---...................---------------kkskkkkrkhceeveeselsqlsqepkakkkr........................................................................................................................................................................................
A0A5N6DEW1_ASPPA/188-336              .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEGSVS.gDQQ..KTAT.A..S....ED.DE..SE.P..S...AS..FD.Q..EK-Ehfnpvslanp......................................vsdtlneeanAEDDESAAEGYFQSVSGHRVRGT..vRFR..VVDVD..VIP..................gSERDRSFLSIEGTML........................................................................................................................................................................................................................
A0A4U0UCY0_9PEZI/299-407              .........................PHQGSYL.EGHV..NLQNESLLGMVCYNYFNAG..I.E.W.N.Q.........................L..PK......................D.WRWVS...........................................................................................................................--------..---..----.-..-....--.-D..EG.G..A...LD..VG.M..SRGK..........................................................GKKAAQEGEGHWVDAEGNKVEGR..lVFR..VRDFE..ATP..................gSDSGAGSINIYGSLL........................................................................................................................................................................................................................
A0A0D1ZF82_9EURO/243-379              .........................PERGDEL.HGWT..NVTSEGFVGLVSYNYFQTA..V.H.E.S.R.........................I..PK......................S.WIWNGptke...................................................................................................................qlgkIKKKAKKA..RLR..DDSD.E..N....EV.KA..DG.A..V...EV..ED.S..AAAP..........................................................YQDRLQDDGGFFTDASGSKIPPT..lRFR..VVDTE..VVP..................aHDRTKWSLQIDGTLL........................................................................................................................................................................................................................
A0A395IVE2_9HELO/154-258              .........................PEKGAWL.EGYI..NLQNEGHLGLVCWNLFNAS..I.E.R.A.R.........................L..PK......................E.WRWVG...........................................................................................................................--------..---..----.-..-....--.--..-V.A..E...QE..ND.A..EAEE..........................................................GATYAEDGIGYYVDGEGKKIEGT...---..-VKFQ..VKEie...............snHDKERGFLTIDGTML........................................................................................................................................................................................................................
A0A672KL76_SINGR/153-384              .........................PKKGSKL.VGVI..NKMGVGHVGCLVHGCFNAS..V.V.K.P.S.........................L..LS......................S.EQWRDsglsvgqnlefevfqldadtagvllirgrleksrvqelvaqtehkesmvelttep.............estedtidspkpkkkdkhekesqndrgleltsenhqtaadtaeidsnanghhkekK-------..---..----.-..-....--.--..--.-..-...--..-R.K..K---..........................................................-----------------------...---..-----..---...................---------------kdkraemdsnanghhkekkrkkkdkrqesdeilpselstsdssryvsdktsrkraaesndglqdapaakkkkks..............................................................................................................................................
A0A1E3BUX5_9EURO/169-318              .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PT......................N.WKWIP...........................................................................................................................PGEEAPAA..NKT..DDES.E..S....DA.PT..KN.F..D...PE..--.-..---Kelftpvslasdan...............................plsettpnpapegqEEGEDESAEGYFQSVSGHRVRGT..vRFR..VLDID..VIP..................gTDRERGFMSIEGSML........................................................................................................................................................................................................................
A0A5N6V4C1_9EURO/188-336              .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEGSVS.gDQQ..KTTT.A..S....ED.DE..SE.P..S...AS..FD.Q..EK-Ehfnpvslanp......................................vsdtlneevnADDDESAAEGYFQSVSGHRVRGT..vRFR..VVDVD..VIP..................gSERDRSFLSIEGTML........................................................................................................................................................................................................................
A0A1E1JQT7_9HELO/160-263              .........................PEKGAWL.EGYV..NLQNEGHLGLVCWNLFNAS..I.E.R.K.R.........................L..PS......................D.WKWKD...........................................................................................................................--------..---..----.-..-....--.--..--.V..S...DA..RE.G..WEGE..........................................................GETYAEEGSGHYVDGEGKKIEGM..vKFR..VREIE..-SS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
K3WSG0_GLOUD/86-133                   .........................PKEGMVL.KGTV..NKIGSNHIGMLFAGVFNGS..V.A.A.S.E.........................L..PK......................G.YVHNY...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------aqda....................................................................................................................................................................................................................
A0A087SHR1_AUXPR/83-219               .........................PKPGCRL.VGVV..NKVGRDFIGLLVAGIVNAS..I.G.A.D.A.........................I..RA......................D.LASRPaqsawvslcnprhvisigttvvfdvlsv..................................................................tqtgqfvslkgalrepdtgavevvgypgqPRKEVAVA.eEAH..KEEN.G..K....ST.AK..RK.R..R...ES..A-.-..----..........................................................-----------------------...---..-----..---...................---------------gdaaatf.................................................................................................................................................................................................................
A0A3P9N5U6_POERE/137-366              .........................PKKGQKL.LGKV..NKLGVSHVGCLVHGCFNAS..I.P.K.P.N.........................L..VS......................V.ETWRDggpsigtelefkvmtldadaagvllirgqldrtrvq..................................................elmamsensessvpadqedpqeaepapetkeaelapeT-------..---..----.-..-....--.--..--.-..-...TH..DG.T..PKKK..........................................................KKKKKEKEKERIKEEETEEQ---...---..-----..---...................---------------itktppglngsteqtnssdtperkkkkkkekhvkeeeermevsalenhrgfgdkpskkrklesgtdapsgddvtpkkskkkkk.....................................................................................................................................
A0A6G1QYI8_9TELE/141-358              .........................PKKGQRL.LGKV..NKLGVSHVGCLVHGCFNAS..I.P.K.P.N.........................L..VS......................V.ATWRDsglragaelefevtaldadtagvllirgrlertrqvvqelmamge................................ssessipgdlpdapdteptpetaeespeetpkkmkkkkknkvnvgeR-------..---..----.-..-....--.--..--.-..-...--..--.-..---Eeevmpscqndsnttle..........................lngitdeansseagdkKKKKKKKKKEKYLKDEEEEIEV-...---..-----..---...................---------------samavhgsdisgyvsdkpstkrkhdtg.............................................................................................................................................................................................
A0A5B0QPS5_PUCGR/168-285              .........................PTIGQKL.VGRP..TLSSPSHLSLVIYRTFNAS..I.N.E.N.H.........................L..RA......................A.-GFHY...........................................................................................................................-------D..INF..EVPA.H..W....KS.IV..EP.A..N...PQ..DQ.S..LSTN..........................................................LPLEHHQDRGCWVDANGAVVGDD...-QG..TVSFT..VMG...................LTIANHMISVVGSLL........................................................................................................................................................................................................................
V4A100_LOTGI/99-136                   .........................PYVGCTL.KGVV..NKLSQGHIGCLVHKHFNAS..V.P.R.-.-.........................-..--......................-.-----...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------pfkna...................................................................................................................................................................................................................
A0A0D2DN57_9EURO/240-374              .........................PERGDEL.HGWT..NVTSEGFVGLVSYNYFQTA..V.H.E.S.R.........................I..PK......................S.WRWNGptk.....................................................................................................................eqaGKTKKKAK..KAR..LRDA.E..N....EV.RE..DE.T..V...DV..EE.S..SAAP..........................................................YQDRLQDDGGFFADASGSKIPAI..lKYR..VVDTE..VVP..................aHDRSKWSLQIDGTLL........................................................................................................................................................................................................................
A0A166WDK6_METRR/289-402              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................A.WKWVS...........................................................................................................................--------..---..--NE.S..P....DA.HG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWVDGEGDRVKGK..iRFR..IRNFD..A-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
U5HHQ1_USTV1/186-342                  .........................PRVGQKM.VGSP..TLSTPSHVSLLLHNLFNAT..L.P.A.S.H.........................I..PS......................D.-EWRFdpdyvvpafirerqk.............................................................................................mafpttsatktaneeAEEAERTE.eGIE..ADAE.G..G....EE.KE..EE.L..A...QE..EE.A..RLAM..........................................................EEDEMYADRGWWVNVRTGEPMGG...EKG..SVEFT..IVS...................LTIANSMITVTGSLL........................................................................................................................................................................................................................
B8A0V9_MAIZE/104-257                  .........................PQPDMIL.EGMV..EMIGKESIHAIVLGVFSVA..I.M.S.E.D.........................I..KF......................K.FKWKSdggkfvsltdkkhviergtmirfsvk......................................................................rvdtemschitgslipphtgcmrwlsvHDPKYASE..LKS..GESR.S..R....DT.SI..KI.E..Q...NE..QE.H..RILK..........................................................NEDGMVKSERPYKSRKRG-----...---..-----..---...................---------------rhiek...................................................................................................................................................................................................................
A0A6P3QD67_PTEVA/125-278              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................E.-QWQTleinvgdelefevfrldsdsagvfcirgk.................................................................lnttslqtkcsavseevteigteedvekpPKKKKKKK.kDPE..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------pyevesgtteltdfadvtmkeetdlqvnndmnglweeepk................................................................................................................................................................................
A0A444TB00_ARMVU/100-303              .........................PEIGSIL.KGKV..VKKSPNHVGCLVHNIFNASssI.P.N.G.-.........................I..TK......................E.-SWCGnsiregdslemkitelnltcavpfl........................................................................kgdiipesiclvskdlpnirikeekaE------D..EDS..GISG.V..E....KP.ND..ED.I..E...SE..SE.N..KKKK..........................................................KKKKKNSAVENIVEES-------...---..-----..---...................---------------iespkkskkrkrnnlensnddleegveklskkiklenssenlsdenmgedtkkkkkkkkkikees.......................................................................................................................................................
G4UFD2_NEUT9/113-161                  .........................PARGKWM.EGVV..QLQSEGHIGVQCWGRFNAS..I.E.A.K.R.........................L..PK......................G.WKWVV...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------eqvht...................................................................................................................................................................................................................
A0A1Y2G1K6_9BASI/162-323              .........................PRVGQKI.VGSP..TLSTPSHISLLIHNLFNAS..I.P.A.S.H.........................I..QT......................N.-DYHFdpefpvpeaiqkrqqls........................................................................................fpsaiveeekteqeeveeKAEVADEE.eLAE..LEDR.K..A....DE.EV..EE.D..K...EE..EE.I..DEEA..........................................................QEEEAYREKGWWRHNVTNEPLGG...DEG..RIEFT..IVG...................ITIANSMISLTGSLL........................................................................................................................................................................................................................
A0A1Y1UW01_9FUNG/84-142               .........................PQKNLEI.VGKV..NKVSADHIGLLLYGVVNAS..I.P.S.D.K.........................I.rKK......................N.FKWDE...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------nsfawketfgerrk..........................................................................................................................................................................................................
N1JFA8_BLUG1/157-261                  .........................PEKGASL.EGYI..NLQNDGHLGVVCWNLFNAS..I.E.R.K.R.........................L..PA......................D.WEWRD...........................................................................................................................--------..---..----.-..-....--.--..-G.C..E...AQ..MD.E..DDKD..........................................................NQPLAGESSGYYVDGHGEKVEGM..iKFR..VADVE..S-S...................QDRERGFLTIMGTML........................................................................................................................................................................................................................
A0A1Y1MRS7_PHOPY/102-347              .........................PEVGQIL.VGVV..NKKSKDHVGCLLYNTFNVS..L.P.K.P.Edqd..................veswS..--......................-.----Gtyseigneikfritfmklqarlpyirgqlidedspkrkknkiltv................................vaeetpttskkkkkkkdvdldeeylpngfgssessikteindtsvkE----SKK..RKR..ESME.E..S....PK.KK..KK.L..E...QM..ED.G..HK--..........................................................-----------------------...---..-----..---...................---------------kskrkksinenefnineklkqendselsdtpnldidisidnlisnelsnrshkkkkrnkgdtlevvgdadslgqntviskkkr.....................................................................................................................................
A0A1Y2J3H3_PYCCO/137-251              .........................PQVGMRL.AGKI..NLCSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..TT......................D.-EYEF...........................................................................................................................--------..---..EYGP.A..E....ND.PE..FG.A..Q...DT..EQ.D..PAPE..........................................................GTEGHVEDGGRWVHKVTGTKLGD...AEG..YLEFT..VIG...................LTIANQMLSLVGSI-q.......................................................................................................................................................................................................................
A0A395H9J7_9EURO/176-343              .........................PQRGQIL.EGWV..NVQSEGFLGAIVLNLFSVG..I.E.R.K.R.........................L..PP......................S.WKWIP...........................................................................................................................PGEEQE--..EEE..QQQS.S..S....ST.AP..AD.E..E...EE..GD.S..DSSSqqknktpfdpekelfrpial.................asdvnpladtdtteggntntnDEDEDAAAEGYFQSVSGHRVRGT..vRFR..VVDVD..VIP..................gSERESGFISIEGTML........................................................................................................................................................................................................................
S2K2S0_MUCC1/126-243                  .........................PKRGTKL.VGRI..NLQSEDHIGLLIYGTFNAS..I.P.K.S.R.........................I..PS......................S.-TYEW...........................................................................................................................-------K..INE..EEAV.E..E....AI.QE..AD.E..D...ED..EG.T..TEAA..........................................................AEERTRTQYGEWINKATGSSIGG...EDG..TLEFN..VMD...................IIEANDILTVTGSL-........................................................................................................................................................................................................................
A0A3S0ZVB3_ELYCH/79-223               .........................PRPGLIL.EGII..NKQSYSHLGCLVLGIFNASlsI.P.D.N.Ee.......................mI..PQi...................gdS.VSFVVtevvvdgeimfmr................................................................................................gslesitnranppkQ---EKEE..---..----.-..-....-L.EE..TK.P..E...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------atqlskaptiktepvdnstyeqedsqpsltvsrvtvksempssdsespsksskkk.................................................................................................................................................................
A0A0G4N036_9PEZI/671-788              .........................PKRGAWM.EGSI..NLESEGHVGVVCWGKFNAS..I.E.S.A.R.........................L..PP......................A.WRWVH...........................................................................................................................--------..-LG..TDET.A..A....TS.AH..DD.T..V...SN..FT.A..EEQH..........................................................GAVRQIHATGYWVDEAGQKVKGR..vRFR..IKAFD..V-G...................VSGDHGYLSLEGTML........................................................................................................................................................................................................................
A0A2I0MQU4_COLLI/84-291               .........................PKKGKKL.VGVV..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................I.IQWQElglkigdelkfrvlhlesdaagvff........................................................................irgeltksslrpkqtetitdstnadeT-------..---..----.-..-....--.--..--.-..-...QK..LD.H..QENGlndsqednvtee.................................plpemdstagenaE----------------------...---..-----..---...................---------------eqsvdaanglcdvkkkkkkkkhkeeeqghvlptsdssgyqsdhkkskkkkrkhcneaeeselsqlsqeprakkkrae...........................................................................................................................................
A0A423VQL2_9PEZI/219-347              .........................PSRGAWM.EGEI..NLQSEGHIGVVCFGKFNAS..I.S.R.R.S.........................L..PK......................G.WTWVD..........................................................................................................................qPDEEDEVA.eEVE..EEQE.Q..E....DP.FT..EN.G..G...GD..NE.D..GNKA..........................................................EDTHQVRSSGHWVDENGDRVGGK..vHFR..IKNFS..-SG...................SSGDFTYLSLQGTML........................................................................................................................................................................................................................
A0A4Z2H987_9TELE/126-352              .........................PENGQKL.LGKV..NKLGMSHVGCLVHGCFNAS..I.P.K.P.G.........................L.vSV......................D.-TWWAagprigadlefdvtaldadtagvllirgrldstrvqellaigessesgfpadqs..............eppetepnpvpaeespvdtpkkkkkrgkvkeekddevtstpscqvdgntpelngtIAEANGAV..EKK..KKKK.K..K....KK.HV..KE.E..E...EQ..EE.V..VIST..........................................................MEVQGSDSSGYLSDKPSKKRRRE...TAS..D----..---...................---------------vasslskvpespk...........................................................................................................................................................................................................
A0A395NRQ7_TRIAR/243-356              .........................PSRGAWM.EGSI..NLQTEGHIGVVCFGQFNAS..I.E.A.R.R.........................L..PS......................A.WKWVS...........................................................................................................................--------..---..--NE.D..P....EA.HG..ME.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWVDGNGKKVKGK..iRFR..IRNFD..V-G...................VSGETSYLSLEGTML........................................................................................................................................................................................................................
B2VQJ4_PYRTR/121-225                  .........................PVQNAYV.HAHV..TDQAKTHITLAYLNTFPVS..I.L.A.S.C.........................M..PS......................D.WSWHS...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...QE..TG.K..MKRA..........................................................WDGRLSDEGGWWVNDFGDKVEGDlrvRIR..DVDGR..MDG...................KGKGKGFLRIDGSL-i.......................................................................................................................................................................................................................
A0A139WJY5_TRICA/38-204               ......................ptr----KIL.EGVV..HKKTKDHVGCLVHKIFNVS..L.P.K.-.-.........................-..PK......................K.HEWLGenlnpgsriqleitstnfegklpyikgriinvldatpnvlne.......................................snnkivfeenldetvtksskkkakkiifdesfndeslnfdtlI-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------keepeislkkskkktkrkaevdedieppikkkkkkhvqedss..............................................................................................................................................................................
B9GDH8_ORYSJ/81-234                   .........................PQPDMIL.EGKV..ELLGKESIHAIVLGVFSAA..I.M.A.D.D.........................I..NE......................K.FKFKRkgdggkfisrsdrhhvirkgsmirfsvkrvdtemnch................................................itgsllpphtgsmpwlsthdaeyaseissgtrrpsnvgI-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------kikneqdhktsdnedsvinserphkksrkrawee......................................................................................................................................................................................
C4Y684_CLAL4/129-230                  .........................PQIGDVL.EGNV..YMQTASHIGLLVHDTFNAS..I.R.S.R.N.........................V..PQ......................D.WQFIP...........................................................................................................................--------..---..----.-..-....--.--..SQ.E..D...EF..ET.E..QSQE..........................................................NASSKFRSYGYWSDAEGTKVEGK...---..-ITFT..VRS...................IHTTGKMLSLEGTL-v.......................................................................................................................................................................................................................
A0A669PTL8_PHACC/114-322              .........................PKKGKKM.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.KpE.H.........................M..SA......................A.-EWQKlgfkigdelkfqvvhldsdaagvffirgqltktsmqpkqsdpvtdavt..........................dgtngeqiqdfdnekndlndsggdnvtedppgeadntvggnteeqsidaE-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------neicddkkkkkkkkkhkqeeqehvlpasdssgyqsdlkkskkkkrkhceveesellelsqepkakkk.....................................................................................................................................................
A0A232LWP0_9EURO/178-332              .........................PQRGQTL.EGWV..NVQSDGFLGVVVFNLFSVS..I.E.R.R.R.........................L..PT......................D.WEWIH...........................................................................................................................PRGEEGER.eREG..KNRR.L..A....KG.SS..AG.V..S...T-..--.-..---Rlnhgfdpekehftpls..........................kpltdgpvdsvnhleqEQDWDSTSMGYFRSISGHRVHGT..iKFR..VHDVD..VIP..................gADTDRWSLSIEGTML........................................................................................................................................................................................................................
A0A317VWH7_9EURO/98-265               .........................PQRGQIL.EGWV..NVQSEGFLGAIVLNLFTVG..I.E.R.K.R.........................L..PP......................S.WKWIP..........................................................................................................................pG-EEQEEE..--Q..QQQL.S..S....ST.ED..AH.E..E...DE..ED.S..DSSSqqknktpfdpekelfrpial.................asdvnpladtdtneggnnttnDEDEDAAAEGYFQSVSGHRVRGT..iKFR..VVDVD..VIP..................gSERESGFISIEGTML........................................................................................................................................................................................................................
F0XRN0_GROCL/199-334                  .........................PSRGAWL.EGTV..ILQNEGSIGVNCWEKFNAS..I.E.A.S.R.........................L..PR......................G.WKYVDcngs...................................................................................................................ldngHVDKADNG.nRGE..GDEE.K..Q....ED.EN..KN.G..E...LE..KD.K..EGQQ..........................................................PLAAHIQTTGHWTDETGMPVKGS..iSFR..IKDFD..V-G...................LAGDNGYLAIEGTML........................................................................................................................................................................................................................
J7RYQ9_KAZNA/125-249                  .........................PQVGDIL.EGNI..FIQSASHIGLLIHDSFNAS..I.K.K.N.N.........................I..PY......................E.WVFVH...........................................................................................................................NEENEHED..EDS..RTNE.G..N....VN.SN..DS.N..R...PNggRN.S..TSGN..........................................................AGFRKNVSMGHWVDQNAQRIDGK...---..-LRFR..VRN...................VYTTGRVVSVEGTLL........................................................................................................................................................................................................................
C5YPA7_SORBI/144-297                  .........................PQPDMIL.EGKV..EMLGKESIHAIVLGLFSVA..I.M.S.E.D.........................I..HE......................K.FRFKRksdrgkyvsrtdkhhvikrgtmirfsv....................................................................krvdtemnchitgslipphtgcmrwlsvH-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------dteyaselksgesrprdtsikfeqneqehrilknedgmvkserphksrkrrhte..................................................................................................................................................................
A0A6J3CQP9_AYTFU/111-316              .........................PKKGKKM.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................A.VEWQElglkvgdelkfrvshldsdaagvffirggltktsmqpkisesitdcang.........................eetqnleheknslndsggdnvmeeppdetgntgrdnaeeqsvvpvngicD-------..---..----.-..-....DK.NK..KK.K..K...KK..HK.Q..EEQQ..........................................................QIMPASDSSGYQ-----------...---..-----..---...................---------------sdhkkskkkkrkhceveeseltqlpqepkakkkr......................................................................................................................................................................................
A0A0D1E694_USTMA/152-245              .........................PRIGQML.EGNI..CLSSPSHVSLLLYGLFNAS..I.P.A.S.H.........................L..PE......................E.FEFVL...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..---N..........................................................DAEATDHGMGYWRSKVDGSKLGA...SDG..KLSFT..VIS...................LTVANHMLSLHGSLL........................................................................................................................................................................................................................
A0A421JM36_9ASCO/118-216              .........................PQIGDVL.QGDI..YMSTASHLGLLICDTFNCS..I.K.K.Y.G.........................I..PR......................D.WRFVP...........................................................................................................................I-------..---..----.-..-....--.--..--.-..-...QQ..DE.F..EEEE..........................................................AGQGRMKNFGYWVDENEVKVEGK...---..-LTFT..VKA...................LHTTGRVVSIEGTL-i.......................................................................................................................................................................................................................
A0A420HIF9_9PEZI/148-252              .........................PKKGTRL.EGVI..SLQNDGFLGVVCWNLFNAS..I.E.R.S.K.........................L..PR......................D.WKWRE...........................................................................................................................--------..---..----.-..-....--.--..-A.G..D...VN..QF.E..DLDH..........................................................MILHGEDNTGFYVDGQGKKIDGT...---..-IRFI..VVEie...............snQNSERGFLSIVGTML........................................................................................................................................................................................................................
A7E6K9_SCLS1/158-262                  .........................PEKGAWL.EGYI..NLQSEGHLGLVCWNLFNAS..I.E.R.T.R.........................L..PK......................E.WKWIG...........................................................................................................................--------..---..----.-..-....--.--..-V.E..D...QE..KN.E..EAEE..........................................................GATYAEDGIGYYVDGEGKKIEGT...VKF..RVKEI..ESN...................HDKERGFLTIDGTML........................................................................................................................................................................................................................
A0A2P4TF30_BAMTH/114-336              .........................PKKGKKM.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.KpE.H.........................M..SA......................A.-EWQElgfkigdelefravhldsdaagvffirgqltktsmqpkqsdpltdavtdgt....................ngeqiltdavtdgtngeqiqdfdseknglndsggdnvtedplgeadntvggnTEEQSIDA.vNEV..CDDK.K..K....KK.KK..KK.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------hkqeeqelvlpasdssgyqsdlkkskkkkrkrceveesellelsqepkakkk....................................................................................................................................................................
A0A1Y2VWU1_9PEZI/275-404              .........................PTRGAWM.EGTV..NLQGEGHIGVVCWDMFNAS..I.E.A.G.R.........................M..PR......................G.WRWID...........................................................................................................................LLSKGKEN.gKNK..NKNK.E..K....TA.EE..AS.L..P...TP..EP.L..EDPE..........................................................DDTTQIHTTGYWVDENGARIRGG...AKL..YFRIKhyEVG...................VSGDYGYLSIEGTML........................................................................................................................................................................................................................
A0A167Y4T9_9PEZI/250-367              .........................PSRGAWL.EGDL..ILQNEGAIGVNCWEKFNAS..I.E.A.A.R.........................L..PR......................G.WTFVE...........................................................................................................................--------..-QD..SAGA.A..D....AT.DA..AS.E..G...DH..NN.T..DGAD..........................................................ALPAQMHTTGYWVDAAGKPVAGK..iLFR..IKDFD..V-G...................LAGDNGYLAIEGTML........................................................................................................................................................................................................................
L9KG29_TUPCH/133-336                  .........................PEPGQKL.MGTV..NKVSSSHVGCLVHGCFNAS..I.P.KpE.Q.........................M..SA......................E.-QWQTleinvgdelefevyrldsdaagvfcirgklnitsfkskcseaseevetgieep................vekppkkkkkkkkdpetcevdgdtpelanfadatlkeeteqqipnnvnglweeeP-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................----------------KKKKKK-...---..-----..---...................---------------kkhrenqeqdpvfqgsdssgyqsdhkkkkkkrkhseeaelgplleh..........................................................................................................................................................................
A0A4W3HBB1_CALMI/114-273              .........................PEKGQKL.VGVV..NKVAPSHLGCVVHGCFNAS..I.P.K.P.Y.........................H..EN......................G.-TWPGfevkvgnnlqfevvhldadv...................................................................................vgvlcirgkldpnsvqaeynVESEKTLE.nNSN..ETPL.E..N....GN.NH..TA.D..Q...TP..GK.K..KKKK..........................................................KKKHKRKNDEEFSTQDTPEEASE...TVE..LMD--..---...................---------------lslledgvhktng...........................................................................................................................................................................................................
G0SUL0_RHOT2/162-271                  .........................PRVGMKV.VGTL..TLATPSHVSLLLHNLFNAS..I.P.S.S.H.........................I..PT......................S.-TYEY...........................................................................................................................--------..---..----.-..D....PE.CP..VP.A..V...VL..ER.R..TATV..........................................................PFATNVAKVGWWVHRKSREPLGG...ADG..RLEFT..LVD...................LTNTNSLLSCTGSLL........................................................................................................................................................................................................................
J4GJA6_9APHY/135-250                  .........................PQVGMKL.VGKV..NLCSPDHIALLVHRTFNVS..I.P.R.H.H.........................I..PT......................H.-DWEF...........................................................................................................................--------..--E..YGPA.E..N....DP.EF..GT.D..I...MD..EN.V..LETG..........................................................ENTPVVEGGGRWVHKLTGAKMGG...DDG..RLEFT..VVG...................LTIANQMLSLVGSV-q.......................................................................................................................................................................................................................
A0A319ECY4_ASPSB/177-344              .........................PQRGQIL.EGWV..NVQSEGFLGAIVLNLFTVG..I.E.R.K.R.........................L..PP......................S.WKWIP...........................................................................................................................P---GEEQ.eEEQ..QQQS.S..S....ST.EN..AQ.E..D...EE..GD.S..DSSTqqknktpfdpekelfrpial.................asdvnpladtdtneggnnntnDEDEDAAAEGYFQSVSGHRVRGT..vRFR..VVDVD..VIP..................gSERESGFISIEGTML........................................................................................................................................................................................................................
A0A1Y1WID1_9FUNG/105-228              .........................PIGGMSV.KGRI..NVQSPDHIGLLLWDTFNAS..I.P.A.S.Y.........................I..PK......................D.-KYEWrafddee.............................................................................................................iaarattVATKSESD.dSEE..SEDK.D..E....SE.ET..PE.E..E...QP..EE.P..AAAM..........................................................DFGDSKFGSGEW-----------...---..---FV..IVD...................VIRANEVLSVTGALL........................................................................................................................................................................................................................
F7BDD1_XENTR/121-468                  .........................PKCGQTL.VGIV..NKVAPTHIGCLVHGCFNAS..I.P.K.PpK.........................M..PI......................E.-NWQRigvniddeiefevfrldsdavg..............................................................................vfcirgkldrrmedkayetpceeT-------..---..----.A..E....QA.DD..GT.S..D...KD..AD.A..LESS..........................................................NMESSVQENGDVQEKAKKKRKKQ...---..-----..---...................---------------klqesltqeaestgdhsivtdpnlespgelhedisnkerkkkkhrnvpgqnsesdaekgvdstiledgnitespvnfkpkkskkkskeisnsnstsaflngvvedesfsesatvepeemtasggdpdkvkkkhkhsfveqipdsdlvtcissegsltkglvisqetpkakkhkakhqehllpgsgsgssqskhkkakrhhenepdtlaaepkikkr
A0A2K5JMW9_COLAP/125-269              .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWLTmeinmgdelefevfrldsd.....................................................................................aagvfcirgklnitslqfkR------S.eVSE..EVTE.N..G....TE.EA..AK.K..P...KK..KK.K..KKDP..........................................................ETYEVDSGTTKLAD---------...---..-----..---...................---------------dagdtpmeesalqntnnvng....................................................................................................................................................................................................
A0A642UHY9_DIURU/107-195              .........................PQLGDTL.EGHI..YMQTASHLGLLVNDTFNAS..I.K.K.H.N.........................L..PL......................G.WEFQA...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................SDADTDSRYGSWLDESGQRVEGK...---..-IKFT..VKS...................IHSSGRVVSLEGTL-v.......................................................................................................................................................................................................................
A0A6G0TR56_APHGL/90-249               .........................PPVGSII.EAIV..NQTSDNHVSCLVHNLFNVS..I.V.R.P.E.........................N.ePY......................D.-QWSGskikkddkidvrvlsfdltkklphit......................................................................geiikkkndkcydstdiqdsptkssssK------N.iVSD..FTKS.F..N....KN.TA..S-.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------pskssssdsesstemtnitmpkisadksiktsplsinttmkhsekv..........................................................................................................................................................................
G8BBJ9_CANPC/122-216                  .........................PSVGDIL.EGDI..FMQTPSHLGILICDVFNAS..I.K.R.Y.N.........................I..PM......................G.WSFTS...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..-N.Q..QDEV..........................................................VESGDKKSYGYWSDENGQKVDGK...---..-IKFT..VKN...................VYTTGRVVSIEGTL-i.......................................................................................................................................................................................................................
G8Y4K8_PICSO/130-228                  .........................PQVGDVL.EGYI..YMQTPSHIGLLLHDTFNAS..I.K.K.Y.N.........................I..PR......................T.WRFVP...........................................................................................................................--------..---..----.-..-....--.--..--.-..N...QE..DE.F..AEDT..........................................................KSSGSFKSYGYWVNENDLKVEGR...---..-LKFS..VKS...................IHTTGRVVSVDGTL-i.......................................................................................................................................................................................................................
A0A1V6TKY1_9EURO/156-295              .........................PKRGQTL.DGWV..NVQSEGFLGAVVFNLFSVG..V.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEAETP..ALT..DDDS.G..S....DK.EM..AD.F..D...AE..KE.C..FKPAalsae...............................................eiaidgEEEDESAHTGYFQSVSGHRVNGS..vRFR..VVDVD..VIP..................gSERDRGFLSIEGTML........................................................................................................................................................................................................................
H3AQL8_LATCH/135-344                  .........................PKKGKKL.MGVV..NKVAPSHIGCLVHGCFNAS..I.P.KpN.Q.........................M..PS......................G.-VWQGfgvkvgdelefevfhldsdaagvfcvrgkldrksvqskpsenwe..................................eetigtnhvelhhgapntpgkqkkkkrkaeeeldvwaidsaevsmAENPSDVA.eATD..TNGQ.S..E....VT.TT..TK.K..K...QK..GD.E..QEARl........................................................eTAVHGSDSSGYHSDGKTS-----...---..-----..---...................---------------kkkkrhlsetelgevaqepkak..................................................................................................................................................................................................
A0A6P9AAV3_THRPL/100-272              .........................PEIGCVL.KGIV..NKISNDHVGILVYQRFNIS..C.P.R.P.G.........................S.dAK......................S.AKWIGnkvvmhqevifklkeknfsgklpf..........................................................................fkgkimdignvvtglneqdkkpkkkS-------..KEI..VPDE.S..N....ST.ET..SS.Q.vT...KK..SR.K..HKLD..........................................................QSNEN------------------...---..-----..---...................---------------ievkakkskkevetlkrpvekdadvsvaaselssskkkkkkvsigs..........................................................................................................................................................................
A0A663EMP4_AQUCH/108-314              .........................PKKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................I.VQWQDlglkigdelkfqvlhldsdaagvffirggltkrsmkpkrsetvt..................................dstngdeiqkldhqendlndsggdnvteeplgetdntgrekgeeqS-------..VDA..VNGL.C..D....DK.NK..KK.K..K...KK..HK.Q..EEQE..........................................................-----------------------...---..-----..---...................---------------hvlptsdssgyqsdhkkskkkkrkhcdeveeselsqlsqepkakkkr.........................................................................................................................................................................
A0A512UM51_9ASCO/126-228              .........................PQIGDLL.EGFV..YMQTASHIGLLVHDTFNAS..I.K.Y.R.N.........................I..PQ......................D.WEFVP...........................................................................................................................--------..---..----.-..-....--.-S..QA.D..E...YA..ES.E..DAPE..........................................................NSSSKFKSFGYWTDASGTKIEGK...---..-VSFI..VKA...................IHTSGKMLSIEGTLL........................................................................................................................................................................................................................
A0A0P1B981_9BASI/202-345              .........................PQVGQRL.EGKL..TLSTSSHVSLLVHGTFNAS..I.S.S.M.H.........................L..PTseslalaesnstsferpnrgaqV.WSFVE...........................................................................................................................-----GYD.lDGV..GEHA.R..A....GA.ES..EH.H..Q...QQ..QQ.Q..EEEE..........................................................EEGDGRKSTGCWAKEDGGRLGGE...-NG..RIVFT..VIG...................LTITSHTLSLHGSLL........................................................................................................................................................................................................................
G9A064_TORDC/130-237                  .........................PQIGDVI.EGWI..FIQSASHIGLLVHDAFNAS..I.K.K.N.H.........................I..PA......................D.WTFVH...........................................................................................................................--------..---..----.N..E....EE.DA..ES.Q..S...RD..EN.D..QDDE..........................................................KSEFTRRSMDYWVDANGERIDGK...---..-LKFT..IRN...................VYTTGRVISVEGTLL........................................................................................................................................................................................................................
A0A1Y2LQM6_EPING/107-157              .........................PTKNSHI.TARI..VHSSKTHITLSYLNIFPVS..V.L.A.A.Q.........................L..PS......................G.WSFEA...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------gaagege.................................................................................................................................................................................................................
A0A402END0_9SAUR/121-301              .........................PKPGKKL.VGLI..NKVAPSHVGCLVHGCFNAS..I.L.RpD.H.........................V..TV......................D.-EWKNlgfqigdklvfkvlhfd........................................................................................sdaagvfcirgrlcksstGTKQPKEN..-CE..NQCE.E..Q....DD.TQ..ER.E..T...TI..E-.-..----..........................................................-----------------------...---..-----..---...................---------------tsgfvtgelqnkdpegeigaknpesareqdradlgmhasdssgyhsdhgqskkkkrklynedsghpgssqltakk.............................................................................................................................................
G0SAD7_CHATD/274-401                  .........................PARGKWM.EGVV..QLQNEGHIGVVCWNKFNAS..I.E.A.K.R.........................L..PK......................G.WRWVD...........................................................................................................................LAKGNANP.kPEP..PAEE.Q..P....QD.SS..KS.D..S...SD..AL.D..GEEL..........................................................QVIEQMHTTGYWVTAQGKRVSGK..lRFR..IKNFD..V-G...................LAGDYGYLSIEGTCL........................................................................................................................................................................................................................
A0A1L9NHU9_ASPTC/177-354              .........................PQRGQIL.EGWV..NVQSEGFLGAIVLNLFSVG..I.E.R.K.R.........................L..PP......................S.WKWIP...........................................................................................................................PGEELEEE..---..QQQQ.Q..E....TS.TT..SA.T..E...KE..DN.N..DEDSdssstsegnkkksafdpakelfrpia......laedvnpladtdptststnnnatgdyDDDETAAAEGYFQSVSGHRVRGT..iKFR..VVDVD..VIP..................gSERESGFLSIEGTML........................................................................................................................................................................................................................
F4R871_MELLP/154-276                  .........................PKIGDRL.IGKP..TMSSPSHLSLILYQTFNAF..I.P.A.N.Hmlgagy............rydpnveI..PS......................S.WKFNG...........................................................................................................................--------..---..----.-..K....DQ.TT..NL.H..Q...AN..QS.G..YEND..........................................................GDDLEIHERGCWVDSNGVVVGGE...-AG..VMSFT..AIS...................LTITNDMISVTGSLL........................................................................................................................................................................................................................
A0A2J6S2X0_9HELO/160-264              .........................PDKGALL.EGYI..NLQNQGHLGIVCWNLFNAS..I.E.S.K.R.........................L..PS......................D.WKWKD...........................................................................................................................--------..---..----.-..-....--.--..-V.S..E...MK..SG.K..DAKQ..........................................................GETYAEEGPGFWIDGKGNKIEGM..vKFR..VREIE..-SS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A1V6XGI4_PENNA/156-295              .........................PRRGQTL.DGWV..NVQSEGFLGAVVFNLFSVG..V.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEAETP..ALT..DDDS.G..S....DK.DM..TD.F..D...AE..KE.C..FKPAalsae...............................................eiaidgEEEDESAHTGYFQSVSGHRVSGS..vRFR..VVDVD..VIP..................gSERDRGFLSIEGTML........................................................................................................................................................................................................................
A0A1E4RVC5_CYBJN/127-226              .........................PQVGDVL.EGLV..YMQSPSHIGLLINDTFNGS..I.K.K.N.N.........................I..PE......................S.WQFIP...........................................................................................................................--------..---..----.-..-....--.--..--.N..Q...AD..EQ.A..TGSD..........................................................EEQLKSQSLGQWIDENEIPIDGK...---..-VKFT..VKA...................IHNSGRVVSVEGSL-i.......................................................................................................................................................................................................................
R7Z5J8_CONA1/185-314                  .........................PRRGVWL.EGYV..NLLNESYLGLVVYNLFSAS..V.H.R.N.R.........................L..PR......................D.WRWVE..........................................................................................................................eTSAGDRQA.lAGA..EEGH.V..Q....GE.EE..VG.R..D...TD..GD.V..RMRK..........................................................WQGRGRQAEGYYVDGEGEKVDGL..iRFR..IKDFE..SGA...................GEGEKGFLSIEGTML........................................................................................................................................................................................................................
A0A4V5NBX6_9BASI/170-327              .........................PRVGMKL.VGTL..TLASASHVSLLLHNLFNAS..I.P.V.S.H.........................I..PT......................D.-TWEWdpdfpvppvvlerr..............................................................................................naalphkqvvsdvveK-AKEAAK.vDEE..EEGG.G..A....DA.AT..EE.L..EkvaEE..QE.E..AAKE..........................................................EEEAEFAERGWWVHRKSREPLGG...QDG..RLEFT..LVG...................LTTSNSLLSCTGSLL........................................................................................................................................................................................................................
A0A427XNE0_9TREE/135-249              .........................PKVGQLL.SGTH..SLSSPSHLSLLFSKTFNVS..I.P.L.N.H.........................I..PQ......................D.-KYEF...........................................................................................................................--------..--E..HTDE.G..A....DE.DD..MS.S..D...DE..SD.-..DGGL..........................................................STPSAVHEVGRWKDKSTGAILGS...AGE..RVAFT..VIG...................MQVTNNMLSLTGSLL........................................................................................................................................................................................................................
A0A0D2CYM8_9EURO/241-379              .........................PQKGDEL.YGWT..NVTSEGFVGLVSYNYFQTA..V.G.K.A.R.........................I..PG......................D.WKWNGpsre..................................................................................................................eaqqnRKKGRRGR.lRGE..DGAD.G..T....QE.QN..TQ.D..T...DA..TV.V..ETLS..........................................................SQISLGEDVGHFADADGAKIKST..lKFR..VVDTE..AVP..................aHDRNKWSLQIDGTLL........................................................................................................................................................................................................................
A0A674IAV9_TERCA/114-319              .........................PKKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.D.........................R..MS......................A.IEWQDlglkigdklefevvhldsdaagvffi......................................................................rgrlnkdsmqskypesvtedtnsiaeiP-KKKHKK..RDR..RNCE.L..E....ND.TE..LT.D..N...AD..TT.V..VEDA..........................................................EEQNADTVNGFYDKKPKKKK---...---..-----..---...................---------------khkqekqkpvfygsdcsgypsdhkkvkrkkrehcdvdeeselsqlsqepkakkrke................................................................................................................................................................
H2LGA8_ORYLA/186-416                  .........................PKKGQKL.LGKV..NKLGVSHVGCLVHGCFNAS..I.P.K.P.N.........................L..VS......................V.ETWRDagpkigselefevtaldadaagvllirgrllktrvqellalcemsesthpadt.................epnpesvqqepeeppkkkkkkdqikeletgeettrlpqnqvdcsstphpngttD-EIQNEE.aGDK..KKKK.K..K....KK.EK..HL.K..E...EV..EE.I..EVSP..........................................................PEVHCSDSSGYLSDKPSKKRKHEs.gSDG..TVAFT..---...................---------------deitptkskkkkkn..........................................................................................................................................................................................................
A0A0D0ASR1_9AGAM/130-257              .........................PSMAMKL.VGKI..ILYSPDHVSLLLHRTFNVS..I.P.R.H.H.........................I..PQ......................D.-VWEFe.........................................................................................................................yGPAENDPE..YGE..GAVG.S..S....AD.NE..GD.V..G...MK..EG.D..GEKA..........................................................EGKAVQEASGQWVHRLTGTKLGG...TDG..YLEFT..VIG...................KTVANEMLSLQGSI-q.......................................................................................................................................................................................................................
A0A167PML3_CORFA/284-397              .........................PSRGAWM.EGSI..NLQTEGHIGVVCFGMFNAS..I.E.A.R.R.........................L..PP......................S.WSWVS...........................................................................................................................--------..---..--ND.D..A....GI.EG..ME.E..T...AS..VA.A..PDEH..........................................................GVVHQIHSTGFWVDVNGDKVMGK..iRFR..IRNFD..V-G...................VSGETTYLSLEGTML........................................................................................................................................................................................................................
A0A1V8UFT6_9PEZI/313-418              .........................PRKNTVM.EGFV..NLQNESMLGLICYNYFNAG..I.E.R.S.R.........................L..PK......................D.WRWVE...........................................................................................................................--------..---..----.-..-....--.--..--.D..E...SA..AD.D..AGAM..........................................................ARRGRRSAAGHYVDGKGKKIEGR..vVFR..VKDFE..ASP..................gAETGGGTINIYGTA-l.......................................................................................................................................................................................................................
A0A161HL94_9ASCO/155-301              .........................PRAGDIV.EGWI..NMQSPSHIGLLIHDTFNAS..I.K.R.D.A.........................I..PR......................D.WRFVP...........................................................................................................................NQEDEAED..---..---G.E..D....HT.PN..DQ.E..Q...ES..AE.D..VTAAttgieeegvndekli............................ntsaensgtskaskgALVSPPRSLGYWVDGNGLRVDGK...---..-LNFT..VRV...................FNVSGRTVSVQGSLL........................................................................................................................................................................................................................
A0A428T568_9HYPO/300-413              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................D.WKWVP...........................................................................................................................--------..---..--NE.S..P....EA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWADGSGEKIKGK..iRFR..IRNFD..V-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
A0A099YUH2_TINGU/41-246               .........................PKKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................V.VQWQElglkigdelkfevlhldsdaagvffirggltknslkrkrsetvtdganggeiqk..............peceenglinsggeivseeplgdtnntgrenaeeetvdavngicdgkikkkkkekHKQQEHVL.pTSD..SSGY.Q..S....DH.KK..SK.K..K...KR..KH.C..DEAE..........................................................E----------------------...---..-----..---...................---------------telsqqsqgpkakkkkn.......................................................................................................................................................................................................
L0PDC8_PNEJ8/127-180                  ........................k--TGDFL.EGIV..NLQSPSHIGLLVSGFFNAS..I.P.K.S.A.........................I..PK......................A.WMYQE...........................................................................................................................IMSQEEVE..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------qne.....................................................................................................................................................................................................................
B8MU07_TALSN/165-339                  .........................PQKGQIL.EGWV..NVQSEGFVGAIAYNLFSVG..I.E.R.K.R.........................V..PK......................T.WKWIPp........................................................................................................................gaDDEEED-P.aVSD..KKGG.Y..V....SA.TS..GD.E..D...GS..RA.N..NNNKvtfdaekehftplpkrvsrkp...............itlpdgdtnmlgeefgeyddddDEDEDSNTTGYFQSVSGHRVRGT..vRFR..VRDVD..VIP..................gADPDRGFLSIEGTML........................................................................................................................................................................................................................
A0A7C8IB06_9PLEO/152-205              .........................PRPASLI.PARV..THQSSTHITLAHLNTFPVS..V.L.K.T.Q.........................L..PP......................A.WTWHE...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------ealfhdppae..............................................................................................................................................................................................................
Q5ARH8_EMENI/192-356                  .........................PQRGQTL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................T.WKWIP...........................................................................................................................PGEEDENE..NGT..TTNP.N..S....DE.DD..DS.T..P...ST..PF.D..PEKEhfnpvplasdsnpfsydq......................gqvadsttgaigqlegeeGTTDQDSLEGHFQSVSGHRVRGT..iKFR..VVDID..VIP..................gTERDRGFLSIEGTML........................................................................................................................................................................................................................
A0A0C2SZL1_AMAMU/115-226              .........................PQVGMKLaVGKI..KLSSPDHIALLIHRTFNVS..I.S.R.D.H.........................I..PA......................D.-EWEF...........................................................................................................................--------..---..----.E..P....GT.EE..DE.A..K...LS..DT.D..DDDD..........................................................WDATKAEERGRWRHKETGDLLGG...EDG..YLEFT..VIG...................VTLANEMLSLHGSLQ........................................................................................................................................................................................................................
A0A093P8C7_PYGAD/41-249               .........................PKKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................I.VQWQElglkigdelkfqvlhldsdaagvffirggltkssmrpkrsetttdhtngde....................iqkldhqenglndsgkdniteeplgetgntgtenaeeqsvdavnglcdgknkK---K---..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------kkkkkkhkqeeqehvlpasdssgyqsdhkkskkkkrkhcdeveeselsqpsqepkakkkk............................................................................................................................................................
W9WRW6_9EURO/243-381                  .........................PERGDEL.YGWT..NVTSEGFVGLVSYNYFQTA..I.G.K.A.R.........................I..PA......................E.WKWNGpsre..................................................................................................................qvqknRKKGRKGR.lRDE..KGLD.D..G....EE.HS..TL.E..T...AT..TT.V..ETPS..........................................................SQALLAEGGGYFADASGTKITST..lKFR..VANTE..IVP..................aHDRHKWSLQIDGTLL........................................................................................................................................................................................................................
A0A6A6YWI5_9PEZI/139-252              .........................PQKNDTI.RAFV..HFQSQAQISLVFLNLISVT..I.R.S.A.H.........................L..PR......................S.WKWVR...........................................................................................................................--------..---..----.-..D....EG.MG..GG.A..E...DY..EQ.G..KKER..........................................................RKKEADGSQGYFVKEDGEKVEGF..iDAR..IIDFE..IVTt.................kTEKRGGLLKIEATL-v.......................................................................................................................................................................................................................
A0A1V6RVJ0_9EURO/156-294              .........................PKRGQTL.EGWV..NVQSEGFLGAVVFNLFSVG..V.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEAETP..ALT..DDDS.G..S....DK.DM..AD.F..D...AE..KE.C..FKPTtlsed................................................evaidEDEDESAHTGYFQSVSGHRVSGS..vRFR..VVDVD..VIP..................gSERDRGFLSIEGTML........................................................................................................................................................................................................................
M5GD55_DACPD/81-180                   .........................PRIGMRL.RGSV..SLCGPDHIGLILERTWNCS..I.P.K.W.G.........................L..DE......................G.-VWEY...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...-V..AG.T..GAEG..........................................................EEGAESTDSGWWKTRMSGEPLGG...ENK..TVDFT..VVG...................MTIANQMLSLTGSLL........................................................................................................................................................................................................................
A0A139AQT6_GONPJ/245-309              .........................PKVRDYV.VGTV..TLSSPTHISLLVHRVFNLF..V.P.A.D.N.........................I..PD......................R.FVYDTsk......................................................................................................................gvwI-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------dkgtdgtkrdemdeg.........................................................................................................................................................................................................
A0A1F5L9L0_9EURO/151-290              .........................PKRGQIL.DGWV..NVQSEGFLGAVVFNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEAETP..ATT..DEDS.S..S....DQ.GM..AG.F..D...AE..KE.M..FQPAslaae...............................................eipldgEDEDESAHSGYFQSVSGHRVRGS..vRFR..VVDVD..IIP..................gSERDRGFLSIEGTML........................................................................................................................................................................................................................
D4ADH7_RAT/125-321                    .........................PKPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.K.P.E........................qM..SY......................E.-EWQTleinvgdelefdvfrldsdsagvfcirgklnttslqhkgsvvsedveetvieev..............vekipkkkkkkdkdrevcatvesvtevadvtdaaaedeaglpcsddvndffeeepK-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------kkkkkkkrhqedqdpifqasdssgyqsdhkkkkkkrkhseean.............................................................................................................................................................................
A0A093HXW2_STRCA/44-248               .........................PKKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................V.AQWQElglklgdelkfqvmhldsdaagvffirggltktslqprrsetvtdgtngde.....................iqklehkknglvdsvrengteepvddtdntgrenteeqmvdavngicddknK-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------kkkkkhkqeqehvlptsdssgyqsdhkkskkkkrkhceeaeeiglsqlsqepkakkkk..............................................................................................................................................................
A0A3B6MP57_WHEAT/98-248               .........................PQPEMIL.EGKV..EMLGKESIHAIVLGVFSAA..I.M.A.D.D.........................I..PE......................M.FKFKRrghggkfisqsdkrhvikkgsmirfsvkrvd............................................................temnchitgslmpphtgcmrwlsvhdaeyaseI-------..--S..SGKR.K..P....RD.HT..KS.E..Q...KV..QG.R..TTAN..........................................................RED--------------------...---..-----..---...................---------------smvnserprksrkrav........................................................................................................................................................................................................
G3NT27_GASAC/95-262                   .........................PLNGQKL.VGRV..NKLGVGHVGCLVHGCFNAS..I.P.R.P.N.........................L..VS......................V.PTWRDagprigsemefevtaldadtagvllirgrmertrvqellamseasgtg...........................vpedrpesteesskntpkkkrtilkdsvtspsscqvdgstspqlngtnTAENGDEA.gEKK..KKKK.K..K....QK.HM..KE.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------eeee....................................................................................................................................................................................................................
A0A444UAN7_ACIRT/136-350              .........................PNKGQKL.VGIV..NKVAPSHIGCLVHGCFNAS..L.P.K.P.Hkmfnda............chdsglkV..GD......................R.LEFEVyqldadvagvllirgkld.......................................................................................ensvlgklvtqqeectvdQ-------..-DN..VNGE.P..D....AI.EE..TP.S..K...KK..KK.K..KEKK..........................................................---R-------------------...---..-----..---...................---------------akedlessvctdeicadstvnrevgampegssvngdssvnggildmpkkkkkkkldkepelasqtechasdssgsrshskrekkrklsdggdlie.........................................................................................................................
A0A091TEA5_PELCR/41-246               .........................PKKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................I.VQWQElglkigdelkfqvlhldsdaagvffirggltkssmqpkqsetvtdstnrde.....................ihkldhqengfsdsrgdniteeplgemdntgrenaeeqsldavngicddknK-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------kkkkkhkqeeqehvlptsdssgyqsdhknskkkkrkhcdeveeselsqlsqepkakkkr.............................................................................................................................................................
A0A2Y9PJS7_DELLE/125-328              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................E.-QWQTleinmgdelefevfrldsdaag...............................................................................vfcirgklnitslqtkcsavseE-------..--V..TETG.T..E....EA.TE..KP.Q..K...KK..KK.K..KKDPepye.................................................vesgiT----------------------...---..-----..---...................---------------eladfadvtmkeetdlqinnnvnglweeepkkkkkhqdpvfqgsdssgyqsdhkkkkkerkhseeaefapllehapkkkre.......................................................................................................................................
A0A446T1F3_TRITD/98-248               .........................PQPEMIL.EGKV..EMLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..PE......................T.FKFKRrghggkfisqsdkrhvikkgsmirfsvkrvdte........................................................mnchitgslmpphtgcmrwlsvhdteyaseissgK-------..---..---R.K..P....RD.HT..KS.E..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------qkvqdcttanredsvvnserprksrkrav...........................................................................................................................................................................................
A0A1U7LL78_NEOID/107-155              .......................tk-------.EGDV..NLQSPDHIGLLLHGTFNAS..I.S.R.D.K.........................I..PE......................S.WKFHG...........................................................................................................................TAWKN---..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------ahget...................................................................................................................................................................................................................
A0A1R1XD67_9FUNG/230-367              .........................PLRGLRL.RGVV..NIQSQSHIGILVYNIFNAS..I.P.R.K.N.........................I.dKA......................K.YMWVEfeepiieevaadseenqlasnkd............................................................................iagqiaadmaemenkskeksneeeISKEDDSS.kVEE..KADG.S..D....DS.DE..SS.E..E...EE..SG.E..GKGS..........................................................DEKGEGSE---------------...---..-----..---...................---------------eke.....................................................................................................................................................................................................................
G3RU18_GORGO/125-274                  .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWQTmeinmgdelefevfrldsdaagv.............................................................................fcirgklnitslqfkrsevseevT-------..---..---E.N..G....TE.EA..TK.K..P...NK..KK.K..KKDP..........................................................ETYEVD-----------------...---..-----..---...................---------------sgttkladdaddtpmeesalqntnnvngiweee.......................................................................................................................................................................................
M3X5H4_FELCA/125-325                  .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................E.-QWQIleinvgdelefevfrldsdaagvfcirgklntsslqtkcstvseevt.............................etgteeivekplkkkkkkktdpepyevesdnreladfadvtvkeetnL-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................----QINNT--------------...---..-----..---...................---------------ngfqneepkkkkkkkhredqdpvfqgsdssgyqsdhkkrkkkrkhseeaeftpllqq...............................................................................................................................................................
A0A672SJX2_SINGR/119-282              .........................PKKGSKL.VGVI..NKMGVGHVGCLVHGCFNAS..V.V.K.P.S.........................L..LS......................S.EQWRDcglcvgqslefevfqldadaagvllirgrlekcryv...................................................qtvdknitiihstpnksiikmfltsncyfrlkyesiI-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------ynnasssekvvwsesgeksaqikhrenspkqletnmwettgdglfhw.........................................................................................................................................................................
A0A4W3HU68_CALMI/120-311              .........................PEKGQKL.VGVV..NKVAPSHLGCVVHGCFNAS..I.P.K.P.Y.........................H..EN......................G.-TWPGfevkvgnnlqfevvhldadvvgvlci.......................................................................rgkldpnsnetplengnnhtadqtpgKKKKKKKK.kHKR..KNDE.E..F....ST.QD..TP.-..-...--..--.-..---Eeasetv.............................................elmdlslL----------------------...---..-----..---...................---------------edgvhktngkkskkkkkkrakeekpnaeteiqtndscdkptkkkkrkhseraseptdc..............................................................................................................................................................
Q1K5X0_NEUCR/250-375                  .........................PARGKWM.EGVV..QLQSEGHIGVQCWGRFNAS..I.E.A.K.R.........................L..PK......................G.WKWVD...........................................................................................................................--LKGDHK.sYNQ..QEEE.Q..Q....EE.EE..QQ.E..E...ED..QL.D..GEEL..........................................................QVVEQVHTTGYWVDASGKKVSGK..vRFR..IKNFD..V-G...................LAGDYGYLSLEGTFL........................................................................................................................................................................................................................
A0A094GR84_9PEZI/165-262              .........................PTRGGWL.EGYV..NLQNEGHLGIVCWNLFNAS..I.E.R.Q.R.........................L..PK......................E.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.A..EDLE..........................................................GEGYAEDGVGYYVDGAGTKIEGI..vKFR..VKDIE..-SS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A0S7DSY8_9EURO/180-339              .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEEEEN.gLNS..GEKP.K..K....KV.FS..ST.E..D...ED..DS.E..PASHfdpekehfkpislas............................danpfsetmdlnnssAEDDEAAAEGYFQSVSGHRVRGT..vRFR..VVDID..VIP..................gSDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A060SM99_PYCCI/52-166               .........................PQVGMKL.AGKI..NLCSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..TT......................E.-EYEF...........................................................................................................................--------..---..EYGP.A..D....ND.PE..FG.A..Q...HT..EQ.N..PAAE..........................................................GAEGQVEGGGRWLHKVTGTKLGD...ADG..YLEFT..VIG...................LTIANQMLSLVGSI-q.......................................................................................................................................................................................................................
A0A2U9D1F4_SCOMX/138-367              .........................PKKGQKL.LGKV..NKLGVSHVGCLVHGCFNGS..I.P.K.P.N.........................L..VS......................M.ETWRDagprigselefevtaidadtagvl..........................................................................lirgrldrtrvqelmamgessessvA-------..-AE..QPDT.E..P....KP.ET..ME.E..S...PD..ET.P..RKKK..........................................................KKKKDKEET--------------...---..-----..---...................---------------kedvtpsckqerittqelngatdeangngegekkkkkkkkekclkeeeeelelspldvqgsdssgyvsdkpskkrkhetgsdvissfsdvpetpkskkkrks..................................................................................................................
H2PMQ7_PONAB/125-269                  .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWQTmeinmgdelefevfrldsdaagv.............................................................................fcirgklnitslqfkrsevseevT-------..---..----.E..N....GT.EE..AA.K..K...PK..KK.K..KKDP..........................................................ETYE-------------------...---..-----..---...................---------------vdsgttkladdaddtpmeesalqntnnvngi.........................................................................................................................................................................................
A0A0K3CR30_RHOTO/162-270              .........................PRVGMKV.VGTL..TLATPSHVSLLLHNLFNAS..I.P.S.S.H.........................I..PT......................S.-TYEY...........................................................................................................................--------..---..----.-..-....DP.EC..PV.P..A...VV..LE.R..RTAT..........................................................VPFATNVAKGWWVHRKSREPLGG...ADG..RLEFT..LVD...................LTNTNSLLSCTGSLL........................................................................................................................................................................................................................
A0A0L0FGB5_9EUKA/45-190               .........................PIIGSEM.VGIV..HKVSEDHVGILVFGSFNVS..I.P.K.N.F.........................I..HS......................D.LMYDKdefkwydpaddsgarfeegstvrfei.......................................................................qswetkndvfyiigalpsdkkriviaN--AEAAEeeESE..AEDL.E..L....D-.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------nktiedleatgvvssaesdeetrnaivpvkqe........................................................................................................................................................................................
A0A5N5QXT3_9AGAM/154-258              .........................PEIGMRI.TGRI..SLHATDHIGLLVHRTFNAS..I.D.R.A.H.........................I..PG......................D.GEWEY...........................................................................................................................--------..---..----.-..-....--.--..-I.H..G...PV..PN.D..PEIN..........................................................SEEQGDEEVGRWINSQTGETLGG...ETG..LVEFT..VIG...................YTIANQMLSLHGSLQ........................................................................................................................................................................................................................
I1I2T1_BRADI/81-231                   .........................PQPNMML.EGKV..EMLGKESIHVVVLGVFSAA..I.M.A.D.D.........................I..PQ......................S.FRFKRrghggkfisqldnqhvikkgsmirfsvkgvdte........................................................mnchingslmpphtgsmvwlsvhdaeyaseinsgK-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------rkskgikieqnvqddttvnnedsvvnserphksrkrtva.................................................................................................................................................................................
A0A6H5JDH5_9PHAE/85-256               .........................PRPGHVL.QGRV..NKVTSTHVGMLVCGIFNAS..V.A.S.E.S.........................M..GE......................G.FRFDMtarewqrsrggkdgareviavgadtq.......................................................................fvvtrmheaaglisiegsleglpkadGSEEKDEQ.pKEE..GGGE.D..A....VA.NT..NT.N..T...NK..RR.V..----..........................................................-----------------------...---..-----..---...................---------------gvatvaaeegedeaaaaaasakaarkkakkaaklaakaqkkvkte...........................................................................................................................................................................
A0A091SAI5_NESNO/41-243               .........................PKKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................V.AQWQElglkigdelkfqvlhldsdaagvffirggltkssmkpkqpe.........................................tvtdsangdetqkldhqenslndsrgdnvteealdgtnntvK-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................ENGEEQSMNGLCDDK--------...---..-----..---...................---------------nkkkkkkkhkqeeqehvlptsdssgyqsdhkkskkkkrkhcseveeselsqlsqepkakka...........................................................................................................................................................
A0A484EH94_BRELC/80-126               .........................PKKGMIL.RGVV..NKIGSNHIGMLIAGVFNGS..V.A.G.A.E.........................L..PV......................G.YVHNY...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------sqd.....................................................................................................................................................................................................................
A0A1V8TK90_9PEZI/311-416              .........................PQKNTVL.EGFV..NLQNESMLGLICYNYFNAG..I.E.R.S.R.........................L..PK......................D.WRWVE...........................................................................................................................--------..---..----.-..-....--.--..--.D..E...SA..AD.D..AGAM..........................................................ARRGRRSAAGYYVDGNGKKVEGR..vVFR..VKDFE..ASP..................gSETGGGSINIYGTA-l.......................................................................................................................................................................................................................
A0A067SYG4_GALM3/31-144               .....................taia-------.AGKV..NLSSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..PT......................D.-IWEF...........................................................................................................................--------..-EY..GPAE.N..D....PE.YG..DT.V..H...QD..EE.V..NDKN..........................................................GQEINQSTGGRWVHKVTGEVLGS...NGG..LLEFT..VVG...................LTVANEMLSLLGSLQ........................................................................................................................................................................................................................
A0A2I0UBT8_LIMLA/224-432              .........................PKKGKKL.VGII..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................I.VQWQElglkigdelkfqvlhldsdaagvffirggltkssmrpkqpvtvtdstngd......................eiqkldhqegglndsggdnvtgerlgetdntgmenaeeqsvdavnglcddkS-------..---..----.-..-....--.KK..KK.K..K...KK..HK.Q..EEQE..........................................................HVLPTSDSSGYQS----------...---..-----..---...................---------------dhkkskkkkrkhceeveemelsqlsqepkakkkrd.....................................................................................................................................................................................
A0A068RS34_9FUNG/134-253              .........................PKKGTKL.VGRI..NLQSQDHIGLLIFGTFNAS..I.P.K.A.R.........................I..PS......................D.-TYEW...........................................................................................................................-----RSS..VDS..SEEP.V..T....KD.QD..ED.D..N...ED..EN.E..DIQQ..........................................................DAEQQRSQYGEWINKSTGVPVGG...DDG..IVEFN..VVD...................IIEANDILTVGGSL-........................................................................................................................................................................................................................
A0A0J8RST8_COCIT/186-319              .........................PERGQTL.EGWI..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PP......................D.WKWVApg.......................................................................................................................qqPESTPTMT.qDED..DSDT.N..S....DT.EN..FR.P..L...KG..DK.H..IPDE..........................................................HDDEASAAMGYFQTRSGKRVRGM..iKFR..VRDVD..VIP..................gSEWDKGFLSLEGTML........................................................................................................................................................................................................................
Q5K9N5_CRYNJ/130-241                  .........................PKIGQKL.RGIH..SISSPSHLSLIFAGAFNVS..I.P.I.Q.H.........................I..PA......................D.-LYEF...........................................................................................................................--------..---..--EE.T..D....EV.VE..TE.S..L...DG..SE.V..EYVD..........................................................KNEMEVKETGRWRNKKTGEFFGK...-RE..LVKFT..VIG...................MQVTNQMLSLTGSLL........................................................................................................................................................................................................................
A0A166SPX4_9PEZI/290-409              .........................PRRGAWM.EGSI..NLENEGHIGVVCWGKFNAS..I.E.S.T.R.........................L..PP......................E.WRWVH...........................................................................................................................----AGS-..-AE..AASY.V..A....DP.FD..D-.N..A...ST..RT.A..EDEH..........................................................GAVGQIHTTGFWVDGSGDKVKGR..vRFR..IKAFD..V-G...................VSGDHGYLSLEGTML........................................................................................................................................................................................................................
A0A1B9G9X0_9TREE/130-241              .........................PKIGQKL.YGTH..SLSSPSHLSLLFNKTFNVS..I.P.L.Q.H.........................I..PT......................E.-LYEF...........................................................................................................................--------..---..---E.H..T....DE.TA..DS.D..S...ED..EE.E..EGFI..........................................................LGNGVVEDVGRWKEKATGKSLGE...GGK..GIKFT..VIG...................MQVTNQMLSLTGSLL........................................................................................................................................................................................................................
A0A443HMI5_BYSSP/176-322              .........................PQRGQVL.EGWV..NVQSEGFLGAVVYNLFSVG..I.E.R.R.R.........................L..PA......................D.WKWIP...........................................................................................................................PGEEDDST..-DA..KKSA.A..T....SA.EN..SG.D..E...ED..SF.D..PEKEhftpvrlpl.......................................gvetqdkgqdMDTEDSTATGYFQSASGHRVRGT..iRFR..VRDID..VIP..................sADRERGFISIEGTML........................................................................................................................................................................................................................
A0A420GIL7_9PEZI/129-233              .........................PEKGTWL.EGVI..SLQNDGFIGVVCWNLFNAS..I.E.R.R.R.........................L..PS......................D.WKWKD...........................................................................................................................--------..---..----.-..-....--.--..-A.S..E...IP..GF.K..EQEN..........................................................SDTHNCEGAGTYIDGQGRKINGV...---..-IKFR..VADie...............scQDRERGFLTIVGTML........................................................................................................................................................................................................................
B9EPB1_SALSA/140-357                  .........................PQRGQKL.LGTV..NKLGVSHVGCLVHGCFNAS..V.P.KpA.H.........................V..TM......................E.-TWKEagprigaelefevcqldadtvgvllirgrlgrarvqelmaagessdpidpte...................qleepdtepalqpnqdspeatvkpkkkkkrkekhreevvsvpapgdavngtvE-------..---..----.-..-....--.--..--.-..-...--..--.-..---Dsst....................................................nghFEEKKKKRKGKRQNEEDEEREVG...GRG..PVEV-..---...................---------------qgsdssgylsdkpnrkrkqgdditsflhgdpe........................................................................................................................................................................................
A0A1U7RU07_ALLSI/110-305              .........................PQKGTRL.VGVI..NKIVPSHIGCLVHGCFNAS..V.P.K.H.Dcvs...................aeqQ..--......................-.----Qdlglkigdtlefdvsrldsdaagmff......................................................................iwgrltkdslqskrpetvtedtnrnetP-------..---..----.-..-....--.--..--.-..-...KK..KH.K..KN-Gtvnfegdsnsge.................................vvedadtavreyaEEQNPDDVNGLFHKKTKKKK---...---..-----..---...................---------------khkqenqepvlpgsdtsdyqsnhkkekrkkrkyceenhelsqlake..........................................................................................................................................................................
A0A5M3MWP2_CONPW/136-258              .........................PRVGMKL.VGKV..NLCSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..PT......................D.-SWEF...........................................................................................................................---EYGPA..END..PEFG.V..N....ID.DA..DT.L..K...VS..VS.Q..RGEN..........................................................AKENEEEGSGRWSHKITGTKLGG...DDG..FLKFT..VVG...................LTVANEMLSLQGSI-q.......................................................................................................................................................................................................................
A0A7C8IMX3_9PEZI/281-401              .........................PSRGAWL.EGLV..NIQSGGHIGVVCWGKFNAS..I.E.S.E.R.........................L..PH......................D.WRWVD...........................................................................................................................--------..QHA..SKQN.G..E....AG.PE..AT.S..S...SL..SE.Q..SDAE..........................................................ADHTEVHATGYWVDGQGSKVTAEt.pICF..RIKNY..EVG...................SSGDYGYLSIEGTML........................................................................................................................................................................................................................
A0A0C3BAI3_PILCF/135-254              .........................PHIGMKL.VGQV..KLCSPDHVALLIHRTFNVS..I.P.R.H.H.........................I..PT......................E.-HWEF...........................................................................................................................-------E.yGAA..ENDP.E..F....GP.GV..GG.G..S...ED..GE.H..SEGG..........................................................SAREEAEEGGKWVHSITGAKLGG...LDG..FLEFT..VIG...................FTIANEMLSLRGSI-q.......................................................................................................................................................................................................................
A0A559M7Z9_9HELO/112-214              .........................PEKGAWL.EGYV..NLSSEGHLGIVCWNLFNAS..I.E.R.K.R.........................L..PS......................D.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..--.-..V...QE..RE.E..GDGE..........................................................EEVYAEEGAGHYVDGEGKKVEGM..vKFR..VREIE..-SS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
Q7PV20_ANOGA/105-240                  .........................PRIGSTL.RGTV..NYVSKNFVSAVIYRVFNVT..V.K.L.G.Qqtarlhalkng...sdisftvnscdM..--......................-.----Kselpviegelvlngv.............................................................................................ipvriktepgeqngdC-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------deveeiametdtivkqepktpkkkaskkskeksnggpvetvrikqe..........................................................................................................................................................................
A0A369H265_9HYPO/114-230              .........................PRRGYWM.EGDI..ILHAESQIGVVCYGKYNAS..I.E.A.A.R.........................L..PP......................P.WKWLS...........................................................................................................................--------..--E..VSDE.A..K....NL.EK..TT.S..S...ST..AA.E..IDND..........................................................DAVEQVDCTGFWVDDRGARVQGK...VRF..RIRNV..FAG...................ASQGINYLSLEGTML........................................................................................................................................................................................................................
A0A485L6Z0_9STRA/82-129               .........................PTPGMQL.AASI..NKIGSNHIGLLLAGVFNVS..I.A.A.G.E.........................M..PP......................G.YVHNY...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------hkea....................................................................................................................................................................................................................
A0A5C3QLU0_9AGAR/152-295              .........................PRIGMKL.AGKI..NLCSPDHVSLLIHRTFNTS..I.P.R.H.H.........................I..PI......................D.-DWEFeygpaandpef.....................................................................................................ggggegalptpP----EST..SPE..NEEG.A..M....DV.DG..KG.A..T...AA..KG.G..DPES..........................................................ALAEDTDPGGRWVHKTTGNVLGG...ESS..ALEFT..VVG...................MTIANQMLSLTGSI-q.......................................................................................................................................................................................................................
A0A136ISG3_9PEZI/316-439              .........................PTRGAWM.EGKI..NLQSEGFVGVICFDMFNAS..I.E.A.S.R.........................L..PE......................G.WRWVD...........................................................................................................................----LMSS.sKNS..KTAS.D..S....TP.DP..FN.E..N...AN..QG.E..EGAD..........................................................GETEQLHTTGYWVDASGARVTGT...LPF..RIKNY..EVG...................SSETHGYLSIEGTML........................................................................................................................................................................................................................
A0A017SDS7_9EURO/167-316              .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PT......................T.WKWIP...........................................................................................................................PGEEAPTA..NKT..DDES.D..T....DS.AA..KD.F..D...PE..KE.H..F--Tpvslasdanpl...................................settpnpvpegqEEGEDESAEGYFQSVSGHRVRGT..vRFR..VLDVD..VIP..................gTDRERGFMSIEGSML........................................................................................................................................................................................................................
F1NJS0_CHICK/190-398                  .........................PKKGKKM.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.KpE.H.........................M..SA......................A.-EWQElgfkigdelkfravhldsdaagvffirgqltktsmqpeqsdplt..................................davtdgtngeqiqdfhseknglnysggdsvtedppgeadntvggnTEEQSIDA.vNEV..CDDK.K..K....KK.KK..KH.K..Q...E-..--.-..----..........................................................-----------------------...---..-----..---...................---------------eqelvlpasdssgyqsdlkkskkkkrkhceveeselpelsqepkakkkr.......................................................................................................................................................................
A0A074WSE8_9PEZI/164-275              .........................PTPGAVI.EGYV..SLQNESYLGLVCWNFFNAG..V.D.R.K.R.........................I..PS......................T.WKWVP...........................................................................................................................--------..---..----.-..-....NH.NA..NA.G..T...KS..ST.D..WMRG..........................................................LRNKSDESSGHYVDENGNKIEGK..vKFT..VKDFE..SAP..................sTERERGFLSIEGTLL........................................................................................................................................................................................................................
A0A5N5T383_9CRUS/100-303              .........................PEIGSIL.KGKV..VKKSPNHVGCLVHNIFNASssI.P.N.G.-.........................I..TK......................E.-NWCGnsvregdslemkitelnltcav..............................................................................pflkgdiipesiclmskdlsnikIKEEKAED..EDS..GISG.V..E....KP.ND..ED.N..E...SE..NE.N..KKKK..........................................................KKKKKNSAVENLVEESIESPKKS...---..-----..---...................---------------kkrkrnnlensnddleegiekvskkiklenssenlsdenmgedtkkkkkkkkkikees..............................................................................................................................................................
A0A094CUA7_9PEZI/165-262              .........................PTRGGWL.EGYV..NLQNEGHLGIVCWNLFNAS..I.E.R.Q.R.........................L..PK......................D.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.A..EDLE..........................................................GDGYAEDGVGYYVDGVGTKIEGI..vKFR..VKDIE..-SS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
F6WGE7_CALJA/125-337                  .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWQTmeinmgdelefevfrldsdtagvfcirgklnitslqfkhsevseevt............................engteeaaekpikkkkkkkkdpetyevdsgttkladfaddtpveesalQ-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------ntnnvndlreeepkkkkkkkkkkhqedpnqdpsfqgsdssgyqsdhkkkkkkrkhseeaeftpplkcspkkkr...............................................................................................................................................
G8BWN1_TETPH/125-236                  .........................PQVGDII.EGWC..FIQSVSHIGLLIHDAFNAS..I.N.K.N.Y.........................I..PD......................D.WTFIQ...........................................................................................................................--------..NEE..HFDD.W..D....--.-E..TE.E..G...ET..EN.T..SNEA..........................................................GTTKHNTSMGHWVDGNGENIDGK...---..-LKFK..IRN...................VFTKGRVISIDGTLL........................................................................................................................................................................................................................
G7XW29_ASPKW/177-356                  .........................PQRGQIL.EGWV..NVQSEGFLGAIVLNLFSVG..I.E.R.K.R.........................L..PP......................S.WKWIP...........................................................................................................................PGEELEEE.eQQQ..QTST.T..S....AT.EK..EE.D..D...ED..SD.S..S--Stsegrkkksafdpakelfrpialaed......vnpladtdpttststnnnnnatgdyyDDDETAAAEGYFQSVSGHRVRGT..iKFR..VVDVD..VIP..................gSERESGFLSIEGTML........................................................................................................................................................................................................................
A0A6J3ILJ0_SAPAP/125-334              .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWQTmeinmgdelefevfrldsdtagvfcirgklnitslqfkhsevs.....................................eevtengteeaaekpakkkkkkkkdpetyevdsgtakladfadD-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------tpmeesalqntnnvndlweeepkkkkkkknkkedqdqdpsfqgsdssgyqsdhkkkkkkrkhseeaeftlpfkcspkkk.........................................................................................................................................
A0A4U0XBC3_9PEZI/175-280              .........................PRKGVSI.PGYV..NLQTESHLALVCWNLFTAS..I.D.R.K.R.........................L..PK......................E.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..--.Q..D...AV..SN.G..TDSV..........................................................VNGSHQGGEGCFVDSEGQKVDGL..iDFR..IQDFE..ASP..................aTERDKGFMSIEGTLL........................................................................................................................................................................................................................
A0A1Y2EBF2_9PEZI/333-474              .........................PARGAWL.EGAI..NLQSEGHLGVVCWEMFNAS..I.E.A.A.R.........................L..PQ......................G.WQWVDlmsdkgs.............................................................................................................tktrakhITFEDEAQ.lPTP..ESAN.E..D....ED.EV..AA.V..P...DN..DA.D..VDGD..........................................................VTQTQLHTTGYWVDEKGQKVRGK...LRF..RVKNY..EVG...................VSGDYGYLSIEGTML........................................................................................................................................................................................................................
A0A196S6Z1_BLAHN/84-161               .........................PQRGMEI.NGTV..NMVGLHYIGLIVCGLFNAS..I.P.E.D.L.........................M..PK......................G.SSYDT...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------asrtwtingttmeigatlkvkvdrihdnngllsm......................................................................................................................................................................................
A0A166FKE7_9AGAM/111-225              .........................PEIGMRL.TGNV..SLCSPDHVSLLVHRTFNVS..I.P.R.H.H.........................I..PT......................D.-NWEF...........................................................................................................................--------..---..EYGA.A..E....ND.PE..YG.V..K...AE..GE.V..VPEV..........................................................QDGEDAADRGRWIHKVTAEPIGG...RKG..RLEFT..VVG...................MTIANNMLSLVGSLQ........................................................................................................................................................................................................................
A0A318Z572_9EURO/188-375              .........................PQRGQLL.EGWV..NVQSEGFLGAIALNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWIPpgdeqeves........................................................................................................statttttisTTNNTSSD..DTK..RFPS.S..D....DD.DD..DE.S..D...SE..SK.P..---Kfdpelehftpvtlasdanpln...............psnsnpstdlsaindpttaanaNHEDDDEVEGYFQSVSGHRVRGT..iKFR..VVDID..VIP..................gSERDRGFISIEGTML........................................................................................................................................................................................................................
A0A1L0CSI1_9ASCO/129-231              .........................PQIGDTL.EGYI..YMQTASHIGLLVHDTFNAS..I.K.F.R.N.........................I..PQ......................D.WEFVP...........................................................................................................................--------..---..----.-..-....--.-S..QA.D..E...FG..ES.E..ELTD..........................................................AKSSKFRSYGYWADGSGTKVEGK...---..-ITFT..VRA...................IHSTGRMLSVEGSL-v.......................................................................................................................................................................................................................
L8GGT6_ACACA/100-218                  .........................PSPGLTL.VGEV..NKVGSDHVGLLVAGAFNAS..V.S.R.D.A.........................V..PA......................D.FAAVT...........................................................................................................................--------..TTT..TTAA.K..E....KN.ED..ED.E..D...EN..ED.E..DDDE..........................................................ASAASVTAVECWRSTTDPSRELS...PGR..FAAFQ..TTA...................VNTSRGIITIFGSML........................................................................................................................................................................................................................
A0A178ANT6_9PLEO/108-213              .........................PVANAHI.KGNV..THQSKTHITLSHLNTFPIS..I.T.K.D.N.........................L..PT......................S.WQWHS...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...QQ..AG.L..VKKG..........................................................WDGRLQDEGGWWVDGEGEKVEGE..lEVR..ITDFD..GRMd................grGKGRGGVLRIEGSLL........................................................................................................................................................................................................................
A0A507ETX2_9FUNG/80-143               .........................PTEGSIL.VGLV..NKVSSDHIGLLVHGVFNAS..I.A.A.E.H.........................V.rKT......................E.FKFSN...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------stkvwnrcvdgnetadsia.....................................................................................................................................................................................................
A0A383YQD0_BALAS/125-319              .........................PEPGQKL.RGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................E.-QWQTleinvgdelefevfrldsdaag...............................................................................vfcirgklnitslqtkcsavseE-------..--V..TETG.T..E....EA.TE..KP.R..K...KK..KK.K..KKDPepyeveggttel..................................adfadvtmkeetD----------------------...---..-----..---...................---------------lqinnnvsglweeepkkkkkkkhqdsvfqgsdssgyqsdhkkkkkkrkhseeaeftp...............................................................................................................................................................
A0A376B2J3_9ASCO/131-229              .........................PQIGDII.EGWI..FIQSASHIGILIHDAFNAS..V.K.K.N.N.........................I..PE......................S.WTFVH...........................................................................................................................--------..---..----.-..-....--.--..--.-..N...ED..YV.N..NGEN..........................................................SSNNQSNSLGYWVDENGQQLDGK...---..-IKFA..IRN...................IFTTGKLISLDGTLL........................................................................................................................................................................................................................
A0A507APE6_9PEZI/262-381              .........................PSRGAWL.EGNV..NLQTEGHIGVVCWDKFNAS..I.E.A.K.R.........................M..PR......................G.WRFID...........................................................................................................................-------L..VGG..QQEA.A..A....PD.AA..AE.Q..D...PF..ED.E..ENGE..........................................................PEVEQMHATGYWVDAAGRRIKGK..lRFR..IKNFD..V-G...................IAGDHGYLSIEGTML........................................................................................................................................................................................................................
A0A137QTP2_9AGAR/118-233              .........................PKVGMKL.AGKV..NLCSPDHVSLLIHKTFNAS..I.P.R.H.H.........................I..PA......................G.-DWEF...........................................................................................................................--------..--Q..YGPA.E..N....DP.EF..GP.E..A...QA..GS.E..SQET..........................................................SEQEEQESAGRWIHRHTGEKLGG...DLG..DLEFT..VIG...................LTVANEMLSLQGSI-q.......................................................................................................................................................................................................................
A0A427Y3C3_9TREE/244-361              ......................fpd-------.-GTH..SLSSPSHLSLLFSKTFNVS..I.P.L.Q.H.........................I..PL......................D.-EYIF...........................................................................................................................---EHTSR..EDQ..PDLE.D..E....SD.IS..DS.E..D...ED..GF.G..GLGG..........................................................FGLGTVHEVGRWKSVKDGKLLGE...GGK..GVKFT..VIG...................MQITNQVLSLTGSLL........................................................................................................................................................................................................................
A0A5A9NIY3_9TELE/132-384              .........................PKKGSKL.VGVI..NKIAVGHLGCLVHGCFNAC..VvK.P.N.H.........................L.tPE......................Q.--WRDcglragesvefevfqldsdcagvliirgrleks.........................................................rvqellaqeqqteastnlpaepentedttdspkH-------..---..----.-..-....--.--..--.-..-...--..-K.K..KKKK..........................................................DKREKKST---------------...---..-----..---...................---------------sedsvddsslsqtcdnrepnvdeteldlnsskphkkkkkdkrekqaksedsandgnlsqtcdvhepdvdgtevdtnsnslhkkkkdkrkdsdevspsgylidktsrkrpaadqiedhsettrlkkkkn........................................................................................
A3LV72_PICST/131-224                  .........................PQVGDVL.EGYI..YMQTASHLGLLIHDTFNAS..I.K.K.Y.N.........................I..PN......................N.WQFIP...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.S..QEDE..........................................................IADAATKSFGYWVDENESKIEGK...---..-LKFT..VKT...................IHTSGKVVSVEGTL-i.......................................................................................................................................................................................................................
A0A3B1KB85_ASTMX/133-323              .........................PKKGDKL.VGVI..NKMAVGHVGCLVHGCFNAC..V.M.K.P.H.........................LltPE......................Q.--WRDsgfkvgdhlefevfqldadvagvll........................................................................irgrlekyrvnelvaavsstemeeqrT-------..TEE..AAAE.P..E....SA.PK..DE.G..TedmDS..SK.P..KKKK..........................................................KKKKNKEL---------------...---..-----..---...................---------------dsetmedngnqvaemetldfnsngikvkpdsdgpsqekekekkkrrrrkikgtrrmkk..............................................................................................................................................................
A0A364KUH9_9EURO/175-346              .........................PQKGQVL.EGWV..NVQSEGFVGAIAHNLFSVG..I.E.R.K.R.........................V..PK......................S.WKWIP..........................................................................................................................pGADDDDVEnaASD..KKKG.Y..V....SA.TS..GD.E..D...GA..AG.S..N--Klafdaekehftplpkkvsrqp................inlpdsdtnmfgeefgeydeeEDDEASNATGYFQSVSGHRVRGT..iRFR..VRDVD..VIP..................gADPDRGFLSIEGTML........................................................................................................................................................................................................................
A0A1V9ZCH9_9STRA/81-128               .........................PQTGMEL.SAVV..CKVGSNHIGLLLNGVFNVS..I.A.S.D.E.........................M..PE......................G.YAHS-...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------ysdda...................................................................................................................................................................................................................
A0A409YWR0_9AGAR/79-180               .........................PRVGTQL.SGKV..SLCSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..PT......................D.-TWEF...........................................................................................................................--------..---..----.-..-....--.--..EY.G..P...AE..ND.P..EFGQ..........................................................TLESKQDSAGRWVHKVTGQPLDG...---..NLEFT..VIG...................LTVANEMLSLVGSLQ........................................................................................................................................................................................................................
A0A1Y1HMN1_KLENI/87-134               .........................PAAQNVL.AGSV..NKVGPAHIGLLALGAFNAS..I.R.A.D.E.........................I..GD......................A.FQYDP...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------dasa....................................................................................................................................................................................................................
A0A1Y2UBK4_9PEZI/280-409              .........................PTRGAWM.EGIV..NLQGEGHIGVVCWDMFNAS..I.E.A.G.R.........................L..PH......................G.WRWVD...........................................................................................................................LLSKGKDK.gKDR..SNDR.E..K....TA.EE..AK.L..P...TP..DP.F..DDPE..........................................................SDKTQIHTTGYWVDENGTRIRGG...AKL..YFRIKhyEVG...................VSGDYGYLSIEGTML........................................................................................................................................................................................................................
A0A384BPS3_URSMA/125-335              .........................PEPGQNL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PT......................E.-QWQNleinvgdelefevfrldsdaagvfcirgklnitslqtkcsavseevtetgtee................iiekplkkkkkkkkdpesyeiengnreladcadatmkketdlqidnvnslcnnePKKKKKKK..HQE..DQDQ.D..P....VF.QG..SD.S..S...GY..QS.D..HKKK..........................................................KKKRKHSEEAEF-----------...---..-----..---...................---------------tpllehspkkkrek..........................................................................................................................................................................................................
E4V032_ARTGP/199-341                  .........................PERGQTL.EGWI..NVQSEDFLGAIVFNLFSIG..I.E.R.R.R.........................L..PA......................D.WKWIApgqqpdk.............................................................................................................psttstsPTSSSK-D.eEDE..DDDE.P..D....SD.KE..NF.K..P...LA..SN.S..EASQ..........................................................FEDAASAETGYFQTRSGKRVRGT..iRFR..VRDVD..VIP..................gSERDKGFLSLEGTML........................................................................................................................................................................................................................
A0A671TE27_SPAAU/190-426              .........................PIKGQML.LGKV..NKLGVSHVGCLVHGCFNAS..I.P.K.P.N.........................L..VS......................V.ETWRDagprigaelefevtaldadtvgvllirgrmdrtrvqellalgessesgatadepep..........peteptpepmeespidtpkkkkkkkkdkvkeaetdtevtnesscqldgnttqelngtMDEANGNE.aGEK..KKKK.K..K....KK.DK..HP.K..E...EE..EE.V..EVSP..........................................................TDIHGSDSSGYLSDKPNKKRKHE...---..-----..---...................---------------tdvtsgvsddtetpkskkkrks..................................................................................................................................................................................................
A0A507F299_9FUNG/80-144               .........................PTEGSIL.VGLV..NKVSSDHIGLLVHGVFNAS..I.A.A.E.H.........................V.rKT......................E.FKFNNs.........................................................................................................................tK-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------vwnrcvdgnetadsiap.......................................................................................................................................................................................................
A0A5E4NLU0_9HEMI/33-266               .........................PPVGSIL.KAVV..NQTSDNHISCLVHNLFNVS..I.V.R.P.E.........................D.qPY......................D.-QWPGskikkediinvrvls.............................................................................................fdltkklphitgdivN-KNDRCS.kPEN..ELDN.Y..S....SQ.CS..ST.D..K...SA..KG.L..QKDS..........................................................-----------------------...---..-----..---...................---------------tsllkqlsrdselsdemhiitspfknknklkmspiykktsinnreyiknqlysstpisnsensvnditvirnkpfeqfknnlvkhnaeklsikqlkkyekdddsyakhnidvlnqervkqdsekev..........................................................................................
A0A1E4STR3_9ASCO/127-240              .........................PQIGDII.DGWS..YLQTQSHIGLLINDTFNAS..I.K.K.Y.N.........................I..PN......................T.WKFIP...........................................................................................................................--------..-NQ..IDEF.D..N....NS.NN..NG.N..S...TV..DN.I..NNNN..........................................................INNNSSKSLGQWVDENEVPIEGK...---..-LRFI..VKA...................LHTAGKVISIEGTLL........................................................................................................................................................................................................................
A0A1V4KC12_PATFA/79-286               .........................PKKGKKL.VGVV..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................I.IQWQElglkigdelkfrvlhlesdaagvffirgeltksslrp................................................kqtetitdstnadeiqkldhqenglndsqednvteeplA-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------emdntvggnaegqsvdaanglcdvkkkkkkkkhkeeeqghvlptsdssgyqsdhkkskkkkrkhcneveeselsqlsqeprakkkrae................................................................................................................................
A0A423X4T5_9PEZI/215-342              .........................PSRGAWM.EGEI..NLQSEGHIGVVCFEKFNAS..I.S.R.R.S.........................L..PR......................G.WKWVE...........................................................................................................................QPDEEVVE.eEEP..VVAE.D..D....PF.TE..KA.E..G...EG..AE.D..GETA..........................................................RDTHQVRSSGHWVDENGDRVSGK..vHFR..IKNFS..-SG...................STGDYTYLSLQGTML........................................................................................................................................................................................................................
A0A250XI53_9CHLO/84-127               .........................PAEGCML.VGKV..IKIAADFVGLLVLGVFNAS..I.A.A.D.S.........................I..RS......................E.FK---...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------cvd.....................................................................................................................................................................................................................
A0A175VWL9_9PEZI/317-444              .........................PSRGKWM.EGVL..QLQSEGHIGVVCWNKFNAS..I.E.A.K.R.........................L..PS......................G.WRWVD...........................................................................................................................LAKGGAKM.nISP..PPSQ.D..E....KG.QQ..DQ.E..S...ED..ML.D..GEEL..........................................................QVVEQIHTTGYWVNEHGRKVSGK..lRFR..IKNFD..V-G...................LAGEYGYLSIEGTCL........................................................................................................................................................................................................................
I4Y542_WALMC/80-132                   .........................PTNGQRM.RGKV..TLCSPDHISLLVHHTFNVT..I.P.R.E.Y.........................I.dCD......................N.FKYAS...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------dssetgsg................................................................................................................................................................................................................
A0A7J6JB21_COLFN/283-405              .........................PRRGAWM.EGVI..NLENEGHIGVVCWSKFNAS..I.E.S.A.R.........................L..PA......................E.WRWVH...........................................................................................................................----ADSA..EAA..QYVA.D..P....FA.AE..ED.A..A...EA..QA.A..EDEH..........................................................GAVRQIHTTGFWVDGAGEKVKGR..vRFR..IKAFD..V-G...................VSGDHGYLSLEGTML........................................................................................................................................................................................................................
A0A6F9CQ83_9TELE/140-351              .........................PQRGHKL.LGIV..NKLGVSHVGCLVHGCFNAS..V.P.KpA.H.........................V..TI......................D.-TWREagprigaelefevcqldadtvgvllirgrldrtrvqelmaagessdptdpa.....................eqleepdtepalepnqdspdatvkpkkkkkkekrreevalvaapgdavhgtAEDSSTSS.hTEE..RRKK.K..E....KR.QK..EE.D..V...ER..EV.D..ERGP..........................................................VELQGSDSSGYLSDKPNRKRKQ-...---..-----..---...................---------------gvditpclh...............................................................................................................................................................................................................
A0A2T6ZK22_TUBBO/85-187               .........................PVKGMLL.KGWV..NMAGASHVGLLVENTWNVA..I.P.R.E.R.........................I..PE......................G.WTWVE...........................................................................................................................--------..---..----.-..-....--.-G..GM.G..V...DG..EA.A..DVGE..........................................................GGEGVGVDEGYWVDGNGKKVEAF...---..-RNFK..VEA...................VKAMGHKVSMEGSLL........................................................................................................................................................................................................................
A0A1E3IY70_9TREE/126-240              .........................PKIDQKL.YGTH..SLSSPSHLSLLFSKTFNVS..I.P.L.Q.H.........................I..PT......................D.-MYEF...........................................................................................................................--------..--E..HTDE.Q..A....PD.KD..SD.D..D...ED..EV.V..YLGS..........................................................GAPPMVEQVGRWKEKETGKTLGE...-GG..KIKFT..VIG...................IQVSNCMLSLIGSLL........................................................................................................................................................................................................................
A0A1B7NLF5_9EURO/249-416              .........................PERGQPL.EGWI..NVQSDGFLGAVVYNLFSVG..I.E.R.R.R.........................L..PA......................D.WQWVApgqept..............................................................................................................asmleapI---AKTS.gNGN..DSGN.D..D....DE.EE..EE.E..E...ES..EF.D..SDKEnfrplpavstamld..............................lstqnqnddgtdqpFETFEDASEGYFRTRSGRRVRGM..aRFR..VREID..VIP..................gAEPDKAFLSIEGTML........................................................................................................................................................................................................................
A0A074VK21_9PEZI/156-267              .........................PTPGAVI.EGFV..SLQNESYLGLVCWNFFNAG..V.D.R.K.R.........................I..PS......................N.WKWVP...........................................................................................................................--------..---..----.-..-....NH.NA..NA.G..T...KS..AT.D..WMRG..........................................................LRNKSDESSGHYVDENGKKIEGK..iKFT..VKDFE..SAP..................sTDRERGFLSIEGTLL........................................................................................................................................................................................................................
I1RKQ5_GIBZE/273-386                  .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................D.WKWVP...........................................................................................................................--------..---..--NE.S..P....EA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWADGSGDKVKGK..iRFR..IRNFD..V-G...................TSGEISYLSLEGTML........................................................................................................................................................................................................................
Q4WAQ0_ASPFU/179-342                  .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................D.WKWVP...........................................................................................................................PGEEEEGN.gFNS..SGKP.K..K....KV.FS..ST.E..D...ED..DS.E..PSSHfdpekehfkpislasda........................npfsetmdpnngpaaddDDDDKSAAEGYFQSVSGHRVRGT..vRFR..VVDID..VIP..................gSDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A0N1H5A5_9EURO/299-441              .........................PTPGEEM.LGWT..NVASEGLVGLVSYNMFQAS..V.G.K.E.R.........................I..PE......................E.WRWVGpgsdst...............................................................................................................ahrkepRKGKLGSP.iKED..APSQ.H..N....QA.QA..DE.D..E...AA..AA.A..SKVT..........................................................RPRSEDDDKGHFLDTATNTRVPDt.lTYK..IVDVD..LVP..................gHAHGTLTYQIDASLL........................................................................................................................................................................................................................
A0A0L0SS37_ALLM3/14-128               .........................PTAGARL.TGVI..NKQSPSHIGLLVYNLFNAS..I.P.A.A.Q.........................L..PD......................GaFTFQF...........................................................................................................................--------..---..-DDT.A..A....YA.PT..GE.N..D...VD..DG.A..PRFN..........................................................KGGKKAMINGNWIHAASGSVLEP...-GH..ALDFV..VTE...................VVKSHDFISMKGTL-v.......................................................................................................................................................................................................................
A0A3Q0CVH2_MESAU/125-322              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.H.........................L..SY......................E.-EWQNleinvgdelefdvfrldsdsagvfcirgkldttslqlkssavsedvteigiee.................vaektskkkkkkkdagtavngvtelancadvtpkeetdllcggsvndvceeepK-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------kkkkkkkrhqedqdpvfqasdssgyqsdhkkkkkkrkhreeidsasp.........................................................................................................................................................................
A0A421J802_9ASCO/125-223              .........................PNAGDII.EGYS..YMQTASHIGLLVHDTFNAT..I.K.K.F.N.........................I..PA......................E.WRFVP...........................................................................................................................--------..---..----.-..-....--.--..--.-..S...QV..DE.Y..AETE..........................................................QETGKFKSFGYWVDENDVKIEGK...---..-IKFT..VKS...................VHASGRVVSLAGTL-i.......................................................................................................................................................................................................................
A0A0P7UGT1_SCLFO/118-338              .........................PKRGQKL.LGVI..NKVGASHVGCLVHGCFNAS..V.A.K.P.H........................hV..SL......................E.-AWKRaglnigdglefevaqldadv..................................................................................agvllirgrldkariqelmalS------N.cAED..VSEE.S..A....QP.ET..NM.T..D...GV..KT.K..RKKK..........................................................KDK--------------------...---..-----..---...................---------------mrddevlqdccapedspqdqketselidvaetnmngqingkkkkkkkkekcveapgdggvievlasapggeegykhskkrkkgleetemtpsadtenpkakrkk................................................................................................................
A0A059LIE5_9CHLO/84-145               .........................PVEKLQL.VATV..SKIAPDFVGLLWAGVVNAT..I.P.K.T.H.........................M..RA......................D.WQYNWs.........................................................................................................................aR---R---..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------wescedadqvivvg..........................................................................................................................................................................................................
C1H7Y2_PARBA/252-415                  .........................PERGQQL.EGWI..NVQSDGFLGAVVYNLFSVG..I.E.R.R.R.........................L..PA......................D.WQWVA...........................................................................................................................PGEGSSAT.pKSN..NTSI.S..A....AV.TD..DD.D..D...ED..SD.F..DSDKenfrplstrslaavldl........................sphsqynsthndpiqlsANPDEAATAGFFRTRSGRRVRGM..iRFR..VRDVD..VIP..................gAEPDKAFLSIEGTML........................................................................................................................................................................................................................
A0A316UHK9_9BASI/90-193               .........................PRVGMKL.RGAI..SLEAPSHVSVLVHETFNAS..I.P.S.S.H.........................M..GK......................E.WHWVH...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..RS.E..HDEE..........................................................EVDGSGGVAGYWERKETGERLGS...---..HVEFV..VIGlti............lanvGGGGGHTLALCGSLL........................................................................................................................................................................................................................
J3PI81_GAET3/292-439                  .........................PRRGAWM.EGTV..NLHSEGHLGVVCWGRFNAS..L.E.A.R.R.........................V..PR......................G.WRFVDvvqraedakk......................................................................................................arfrnagkktaAAVADDAS..VAS..WQVN.G..Q....DG.PN..NN.N..N...ED..EA.P..EDLE..........................................................NSLQQMHATGYWIDAEGRRVQGK..lRFR..IKNYD..-VG...................TAGDHGYISIEGTML........................................................................................................................................................................................................................
C5GBZ2_AJEDR/251-414                  .........................PERGQLL.EGWI..NVQSDGFLGAVVYNLFSVG..I.E.R.R.R.........................L..PA......................D.WQWVApgees................................................................................................................ttaalgT-------..--T..TPKR.S..S....GT.DD..DD.D..D...DN..ED.K..DSDFdsdkenfrplpatsst.........................ildlnaqnhnhegmeppFEAFEDAAAGYFRTRSGRRVRGM..vRFR..VRDVD..VIP..................gAEHDKGFLSIEGTML........................................................................................................................................................................................................................
G3JV16_CORMM/259-372                  .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................S.WKWVS...........................................................................................................................--------..---..--NE.D..P....EA.EG..ME.E..T...AS..IV.A..PDEH..........................................................GVVHQIHSTGFWVDAHGDKVKGK..iRFR..IRNFD..V-G...................VSGETTYLSLEGTML........................................................................................................................................................................................................................
A0A0C4F606_PUCT1/156-270              .........................PTIGQKL.VGRP..TFSSPSHLSLVIYRTFNAS..I.N.E.N.H.........................L..KA......................A.-GFHY...........................................................................................................................-------D.iNFE..V---.-..P....AN.WK..SI.G..D...PS..NS.Q..SVPI..........................................................DLSHEHKDRGCWLDANGVVVGGA...-EA..TVSFT..VMS...................LTIANNMISVIGSLL........................................................................................................................................................................................................................
A0A0L0N1G5_TOLOC/306-419              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................A.WKWVS...........................................................................................................................--------..---..--NE.S..P....DA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWVDGSGARVKGK..iRFQ..IRNFD..A-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
A0A1R3R968_ASPC5/76-247               .........................PQRGQIL.EGWV..NVQSEGFLGAIVLNLFTVG..I.E.R.K.R.........................L..PP......................S.WKWIP..........................................................................................................................pGEEQEEEQ.qQQQ..QQQS.S..S....ST.ED..AQ.E..D...EE..GD.S..DSSSqqknktpfdpekelfrpial.................asdvnpladtdtnesgnntanDEDEDAAAEGYFQSVSGHRVRGT..iRFR..VVDVD..VIP..................gSERESGFISIEGTML........................................................................................................................................................................................................................
A0A5E4BR63_MARMO/125-324              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.K.P.E........................qM..SV......................E.-QWQTleinmgdelefevfrldsdaagvfcirgkiniaclqskhpnvseevtetl.......................teesvekipkkkkkkkkdpeiyevndgvtepadftgitpkeeeelqvsndM-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------nglceeepkkkkkkkkhqedqdpifqcsdssgyqsdhkkkkkkrkhseeaeltpv.................................................................................................................................................................
E9DYY3_METAQ/282-395                  .........................PSRGAWM.EGSV..NLQTEGHIGVVCYGKFNAS..V.E.A.R.R.........................L..PP......................A.WKWVS...........................................................................................................................--------..---..--NE.S..P....EA.HG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWVDGNGDRVKGK..vRFR..IRNFD..A-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
A0A0A2LLC1_PENIT/156-295              .........................PKRGQTL.DGWV..NVQSEGFLGAVVFNLFSVG..V.E.R.K.R.........................L..PS......................N.WKWVA...........................................................................................................................PGEEAETP..AVT..DDDS.G..S....DK.DM..AD.F..D...AE..KE.C..FKPAtlsae...............................................eiaidgEEEDESAHSGYFQSVSGHRVSGS..vRFR..VVDVD..VIP..................gSERDRGFLSIEGTML........................................................................................................................................................................................................................
W9YCY8_9EURO/260-400                  .........................PERGDEL.YGWT..NVTSEGFVGLVSYNYFQTA..V.A.K.N.R.........................I..PQ......................D.WIWNG...........................................................................................................................PSREDTSK.tKKK..SKKG.R.lR....DE.DD..SP.S..Q...TP..ED.-..---Eiaaqngd............................................wdagpaaSSQVQIDEVGFFVDAHGSKVLPT..qKFR..VVDTE..VVP..................sHDRHKWSLQIEGTLL........................................................................................................................................................................................................................
A0A1X7RR62_ZYMTR/128-193              .........................PERGSLL.DGFV..NLQSESMLGLLCYNYFNVA..I.A.R.E.G.........................L..PE......................G.WNWDG...........................................................................................................................ESWND---..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------aegnpvgegrkvkckve.......................................................................................................................................................................................................
A0A1Y1VUA6_9FUNG/84-142               .........................PKKNLEI.VGKV..NKVSADHIGLLLYGVINAS..I.P.S.D.K.........................I.rKK......................N.FKWDE...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------nsfawketfgerrk..........................................................................................................................................................................................................
A0A6J0C6R1_NEOLC/104-359              .........................PNIGDEL.KGIV..NKKSQDHVGILLNKVFNVS..I.P.R.P.D.........................E..DE......................N.WP--Gfytqigqevrftitylelkgr.................................................................................lpyirgsmdaenylrnckpldD-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------tfeavdeddepvtkpnaikfsysdeegeedsnefvvdrksrvnkvihtrddsdidekllprklkelenddsedeihvkkmekhkaktnisfpeikldlygedpinedrdiddelypkskilkketnrdevptkkkkrnkvkmeetsadleksvrhisensdvveetlppks.............................................
M9LWC2_PSEA3/140-236                  .........................PKIGQML.EGTI..CLSSPSHVSLLLYGLFNAS..I.P.A.S.H.........................L..PE......................E.-DWEF...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.V..LNDA..........................................................EAGSNDHGLGYWQSKSDGSRLGG...QKG..TLAFT..VIS...................LTVANHMLSLHGSLL........................................................................................................................................................................................................................
A0A6I9IGG2_VICPA/125-335              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M.aPE......................Q.WQTLEinvgdelefevfrldsdaagvfcirgklsitslqtkrsa............................................vseevtetgteeavekppkkkkkkkedpepyeveggttelA-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------dfadvtmerdmqmnnnvnglleekpkkkkkkkkhqedqdqdplfqgsdssgyqsdrkkxkkkrkhseeaeftpllehvpkrkgks...................................................................................................................................
A0A5N7B5Y2_9EURO/188-336              .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGDEGSVN..GDQ..QKTA.T..A....SE.DD..ES.E..P...AA..SF.D..QEKEhfnpvslanp......................................vsdtlneeanAEDDESAAEGYFQSVSGHRVRGT..vRFR..VVDVD..VIP..................gSERDRNFLSIEGTML........................................................................................................................................................................................................................
H3GGU1_PHYRM/84-130                   .........................PKEGMKL.RGIV..NKIGSNHVGMLFAGVFNGS..V.S.E.A.E.........................L..PK......................G.YVHNY...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------aqd.....................................................................................................................................................................................................................
A0A091FNC1_9AVES/41-249               .........................PQKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.Q.........................Q..MS......................I.VQWQElglkigdelkfqvlhldsdaagvffirgglakssmrpkksetitdstngd......................eipkldhqensfndseggvvteqslgetdnagrengeeqnvnamngvcddkN-------..---..----.-..-....--.KK..KK.K..K...KK..HK.Q..EEQE..........................................................-----------------------...---..-----..---...................---------------hvlptsdssgyqsdhkkskkkkrkhcdeveesefsqvsqepkakkkrd........................................................................................................................................................................
A0A2T4C059_TRILO/258-371              .........................PSRGAWM.EGTI..NLQTEGHIGVVCFGQFNAS..I.E.A.R.R.........................L..PS......................S.WKWVS...........................................................................................................................--------..---..--NE.D..P....SA.HG..ME.E..T...AS..VI.T..ADDQ..........................................................GVVRQIHSTGFWVDASGNKVKGK..iRFR..IRNFD..V-G...................VSGETSYLSLEGTML........................................................................................................................................................................................................................
S3CX65_GLAL2/153-254                  .......................es---GVEI.EAYV..NLQNEGHVGLVCWNLFNAS..I.E.R.K.R.........................L..PA......................D.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..--.-..V...EE..LE.A..EEGA..........................................................EDNYAPDGAGYYVDGSGNKVEGK..yMFR..IKDVQ..-TD...................SDPQRGFVSIEGTML........................................................................................................................................................................................................................
A0A3M0JVM5_HIRRU/113-321              .........................PKKGKKL.VGVI..NKVAPTHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................I.VQWQElglkigdelkfqvlhldsdtagvffirggltkssmrpkks..........................................davtestngdeiqkldhqenglndcgednvteeplnemgslGRENEEEQ.sVDA..VNGL.C..D....DK.KK..KK.K..K...KK..DK.Q..GEQE..........................................................LVLPTSDSSGY------------...---..-----..---...................---------------qsdhkkskkkkrkhcdeveaselsqlsekpkakkrkgt..................................................................................................................................................................................
A0A1Y3NGC7_PIRSE/45-80                .........................PKKNLEI.VGKV..NKVSADHIGLLLYGVVNAS..I.P.S.D.K.........................I..--......................-.-----...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------........................................................................................................................................................................................................................
A9UYD7_MONBE/71-243                   .........................PSVGMLL.RGVV..NKISESHVGVQINDQFNAS..V.A.K.A.D.........................L..PR......................D.YQFNAaentydhaatperqltigskvivlvadlmrsshgainikgq........................................mnqpgtgpdfreeeeedevpavetvrtpvqsqsatpqvegskK------K.hKSK..KSKE.D..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------aaptpssskkrghkdvasdtptkakkskkdkskaq.....................................................................................................................................................................................
C7YZW4_FUSV7/279-392                  .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................D.WKWVP...........................................................................................................................--------..---..--NE.S..P....EA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWADGSGEKIKGK..iRFR..IRNFD..V-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
A0A162JK33_CORDF/261-374              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................S.WKWVS...........................................................................................................................--------..---..--NE.D..P....EA.EG..ME.E..T...AS..IV.A..PDEH..........................................................GVVHQIHSTGFWVDANGDKVKGK..iRFR..IRNFD..V-G...................VSGETTYLSLEGTML........................................................................................................................................................................................................................
F7W7D9_SORMK/241-364                  .........................PARGKWM.EGVV..QLQSEGHIGVQCWGRFNAS..I.E.A.K.R.........................L..PK......................G.WKWVD...........................................................................................................................--LKGDK-..SYN..QHEE.E..Q....EE.EQ..EE.E..E...DD..QL.D..GEEL..........................................................QVVEQVHTTGYWVDASNKKVSGK..vRFR..IKNFD..V-G...................LAGDYGYLSLEGTFL........................................................................................................................................................................................................................
A0A4W2GCM4_BOBOX/121-328              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................D.-QWQTlqinvgdelefevfrldsdaagvfcirgk.................................................................lsiaslqtkcsavpeeapetgadepvekpPKKKKKKK.kDRE..PCEV.E..G....GA.TE..PE.D..F...AE..VA.T..KDEA..........................................................DLHVSNSVNGLWEEEPKKKKKKK...KQE..H----..---...................---------------qdqepvfqgsdssgyqsdhtkkkkkrkseeaeftplvertpkkk............................................................................................................................................................................
A0A3Q1C138_AMPOC/141-379              .........................PKKGQKL.LGKV..NKLGVSHVGCLVHGCFNAS..I.P.K.P.N.........................L..VS......................V.ETWRDagprigaelefevtaldadtagvllirgrmdrtrvqellamgessestvpeeqte.............pqdteptpeptqdsldgtpkkkkkkkkvkeeeteeeivsvssgqqdssataalngT-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------tdeangdeagekkkkkkkkekrlkeeeeemelsrvevhgsdssgyisdkpskkrkhetanedtsglsedpepkkskkkrksdie....................................................................................................................................
A0A395HQW4_ASPHC/185-377              .........................PQRGQLL.EGWV..NVQSEGFLGAIALNLFSVG..I.E.R.K.R.........................L..PS......................D.WKWIPpgdeqedess.......................................................................................................ttttnntsanTSAKTSDA.tNPT..STSS.D..D....DD.DN..SE.D..E...ES..DT.E..TKPKfdpalehftpvtlasdanpln...............plnsnpstdstpttnaavvednNDDDDDGVEGYFQSVSGHRVRGT..iKFR..VVDID..VIP..................gSERDRGFISIEGTML........................................................................................................................................................................................................................
A0A284QLS7_ARMOS/126-244              .........................PHVGMRL.EGRI..NLCSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..PS......................E.-DWEF...........................................................................................................................---EYG--..-PA..-END.P..Q....FG.PD..AA.E..K...DG..EE.A..ALPP..........................................................AERSGGEEGGRWIHKLTGDLIGG...KSG..HLEFT..VIG...................LTVANEMLSVVGSI-q.......................................................................................................................................................................................................................
A0A6P7HFY1_DIAVI/40-170               .........................PEIGKIM.EGVV..KRKSKDHIGALVYEAFNVS..I.P.L.T.SdddeeelgntvkvgdtvtfqiiyinL..--......................-.----Tsrlpyirgrlmse.................................................................................................ttetetneiseikI-------..--K..KRKK.K..S....KT.ET..TE.T..E...TN..ET.T..ETKV..........................................................KKKKSK-----------------...---..-----..---...................---------------tkekkveemedd............................................................................................................................................................................................................
L8IEQ3_9CETA/121-331                  .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................D.-QWQTlqinvgdelefevfrldsdaagvfcirgklsiaslqtkc.............................................savpeeapetgadepvekppkkkkkkkkdrepcevegsaT-------..---..----.-..-....--.-E..PE.D..F...AE..VA.T..KDEA..........................................................DLHVSGSVNGLWEEEPKKKKKKK...---..-----..---...................---------------kkkkqehqdqepvfqgsdssgyqsdhtkkkkkrkseeaeftplverapkkk.....................................................................................................................................................................
A0A453KJY1_AEGTS/62-212               .........................PQPEMIL.EGKV..EMLGKESIHAIVLGVFSAA..I.M.A.D.D.........................I..PE......................M.FKFKRrghggkfisqsdkrhvikkgsmirfsvkrvd............................................................temnchitgslmpphtgcmrwlsvhdaeyaseI-------..--S..SGKR.K..P....RD.HT..KS.E..Q...KV..QG.R..TTAN..........................................................RED--------------------...---..-----..---...................---------------smvnserprksrkrav........................................................................................................................................................................................................
M7TNG4_BOTF1/159-265                  .........................PEKGAWL.EGYI..NLQNEGHLGLVCWNLFNAS..I.E.R.A.R.........................L..PK......................E.WRWVG...........................................................................................................................--------..---..----.-..-....--.-V..ED.Q..E...KD..AE.A..EAEE..........................................................GATYAEDGIGYYVDGEGKKIEGT...VKF..RVKEI..ESN...................HDKERGFLTIDGTML........................................................................................................................................................................................................................
S3BN74_OPHP1/222-384                  .........................PSRGAAL.EGKV..ILQNEGAMGVSCWDKFNAS..I.E.A.A.R.........................L..PS......................G.WQYIEyaegegpvaavaa................................................................................................astvstasaasnkkI-------..LFD..DDAP.D..Q....SM.AD..AD.A..A...AA..--.-..---Qiageaaevvsd....................................ptepapatgfaGDLEELQSTGYWVDEQGTPVTGT..vRFR..IKDFD..V-G...................LAGDNGYLAIEGTML........................................................................................................................................................................................................................
G0VFN6_NAUCC/123-240                  .........................PQVGDVL.EGYI..FIQSASHIGLLIHDAFNAS..I.K.K.N.N.........................I..PT......................D.WTFIE...........................................................................................................................----NEAE..-YI..DEDT.E..S....GD.SR..TD.G..S...NE..ET.N..NRSE..........................................................TKSFVNRSLGYWVDANGSRIDGK...---..-LKFK..VRN...................VFTTGRVVSVEGTLQ........................................................................................................................................................................................................................
G1LPM2_AILME/125-327                  .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PT......................E.-QWQNleinvgdelefevfrldsdaagvfcirgklnitslqtkcsavseevtetgtee................iiekplkkkkkkkkdpesyeiendnreladcadatmkketdlqigdvnslwnnePKKKKKKK.kHQE..DQDQ.D..P....VF.QG..SD.S..S...GY..QS.D..HKKK..........................................................KKKRKHSE---------------...---..-----..---...................---------------eaeftplle...............................................................................................................................................................................................................
A0A4Q4YHV6_9PEZI/536-661              .........................PKRGSWM.EGSL..NLQSEGFIGVICFGMFNAS..I.E.A.S.R.........................L..PS......................G.WKWVD...........................................................................................................................--LLSKKG.gKQQ..NGKS.A..A....EA.KL..PT.P..E...PQ..DE.N..GEED..........................................................DGTNQAHSTGYWVDESGSKVGGK...LRF..RIKNY..EVG...................SVGDYGYLSIEGTML........................................................................................................................................................................................................................
A0A0D0DQY9_9AGAM/165-302              .........................PCVSMKL.VGKI..NLCSPDHISLLVHRIFNVS..I.P.R.H.H.........................I..PQ......................D.-QWIFeygpaen.............................................................................................................dpefgegR---GWDA.eGKS..NGEI.D..E....EG.DV..EM.K..G...AS..GD.E..GQSP..........................................................GEAREPESSGRWVHHLTGGKIGD...SDG..YLEFT..VIG...................LTVANEMLSLQGSI-q.......................................................................................................................................................................................................................
A0A4Z1HHF7_9HELO/159-265              .........................PEKGAWL.EGYI..NLQNEGHLGLVCWNLFNAS..I.E.R.A.R.........................L..PK......................E.WRWVG...........................................................................................................................--------..---..----.-..-....--.-V..ED.Q..E...KD..AE.A..EAEE..........................................................GATYAEDGIGYYVDGEGKKIEGT...VKF..RVKEI..ESN...................HDKERGFLTIDGTML........................................................................................................................................................................................................................
A0A6P6IBA8_PUMCO/125-332              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................E.-QWQIleinvgdelefevfrldsdaagvfcirgklntsslqtkcstvseevtetgt.....................eeivekplkkkkkkktdpepyevesdnreladfadvtvkeetnlqinntngF-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------qneepkkkkkkrhqedqdpvfqgsdssgyqsdhkkrkkkrkhseeaeftpllehsskkkre...........................................................................................................................................................
A0A6G1GHI7_9PEZI/175-282              .........................PKRGQQL.EGWI..TLQNDSHIGLTCWNLINAS..I.E.R.K.R.........................L..PE......................S.WTWID...........................................................................................................................--------..---..----.-..-....--.--..HV.L..V...EG..ED.F..STVP..........................................................SIPKGKHGSGHYIDGKGRELGDT...---..-LSFT..VADyey.............lwmSEAERGLLRIEGTLL........................................................................................................................................................................................................................
A0A2K6FDT6_PROCO/125-335              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWQTleinlgdelefevfrldsdaagvfcirgklnisslqfkssevseevtetgteevv.............ekppkkkkkkkkdpetyeadsvtikqadfaddtpkeeldlqitnnvsglceeepkKKKKKKKK.kDQE..DQDQ.D..P....VF.QC..SD.S..S...GY..QS.D..HKKK..........................................................KKKRKHNEEAEF-----------...---..-----..---...................---------------tspkrkgksn..............................................................................................................................................................................................................
A0A074XHN0_AURPU/164-275              .........................PTPGAVI.EGYV..SVQNESYLGLVCWNFFNAG..V.D.R.K.R.........................I..PT......................T.WKWVP...........................................................................................................................--------..---..----.-..-....NH.NA..TA.G..T...KS..ST.D..WMRG..........................................................LRNKSDESSGHYVDADGKKVEGL..vKFT..VKDFE..SAP..................sTERERGFLSIEGTLL........................................................................................................................................................................................................................
T0RQ13_SAPDV/93-140                   .........................PTPGMEL.SAVV..NKVGSNHIGLLLAGVFNVS..I.D.A.A.E.........................M..PD......................G.YTHNF...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------heea....................................................................................................................................................................................................................
A0A0F4Z8R0_9PEZI/228-329              .........................PAPGAWM.RGAV..VLQTEGHIGVVCWGKFNAS..I.E.A.S.R.........................L..PR......................T.WRWVA...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...AE..EA.Q..FDAD..........................................................VDADTETASGHWIDGTGARIDGA..vLFR..VKRFD..V-G...................VRDEHSFISIEGSML........................................................................................................................................................................................................................
A0A287R998_HORVV/86-240               .........................PQPEMIL.EGKV..EMLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..PE......................T.FKFKRsqrghggkfisqldkqhvikkgsmirfsvkrvdt.......................................................emnchitgslmpphtgcmrwlsvhdaeyaseissG-------..---..--KR.K..S....RD.HT..KT.E..H...NV..QG.R..AT--..........................................................-----------------------...---..-----..---...................---------------vnsedsvvnserprkskkrsvee.................................................................................................................................................................................................
G4N9S9_MAGO7/327-467                  .........................PRRGAWM.EGVV..NLQSEGHLGVVCWNRFNAS..I.E.A.N.R.........................V..PE......................G.WKFIDvvqkae..............................................................................................................dakkakfRNAGKKIN.lEEA..EGEG.D..E....EA.EA..AE.E..A...GE..DD.Q..EELE..........................................................ASLQQMHATGYWVDAAGKRIAGK..iRFR..IKNFD..V-G...................TAGDHGYISIEGTML........................................................................................................................................................................................................................
A0A2H3CCH6_9AGAR/126-244              .........................PHVGMRL.EGRI..NLCSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..PS......................E.-DWEF...........................................................................................................................---EYG--..-PA..-END.P..Q....FG.PD..AA.E..K...DG..EE.A..ALPP..........................................................AERSGGEEGGRWIHKLTGDLIGG...KSG..HLEFT..VIG...................LTVANEMLSVVGSI-q.......................................................................................................................................................................................................................
A0A2K5MG82_CERAT/125-332              .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWLTmeinmgdelefevfrldsdaagvfcirg..................................................................klnitslqfkrsevseevtengteeaakkPKKKKKKK..DPE..TYEV.D..S....GT.TK..LA.D..D...AD..DT.P..MEES..........................................................ALQNTNNVNGLWEEEPKKKKRKK...---..-----..---...................---------------khqevqdqdpvfqgsdssgyqsdhkkkkkkrkhneeaeftpplkcspkrk......................................................................................................................................................................
A0A665TRC7_ECHNA/141-343              .........................PKKGQKL.LGKV..NKLGTSYVGCLVHGCFNAS..I.P.K.P.N.........................L..VS......................M.ETWRDagprigaevefevtaldadvvgvllirgrld.............................................................rtkvqelmamgesselsipteqpdtepkpepT-------..---..--EQ.S..P....DE.TS..KK.K..K...KK..KK.K..KDTEe.......................................................erEEQIASEPNGTIVEANGNEAGEK...---..-----..---...................---------------kkkkkkkdkhtaeedvelspvevhgsdssgyisdkpskkrkhdidsdat.......................................................................................................................................................................
A0A194SCX3_RHOGW/173-353              .........................PRVGMKL.LGTL..TLASPSHVSLLLHNLFNAS..I.P.S.S.H.........................I..PS......................Q.-DYEFdpecavppivlerrnanvplrsvvdsv....................................................................krragaaaaaedggegaveetvtgepgsEHLVPQSA..AGE..ADVA.K..A....EA.DA..EE.E..Q...DE..ED.E..LKEE..........................................................EDEALLAERGWWVHRTTREPLGG...SDG..RIEFT..LVD...................LTTTNSLLSCTGSLL........................................................................................................................................................................................................................
A0A194USG2_9PEZI/221-353              .........................PSRGAWM.EGEI..NLQSEGHIGVVCFEKFNAS..I.S.R.R.S.........................L..PK......................G.WTWVDqpd.....................................................................................................................edyVAEEEAPA..VEE..DPFT.E..K....AE.GE..EA.E..G...AE..GE.D..GNTA..........................................................RNTHQVRSSGHWVDENGDRVSGK..vHFR..IKNFS..-SG...................STGDFTYLSLQGTML........................................................................................................................................................................................................................
A0A087X5M1_POEFO/137-373              .........................PKRGQKL.LGKV..NKLGVSHVGCLVHGCFNAS..I.P.K.P.N.........................L..VS......................V.ETWRDggprigtelefkvttldadaagvllirgqldrtrvqellam........................................sensessvpadqedpqeaepapepqeaepapepqeaepspepT-------..---..----.-..-....--.--..--.-..-...--..--.-..---Hdgtpkkkkkkkkekerik.....................eeemeeqitktppglngstE----------------------...---..-----..---...................---------------qtnssdtperkkkkkkekhvkeeeeqmevsavenhrgfgdkpskkrklesgtdapsgddvtpkkskkkkk..................................................................................................................................................
A0A0G4KLU3_9PEZI/698-815              .........................PKRGAWM.EGSI..NLESEGHVGVVCWGKFNAS..I.E.S.A.R.........................L..PP......................A.WRWVH...........................................................................................................................--------..-LG..TDET.A..A....TS.AH..DD.T..V...SN..FT.A..EEQH..........................................................GAVRQIHATGYWVDEAGQKVKGR..vRFR..IKAFD..V-G...................VSGDHGYLSLEGTML........................................................................................................................................................................................................................
D4AJZ0_ARTBC/199-341                  .........................PERGQTL.EGWI..NVQSEDFLGAIVFNLFSIG..I.E.R.R.R.........................L..PA......................D.WKWIApgqqsdr.............................................................................................................psttsasPTSSSKDE..EDD..DDDE.P..D....SD.KE..NF.K..P...LA..SN.S..EASQ..........................................................FEDAASAETGYFQTRSGKRVRGT..iRFR..VRDVD..VIP..................gSERDKGFLSLEGTML........................................................................................................................................................................................................................
A0A673SRE3_SURSU/152-360              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................E.-QWQIlevnvgdelefevfrldsdaagvfcirgklnisslqakcstvs....................................eevtdtgteeivekplkkkkkkkkdaepceveagsreladladgPVREETDQ.vTNE..NGLQ.K..E....EP.KK..KK.K..R...RH..QE.D..QDQD..........................................................PVFQGSDSSGYQSDHKKKKKKRK...HSE..EAEFT..---...................---------------pllehtskkkrk............................................................................................................................................................................................................
G0WBT5_NAUDC/124-245                  .........................PHVGDIM.EGYI..FIQSASHIGLLLHDAFNAS..I.K.K.N.N.........................I..PE......................D.WTFIS...........................................................................................................................--NDEEYI.aETS..RTDD.G..D....KN.EN..NN.G..N...EG..NN.N..NGIQ..........................................................GNSYVNRSLGYWVDANGSRIDGK...---..-LKFT..VRN...................VHTTGRVVSVEGTL-y.......................................................................................................................................................................................................................
A0A1X0RQX1_RHIZD/126-242              .........................PKKGSKL.VGRI..NLQSEDHIGLLIYGTFNAS..I.P.K.S.R.........................I..PS......................S.-MYEW...........................................................................................................................--------..KVS..EEDD.A..P....VQ.EE..SS.I..D...ED..ED.G..KEST..........................................................PEERKRTQYGEWVNKQTGASIGG...DDG..TVEFT..VID...................IIEANDILTVTGSL-........................................................................................................................................................................................................................
A0A0C3PNM4_PISTI/121-261              .........................PRVGMKL.VGKI..NLYSPDHVSVLVHRTFNVS..I.P.R.H.H.........................I..PC......................D.-QWTFeygpakn.............................................................................................................dpefgpgRDSEGHES.sAEG..EELT.S..V....TR.--..--.-..-...--..--.-..---Eiemqdvl............................................pdvmakqSKDKVSESSGRWVHHLTGKRLGD...PDG..YLEFT..VIG...................LTVANEMLSLQGSI-q.......................................................................................................................................................................................................................
A0A182YCA6_ANOST/105-344              .........................PRIGSTL.RGTV..NYVSKKFVSAMIYRVFNVT..V.K.L.G.Kqtvtt..............gsditfI..--......................-.----Vkscdmkseipvie.................................................................................................gelvlndtlppvnVKQEPDSN..EEE..EVQD.Q..P....DH.NN..SS.A..S...KA..KK.A..KKQKvaekekpirrnsva..............................pplaqpdgstdssdD----------------------...---..-----..---...................---------------sddstdeksmlikslinqmfgdqftngdssdkkkkktpkkttpaletspavvarvkqeplstdeeesvdsghstsqsnetiptassskkvpskgtveqkrkki.................................................................................................................
A0A1X7R4Z3_9SACH/126-234              .........................PQVGDIL.EGYV..FIQSASHIGLLIHDAFNAS..I.K.K.N.N.........................I..PS......................D.WTFIR...........................................................................................................................--------..---..---N.E..E....QV.TE..DT.E..N...QD..ES.N..TENQ..........................................................PKVHKPHSMGYWVDANGEQIDGK...---..-LQFT..VRN...................IFTTGRVVSVEGTLL........................................................................................................................................................................................................................
A0A507QXG3_MONPU/181-331              .........................PQRGQVL.EGLV..NVQSEGFLGAVVFNLFSVG..I.E.R.K.R.........................L..PA......................N.WKWIP...........................................................................................................................PGEEDSGK.kKNN..STED.G..N....DD.SN..SS.S..P...SS..NF.D..PEKEyfnlsaspds.....................................dgvdtlgqdpsSEGPDESAAGYFQSVSGHRVRGT..vRFR..VVDID..VIP..................gSERDRGFISIEGTML........................................................................................................................................................................................................................
A0A0C3EM83_9AGAM/118-232              .........................PRVSMKL.VGKI..NLCSPDHVSLLVHRIFNVS..I.P.R.H.H.........................I..PQ......................D.-QWTF...........................................................................................................................--------..---..EYGP.A..E....ND.PE..FG.A..G...RA..EA.Q..GHDE..........................................................TPNASGDSSGQWAHHLTGEKLGS...PDG..YLEFT..VIG...................LTVANEMLSLQGSI-q.......................................................................................................................................................................................................................
A0A1X2G8Q3_9FUNG/120-225              .........................PKKGSKL.VGRI..SLQSQDHVGLLIYGTFNAS..I.P.R.S.N.........................L..SE......................K.YEWST...........................................................................................................................--------..---..----.-..-....--.-S..EN.H..D...ED..EE.E..QSED..........................................................QETRNKSQNGEWVTKSSGARIGG...DDG..SLEFT..VVD...................ITEVNDILTVTGSL-........................................................................................................................................................................................................................
W4GB78_9STRA/84-131                   .........................PTPGMQL.TATV..NKVGSNHIGLLLAGVFNVS..I.A.A.T.E.........................M..PS......................G.FVHNY...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------heda....................................................................................................................................................................................................................
A0A545A1I6_9PEZI/129-233              .........................PEKGTWL.EGVI..SLQNDGFIGVVCWNLFNAS..I.E.R.R.R.........................L..PS......................D.WKWKD...........................................................................................................................--------..---..----.-..-....--.--..-A.S..E...IP..GF.K..EQED..........................................................SDTHACEGAGTYVDGEGRRVNGV...---..-IKFR..VADie...............scQDRERGFLTIVGTML........................................................................................................................................................................................................................
A0A4P6XT47_9ASCO/165-267              .........................PQLGDLL.QGYV..YMQTASHIGLLVHDTFNAS..I.K.F.R.N.........................I..PQ......................D.WEFVP...........................................................................................................................--------..---..----.-..-....--.-S..QA.D..E...VG..ES.E..DALQ..........................................................TSSSKFKSFGYWTDASGTKVEGK...---..-VSFS..VKA...................IYTSGKMLSIEGTLL........................................................................................................................................................................................................................
A0A2V1DZZ9_9PLEO/136-251              .........................PLANARI.TASI..THQSSTHMTLSYLNLFAVT..V.L.R.K.D.........................M..PD......................D.WRWHE...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...EG..VG.K..KRKG..........................................................WDGRIEDLGGWWVDGEGRRVGGG...GGG..EVKVR..EEVevrilew.....darpaggGAKGRGFLKIEGSFL........................................................................................................................................................................................................................
A0A5N6FDV1_PETAA/243-393              .........................PQRGQIL.EGWV..NVQSEGFLGAVALNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWLP...........................................................................................................................PGEEGSVN.gDKK..TAAS.T..T....A-.SE..DD.D..L...EP..SA.S..FNPEkehfnpvslan....................................pisdtlneeanAEDDESPAEGYFQSVSGHRVRGT..vRFR..VVDID..VIP..................gSERDRSFLSIEGTML........................................................................................................................................................................................................................
G3AIG6_SPAPN/119-217                  .........................PQVGDVL.EGDI..YMSTASHLGLLIGDTFNCS..V.R.K.H.G.........................I..PR......................D.WRFVP...........................................................................................................................--------..---..----.-..-....--.--..--.-..I...QQ..DE.V..EEEG..........................................................ESKGRVKSFGYWVDENEVKVEGK...---..-LKFT..VKA...................LHTTGRVVSIEGTL-i.......................................................................................................................................................................................................................
F6Z410_ORNAN/161-369                  .........................PEKGATL.VGQV..NKVSPSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..QS......................E.-QWKDlgiqigdelefevfrldsdaagvfc.........................................................................irgqlnenslkakcpesqapeesaeI-------..---..----.D..H....DP.GA..TE.E..T...PK..KK.R..KKKK..........................................................DSKNHEEGDG-------------...---..-----..---...................---------------aaeaadsatvavkeetdiqpidgvnglcetplkkkkkkrkreereaqdpgfhgsdssgyqsdhkkskkkkrkhcdadssqlleep...................................................................................................................................
B6JYA1_SCHJY/83-149                   .........................PEKDDRL.EGQV..NLVSPSHIGLLVMGIFNAS..I.P.R.E.C.........................I..PS......................T.WSFIE...........................................................................................................................PSTTEEQ-..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------gkwktdegeivepgsk........................................................................................................................................................................................................
A0A0L6V9T4_9BASI/160-276              .........................PTIGQKL.IGRP..TNSTPSQLSLVIYRTFNAS..I.N.A.N.H.........................L..RA......................A.-GYHY...........................................................................................................................--------..DLN..FEFP.A..N....WD.SI..GH.P..A...PP..QD.P..SLPF..........................................................DLTNQHRHRGCWVDAHGVAVGGD...-EG..TVSFT..VMS...................LMIENHMISVMGSLL........................................................................................................................................................................................................................
A0A6F9ABN0_9TELE/24-203               ........................p--RGQKL.LGRV..NKLGVSHVGYPVHGCFNAS..I.L.KpA.H.........................F..TM......................E.-TWREagprigaelefevcqldadtvgvlli.......................................................................rgrmgrkqvqklmaagessdpndpaeQLEEPDTE.pALE..PDLE.P..S....HR.ET..Q-.-..-...--..--.-..---Eeekgqtqrkrlq..................................yrhpasrealclEQQRTVALTATWRRRKGRKRMTE...---..-----..---...................---------------rggeggevevsrgg..........................................................................................................................................................................................................
A0A5J9VEW5_9POAL/115-277              .........................PQPNMML.EGTV..EMLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..HE......................K.FKFKRdqhdgllkcivqqssyi.........................................................................................iffmhnvtaeiqsnntsE-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------dfmvdtemnchitgslipphtgsmlwlslhddeyasgingdkrrsrdinikvdqdeqeygkvdnkggvrnserphksrkrsfee....................................................................................................................................
A0A3P8XEY3_ESOLU/140-346              .........................PRKGQKL.LGVV..NKLSMNHAGCLVHGCFNAS..I.P.KpA.H.........................V..TV......................E.-TWRDagprigaelefevcqldadtvgvilirgrlrrtrvqelma..........................................aveisdpsdpaetleepypevepsqdlpdasgkvkkkkkkkD-------..---..----.-..-....--.--..--.-..-...--..--.-..---Khcveeaaipptdhevg.........................tvngivedsstnghikkKKKEKRQKEDELECTSSGV----...---..-----..---...................---------------vqgsdssgylsdkqsrkrkhgdkitssc............................................................................................................................................................................................
A0A4U0USQ0_9PEZI/287-386              .........................PTKDSWL.EGYV..NLQNESLLGLVCYNYFNAA..I.E.R.Q.R.........................L..PK......................D.WRWVD...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.D..ASRG..........................................................NTRVAKGGQGYWVDDSGGRVDGK..vVFR..VKDFD..AAA..................gGDSGAGSINILGTLL........................................................................................................................................................................................................................
A0A091HGR2_BUCRH/43-249               .........................PKKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................V.VQWQElglkigdelkfrvlhldsdaagvffirggltkssmqprqsetitdstngd......................eiqkldhqenglndsggdnvteeplcemdnngremaeersadavdglcddkN-------..---..----.-..-....--.-K..KK.K..K...KK..HK.Q..EEQE..........................................................H----------------------...---..-----..---...................---------------vlpasdssgyqsdhkkskkkkrkhcdeveeselsqqsqklakkkrd..........................................................................................................................................................................
A0A1V8SS70_9PEZI/311-416              .........................PRKNTVL.EGFV..NLQNESMLGLICYNYFNAG..V.E.R.S.R.........................L..PK......................D.WRWVE...........................................................................................................................--------..---..----.-..-....--.--..--.D..E...SA..AD.D..AGAM..........................................................ARRGRRSAAGYYVDGKGKKVEGR..vVFS..VKDFE..ASP..................gAETGGGTINIYGTA-l.......................................................................................................................................................................................................................
W9WBR2_9EURO/243-380                  .........................PENGDEL.YGWT..NVTSEGFVGLVSYNYFQTA..V.G.K.T.R.........................I..PE......................G.WKWNGpsrn...................................................................................................................eaqrRKKGRKGR.lRGE..EGGD.G..P....QE.QD..TQ.E..T...EV..TF.V..EKSS..........................................................SQISLDEEGGHFADADGAKIKST..lKFR..VVDTE..AVP..................aHDRNKWSLQIHGTLL........................................................................................................................................................................................................................
A0A139HCY3_9PEZI/139-212              .........................PSPGTYL.EGEV..NLQNEALLGLICLNYFNVS..I.P.K.E.N.........................M..PS......................D.WTWNG...........................................................................................................................QTWSD---..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------gqgkldqkiicqvhdfeasgqesis...............................................................................................................................................................................................
A0A2I3HSQ3_NOMLE/124-329              .........................PEPGQKL.MGVV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWQTmeinmgdelefevfrldsdaagvfcirg..................................................................klnitslqfkcsevseevtengteeaakkPSKKKKKK..DPE..TYEV.D..S....GT.TK..LA.D..D...AD..DT.P..MEES..........................................................ALQNTNNVNGIWEEEPKKKKKKK...---..-----..---...................---------------khqevqdqdpvfqgsdssgyqsdhkkkkkkrkhseeaeftpplkcspk........................................................................................................................................................................
A0A397U473_9GLOM/94-182               ........................s--KGCRL.TGKV..IRQSPTHIALLLYESFNVK..I.F.R.D.C.........................I..PD......................D.-VFKW...........................................................................................................................--------..---..----.-..-....--.KD..NE.E..F...FN..AM.I..SDKQ..........................................................LELDKLYQDGEWINERTGESLTD...--K..CIAFE..V--...................---------------lg......................................................................................................................................................................................................................
A0A067CHZ3_SAPPC/81-128               .........................PTPGMQL.SAVV..NKVGSNHIGLLLAGVFNVS..I.D.S.T.E.........................M..PD......................G.YVHNF...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------qeea....................................................................................................................................................................................................................
A0A317SQ09_9PEZI/67-170               .........................PVKGMLL.KGWV..NMAGASHVGLLVENTWNVA..I.P.R.E.R.........................I..PE......................G.WRWVE...........................................................................................................................--------..---..----.-..-....--.EV..GM.E..V...DG..DA.A..AVGE..........................................................GEEGTGVDGGYWVDGDGKKIEAF...---..-RKFK..VEA...................VKAMGHMVSMEGSLL........................................................................................................................................................................................................................
A0A6I9Z6U5_9SAUR/132-319              .........................PKPGKKL.VGII..NKVAPSHIGCLVHECFNAS..I.P.KpD.H.........................I..SI......................E.-EWKNfgfqigirlvfkvlhfdsdaagvfcirgklcknslgeem.............................................lkekckkkyekhcdvhigseemevdissvgiedremhncD-------..---..--DE.D..D....HG.IF..DK.P..E...TE..NG.Q..DGAE..........................................................VGMHASDSSGYH-----------...---..-----..---...................---------------sdhgkskkkkrklfeeenghsallkskakkkr........................................................................................................................................................................................
A0A6G1CN81_9ORYZ/81-139               .........................PKPDMMM.EGKV..EMLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..HE......................K.FKFKR...........................................................................................................................--KKDGGK.fVS-..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------rsdkqh..................................................................................................................................................................................................................
R0I8T2_SETT2/119-223                  .........................PVRNAYL.DAHV..TDQAKTHITLAHLNTFPVS..I.L.K.E.H.........................I..PA......................D.WSWHQ...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...NE..TG.K..VKKG..........................................................WDESLSDEGGWWVNGDGEKVEGElrvRIR..DVDGR..MDG...................RGKGKGFLRVDGSLL........................................................................................................................................................................................................................
F9X8A0_ZYMTI/128-193                  .........................PERGSLL.DGFV..NLQSESMLGLLCYNYFNVA..I.A.R.E.G.........................L..PE......................G.WNWDG...........................................................................................................................ESWND---..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------aegnpvgegrkvkckve.......................................................................................................................................................................................................
A0A165I386_XYLHT/174-280              .........................PKRGDWI.EGWV..NLQHEGHLGLVCWNLFNAS..I.E.R.K.R.........................L..PK......................S.WQWVG...........................................................................................................................--------..---..----.-..-....--.--..-P.S..T...SR..SN.S..RADD..........................................................QADAAAEGEGYYVDEDGNKVEGK..iKFR..VKDIE..TSA..................sSSHERGFLSIEGTML........................................................................................................................................................................................................................
W4K537_HETIT/93-213                   .........................PELGMKL.SGKI..NLCSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..QT......................D.-EWEF...........................................................................................................................------EH.gPAE..NDPE.F..G....IG.VE..AV.D..A...QD..GE.D..PGDA..........................................................RPSEDVERGGRWIHKVTGDRLGG...EEG..RLEFT..VVG...................LTIANQMLSVLGSI-q.......................................................................................................................................................................................................................
A0A2V5GYZ5_ASPV1/185-368              .........................PQRGQLL.EGWV..NVQSEGFLGAIALNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWIPpgdehedettt.....................................................................................................ttttttttttaK-----ST.pNDE..TNPS.T..T....--.--..--.-..-...--..--.-..---Tasddsdsdssesetkpkfdpelehfs.....pvtlasdanplnpsnsnpdisthdptpKDDDDDGVEGYFQSVSGHRVRGT..iKFR..VVDID..VIP..................gSERDRGFISIEGTML........................................................................................................................................................................................................................
A0A0U1M856_TALIS/181-341              .........................PQKGHIL.EGWV..NVQSEGFLGAVAYNLFSVG..I.E.R.K.R.........................L..PA......................D.WKWVP...........................................................................................................................PHTDEDEE.ySAA..QTTR.T..K....GV.AS..AP.T..S...GD..ED.E..SSKSssdfdprkehftplp...........................kpvtnpiemeeaaqdgQGEDELDATGYFESVSGHPVRGT..iRFR..VRDID..VIP..................gADPDRGFISIEGTML........................................................................................................................................................................................................................
A0A672YBN7_9TELE/143-384              .........................PKQGDKL.RGKV..NKLGVSHVGCLVHGYFNAS..I.P.K.P.H.........................L..VT......................M.ETWRDagprvgselefevtaidtdavgvllirgkldrtrvqellamaestessvaaeesdqpd......aglapeptpepaqecpdntpkkkkkkkkdkikeeereeaitappsyqqdgnttaelmgnMKEENGND..AVE..KKKK.K..K....KK.EK..QL.K..E...EE..EE.V..ELSC..........................................................MEVHGSDSSGYHSNKPSKKRKH-...---..-----..---...................---------------epditssfseeppkskkkkkrksev...............................................................................................................................................................................................
A0A0D3GDA2_9ORYZ/81-229               .........................PKPDMML.EGKV..EMLGKESIHAIVLGVFSAA..I.M.L.D.D.........................I..HE......................K.FKFKRkkyggkfvsrsdkqhvikkgsmirfsvkrvdae.........................................................mnchvtgslipphtgsmfwlsvhddeyaleinsG-------..---..KRSR.D..N....KI.KT..EQ.H..E...QD..HS.V..KSSG..........................................................RKHKSKSR---------------...---..-----..---...................---------------krsfeer.................................................................................................................................................................................................................
E3QKU1_COLGM/290-412                  .........................PRRGAWM.EGSI..NLESEGHIGVVCWGKFNAS..I.E.S.S.R.........................L..PP......................E.WRWVH...........................................................................................................................----AGSA..EAA..SYVA.D..P....FD.GD..DA.A..A...AE..AE.A..EDEH..........................................................GAVRQIHTTGFWVDGNGDKVKGR..vRFR..VKAFD..V-G...................VSGDHGYLSLEGTML........................................................................................................................................................................................................................
A0A4T0VLT4_9PEZI/289-412              .........................PRRGAWM.EGSI..NLENEGHIGVVCWGKFNAS..I.E.S.A.R.........................L..PP......................E.WRWVH...........................................................................................................................----AGSA.eAAS..YVAD.P..F....DN.DD..DD.N..A...SA..RA.A..EDEH..........................................................GAVRQIHTTGFWVDGAGDKVKGR..vRFR..IKAFD..V-G...................VSGDHGYLSLEGTML........................................................................................................................................................................................................................
A0A0D1Z6R4_9EURO/240-377              .........................PERGDEL.LGWT..NVTSEGFVGLVSYNYFQTA..V.D.K.S.R.........................I..PA......................E.WKWIGpsrv...................................................................................................................qsspNKKKGKKG.rLRD..DGGA.P..P....AA.DD..AT.R..E...DG..DA.E..IETN..........................................................SQTHLGDDSGHFADATGFKIPST..lKLR..VVDTE..VVP..................aHERNKWSLQIDGTLL........................................................................................................................................................................................................................
A0A0F8B522_CERFI/275-387              .........................PSVGAWM.KGEV..VLQTEGHIGVVCWGRFNAS..I.E.A.S.R.........................L..PR......................T.WRWVA...........................................................................................................................--------..---..---A.E..E....AE.LE..DD.S..M...EL..DN.G..TSEG..........................................................AAALTPQTTGYWADENGTPVDGK..vVFR..IKRFD..V-G...................VRDDHSFISIEGSML........................................................................................................................................................................................................................
A0A3M6W1Z8_HORWE/298-403              .........................PQKGTYL.EGYV..NLQNESLLGLVCYNYFNAG..I.E.W.N.R.........................L..PK......................D.WQWVS...........................................................................................................................--------..---..----.-..-....--.--..--.D..E...EG..AL.T..GKGK..........................................................GKKATQEGEGHWVDAEGKKVDGR..lIFR..VKDFE..ATS..................gSEGGAGSINIVGTLL........................................................................................................................................................................................................................
A0A287R988_HORVV/81-233               .........................PQPEMIL.EGKV..EMLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..PE......................T.FKFKRrghggkfisqldkqhvikkgsmirfsvkrvdte.........................................................mnchitgslmpphtgcmrwlsvhdaeyaseissG-------..---..--KR.K..S....RD.HT..KT.E..H...NV..QG.R..ATVN..........................................................-----------------------...---..-----..---...................---------------sedsvvnserprkskkrsvee...................................................................................................................................................................................................
K1X568_MARBU/168-271                  .........................PETGAWL.EGYV..NLQNEGHLGLVCWNLFNAS..I.E.R.K.R.........................L..PS......................D.WEWRY...........................................................................................................................--------..---..----.-..-....--.--..--.V..S...DA..RE.G..LEGQ..........................................................EETYAEEDAGYFVDGEGKKIEGL..vKFR..VRE-T..ESS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
W5N055_LEPOC/137-318                  .........................PKKGQKL.VGVI..NKVGVNHVGCLVHGCFNAS..I.P.K.P.A.........................L.mPL......................E.-SWQGlglsvgdslefevfqldadvagvllirg...................................................................slgknkvhsllgapqgeaaaeedivdgeR-------..---..----.-..-....DA.EE..VK.V..K...KK..KK.K..DRRK..........................................................GEEAAEAVNGHDSESSGRKRRRK...---..-----..---...................---------------hreeraadeepeqacpreergdgdgrarrrreksggdemtd...............................................................................................................................................................................
A0A0L0HRX8_SPIPD/108-168              .........................PSLKANL.VGVV..NKVSPDHIGLLVHGVFNAS..I.P.A.D.Q.........................I.rRK......................E.FKWDEn.........................................................................................................................aA-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------gwrrsrgadgeem...........................................................................................................................................................................................................
A0A1V6Q1R0_9EURO/149-288              .........................PKRGQIL.DGWV..NVQSEGFLGAVVFNLFSVG..V.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEAETP.aTTD..EESG.S..D....QK.IA..GF.D..A...EK..EF.F..QPASlaaee................................................vpldgEDEEESAHSGYFQSVSGHRVRGS..vRFR..VVDVD..VIP..................gSERDRGFLSIEGTML........................................................................................................................................................................................................................
A0A0L0SVD6_ALLM3/79-196               .........................PTAGARL.TGVI..NKQSPSHIGLLVYNLFNAS..I.P.A.A.Q.........................L..PD......................GaFTFQF...........................................................................................................................--------..--D..DSAA.Y..A....PTgED..EA.E..G...DD..GS.A..PRFN..........................................................KGGKKAMINGNWIHSASGSVLEP...-GH..ALDFI..ATE...................VVKSHDFISMKGTL-v.......................................................................................................................................................................................................................
M5E5S5_MALS4/98-199                   .........................PEIGMAL.QGTM..SLSLPSHVSLLLYDTFNAA..I.S.A.A.H.........................L..PA......................S.-EWEF...........................................................................................................................--------..---..----.-..-....--.--..--.-..V...HY..SD.A..GESH..........................................................RRSLTDRSIGFWRHKVTRERLGG...DDG..RLTFS..VIS...................MTVAHQMLSLHGSLL........................................................................................................................................................................................................................
A0A388KAA3_CHABU/51-108               .........................PAEGQVL.EGKV..NNIGHDHIGVLVLDHFKAS..I.G.F.G.C.........................I..RQ......................D.LRYDE...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------dtnswisiddeehc..........................................................................................................................................................................................................
A0A6H0XTC2_9PEZI/188-292              .........................PVIGTVL.EGFV..NLQNQSILGLLCYNYFNAG..I.E.Q.S.R.........................L..PG......................D.WRWVE...........................................................................................................................--------..---..----.-..-....--.--..--.-..K...EE..LE.D..DTDA..........................................................QGEQIPQSSGHYVDASGEVVEGK..vLFK..VKDFE..ASA..................gMDGGTSSINIFGTLL........................................................................................................................................................................................................................
E3JQ84_PUCGT/168-285                  .........................PTIGQKL.VGRP..TLSSPSHLSLVIYRTFNAS..I.N.E.N.H.........................L..RA......................A.-GFHY...........................................................................................................................-------D..INF..EVPA.H..W....KS.IV..EP.A..N...PQ..DQ.S..LSTN..........................................................LPLEHHQDRGCWVDANGAVVGDD...-QG..TVSFT..VMG...................LTIANHMISVVGSLL........................................................................................................................................................................................................................
A0A1U7UGS7_CARSF/125-338              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWQTleinlgdelefevfrldsdaagvfcirgklnitslkfkcpevpaettdtcaeeav.............ekppkkkkkkkkdpeicevddgatkladftddtpkkesdlqntnnvsglwedepkKKKKKKKK.kHQE..DQDQ.D..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------pvfqgsdssgyqsdhkkkkkkrkhneeaefspilecspkkkte.............................................................................................................................................................................
A0A1Y2AJY2_9FUNG/84-142               .........................PKKNLEI.VGKV..NKVSADHIGLLLYGVVNAS..I.P.S.D.K.........................I.rKK......................N.FKWDE...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------nsfawketfgdrrk..........................................................................................................................................................................................................
I3N9D6_ICTTR/152-363                  .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.K.P.E........................qM..SV......................E.-QWQTleinvgdelefevfrldsdaagvfcirgkiniaclqskhpdvseevtetltees...............vekipkkkkkkkkdpeiyevndgatepadftgitpkeeeelqvsndmnglceeeP-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------kkkkkkkkkkhqedqdpifqcsdssgyqsdhkkkkkkrkhseeaeltavlecspkkkqk.............................................................................................................................................................
C5FTH5_ARTOC/203-348                  .........................PERGQTL.EGWI..NVQSEDFLGAIVFNLFSIG..I.E.R.R.R.........................L..PA......................D.WKWIApgqqpdkp...........................................................................................................stntttttTSPTSSKD.eEDE..DEDE.A..D....SD.KE..NF.K..P...LA..SN.S..EASQ..........................................................FEDAASAETGYFQTRSGKRVRGT..iRFR..VRDVD..VIP..................gSERDKGFLSLEGTML........................................................................................................................................................................................................................
M3B2E7_PSEFD/86-125                   .........................PSPGTYL.EGDV..NLQNEGLLGLICFNYFNVS..I.P.K.E.N.........................M..PS......................D.W----...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------........................................................................................................................................................................................................................
A0A4Z1JFZ2_9HELO/159-265              .........................PEKGAWL.EGYI..NLQNEGHLGLVCWNLFNAS..I.E.R.A.R.........................L..PK......................E.WRWVG...........................................................................................................................--------..---..----.-..-....--.-V..ED.Q..E...KD..AE.A..EAEE..........................................................GATYAEDGIGYYVDGEGKKIEGT...VKF..RVKEI..ESN...................HDKERGFLTIDGTML........................................................................................................................................................................................................................
A0A6P8IBY8_ACTTE/102-280              .........................PQVDSKL.IGVV..NKFGYDHIGCLVHGCFNAS..I.S.N.P.R.........................T..QN......................G.-HFTDnlklgssftfrvvgle...........................................................................................slngvllitgafddktLRKKSKSK..KSL..DRDK.N..S....DP.TT..EG.T..E...IQ..TS.K..KSKK..........................................................HKQENDSETEGPVAKKKKKLSNG...-DA..RRDEE..VSA...................---------------nknnnneknfkiksektsnddhisslkkakkkkknhn...................................................................................................................................................................................
A0A4S4NBC7_9APHY/136-255              .........................PHVGMKL.SGKV..NLCSPDHVSLLVHRTFNVS..I.P.R.R.H.........................I..TT......................DnWEFEY...........................................................................................................................--------..GPA..ENDP.E..F....GA.TA..AE.G..E...QT..AE.G..EEGE..........................................................GAVITIEGSGKWVHKVTGTTLGG...LSG..ELEFT..VIG...................LIIANQMLSLVGSI-q.......................................................................................................................................................................................................................
A0A1B8CK13_9PEZI/165-262              .........................PTRGGWL.EGYV..NLQNEGHLGIVCWNLFNAS..I.E.R.Q.R.........................L..PK......................E.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.A..EDLE..........................................................GEGYAEDGVGYYVDAAGVKIEGI..vKFR..VKDIE..-SS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A2H3GG90_FUSOX/267-380              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................D.WKWVP...........................................................................................................................--------..---..--NE.S..P....EA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWADGNGDKVKGK..iRFR..IRNFD..V-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
A0A367YC14_9ASCO/129-222              .........................PQVGDVL.EGDV..YMQTPSHIGLLINDTFNAS..I.K.K.Y.N.........................I..PS......................S.WTFKS...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.S..QVDE..........................................................VSSDDRKTFGHWIDENETKIEGK...---..-LQFT..VKA...................IYTTGRVVSVEGTL-i.......................................................................................................................................................................................................................
Q0CWU2_ASPTN/191-342                  .........................PRRGHIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................N.WRWVP...........................................................................................................................PGEEADDT..DAD..-KPL.R..T....ED.ED..SE.P..A...AP..--.-..---Fnpdkehftpvslasd............................anplsdmaaadqtagGDDDDAVAEGYFQSVSGHRVRGT..vRFR..VVDID..VIP..................gSERERGFISIEGTML........................................................................................................................................................................................................................
A0A1Y1U9N8_9TREE/71-169               .........................PKPGQRL.TGSH..SLSSPSHISLLFGKTFNVS..I.P.L.Q.H.........................I..PQ......................D.-QYTF...........................................................................................................................--------..---..-VQT.D..E....DD.PL..AD.D..S...DS..EE.E..QVHG..........................................................LTNGIVEEVGRWRSTKTGKILGE...DGK..LVKFT..VIG...................---------------........................................................................................................................................................................................................................
A0A096PAW5_OSTTA/123-167              .........................PVRGSRL.VGTV..NKIAHDFIGALVLDKFNVA..I.A.A.G.D.........................I..RE......................E.-----...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------lvsese..................................................................................................................................................................................................................
A0A4Q4UEY5_9PEZI/309-434              .........................PKRGSWM.EGSL..NLQSEGFIGVICFGMFNAS..I.E.A.S.R.........................L..PS......................G.WKWVD...........................................................................................................................--LLSKKD.gKQQ..NGKS.A..A....EA.KL..PT.P..E...PQ..DK.N..EEED..........................................................GGTDQAHSTGYWVDESGSKVGGK...LRF..RIKNY..EVG...................SVGDYGYLSIEGTML........................................................................................................................................................................................................................
A0A545VLH0_9HYPO/260-373              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................S.WKWVS...........................................................................................................................--------..---..--NE.D..P....EA.EG..ME.E..T...AS..IV.A..PDEH..........................................................GVVHQIHSTGFWVDTNGDKVKGK..iRFR..IRNFD..V-G...................VSGETTYLSLEGTML........................................................................................................................................................................................................................
A0A6I9M8T7_PERMB/122-322              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.K.P.E........................qM..SY......................E.-EWQTleinvgdelefdvfrldsdsagvfc.........................................................................irgklnatslqiksslvsedvaevgI-------..---..----.-..-....-E.EV..AE.K..T...SK..KK.K..KKKK..........................................................KDAEAYAAV--------------...---..-----..---...................---------------ggvtelsdcadvtpkegtdllcgdavndlceeepkkkkkkkkreqedqdpvfqasdssgyqsdhkkkkkkrkhaedidvas.......................................................................................................................................
A0A091I138_CALAN/41-247               .........................PKKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................V.VQWQElglkigdelkfqvlhldsdaagvffirggltkssmkakqse........................................titdstngyesqkldhqenglndlsggdnmaeetlcetdnpgVANAEEEK..VDA..VNGV.S..D....DK.NK..KK.K..K...KK..HK.Q..E---..........................................................-----------------------...---..-----..---...................---------------vqelvlptsdssgyqsdhkkskkkkrkhcevedseltqlsqepkakkkr.......................................................................................................................................................................
C6H3P1_AJECH/239-407                  .........................PERGQPL.EGWI..NVQSDGFLGAVVYNLFSVG..I.E.R.R.R.........................L..PA......................D.WRWVApgqestt.............................................................................................................stseavsPKDRGGSV.gVGV..DDDD.D..D....DD.DD..KS.S..D...FD..SD.K..ENFRplpassaamldh.................................stqyqsnggleppFEAFEDASAGYFQTRSGRRVRGM..vRFR..VRDVD..VIP..................gAEHDKGFISIEGTML........................................................................................................................................................................................................................
A0A091S0T9_9GRUI/78-285               .........................PKKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.KpE.H.........................M..LI......................V.-QWQElglkigdelkfrvlhldsdaagvffirggltkssmkpkpset......................................vtdsangdesqkldsqendlndsggdnvteeplsemdntgrenA-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------eeqsvdavnglcddknmkkrkkkkkhkqeerehalptsdssgyqsdhkkskkkkrkhcdeveeselsqlsqepkakkk..........................................................................................................................................
A0A1Y2GGI4_9FUNG/90-205               .........................PIKGSIL.HGTI..NLQSPDHIGLVLYGTFNAS..I.P.S.E.F.........................I..PK......................D.-KYEF...........................................................................................................................--------..-NP..NSSY.N..H....HI.KQ..QP.Q..G...ED..AN.Q..GEDS..........................................................LASATGLLNGEWVLKSTGESIGH...-DG..VIEFE..VAD...................LVRTNDMLAVTGSL-m.......................................................................................................................................................................................................................
A0A6J1SML4_FRAOC/100-271              .........................PEVGNVL.KGIV..NKISKDHVGVLLYQRFNIS..C.P.R.P.Ss.......................eS..RS......................E.-KWLGnqvsmqqevtfkvkeanf......................................................................................sgtlpflkgkllsvgdivtAKIEEDKK..--P..KKKK.K..E....KT.ED..ES.Y..M...PE..Q-.-..----..........................................................-----------------------...---..-----..---...................---------------sscfvtsvskdrkhklvdlkdsgeskakkakkviqfeedtsksvlecsnavestkelpvikkkk........................................................................................................................................................
A0A0J8R421_COCIT/186-319              .........................PERGQTL.EGWI..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PP......................D.WKWVApg.......................................................................................................................qqPESTPTMT.qDED..DSDT.N..S....DT.EN..FR.P..L...KG..DK.H..IPDE..........................................................HDDEASAAMGYFQTRSGKRVRGM..iKFR..VRDVD..VIP..................gSEWDKGFLSLEGTML........................................................................................................................................................................................................................
A0A5N5MGS4_9PEZI/286-416              .........................PSRGAWM.EGTV..NLQSDGHVGVVCFNKFNAS..I.E.A.K.R.........................L..PS......................G.WRWVD...........................................................................................................................LNENHHNS.sSTK..PQGK.H..T....FL.SA..DP.DtpE...GT..DI.L..DDSP..........................................................LELAELHTTGYWVNEAGEKVSSMp.lRFR..IKNFD..V-G...................VAGDYGYISIEGTTL........................................................................................................................................................................................................................
H2QU84_PANTR/125-332                  .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWQTmeinmgdelefevfrldsdaagvfcirg..................................................................klnitslqfkrsevseevtengteeaakkPKKKKKKK..DPE..TYEV.D..S....GT.TK..LA.D..D...AD..DT.P..MEES..........................................................ALQNTNNVNGIWEEEPKKKKKKK...---..-----..---...................---------------khqevqdqdpvfqgsdssgyqsdhkkkkkkrkhseeaeftpplkcspkrk......................................................................................................................................................................
A0A453KK87_AEGTS/98-248               .........................PQPEMIL.EGKV..EMLGKESIHAIVLGVFSAA..I.M.A.D.D.........................I..PE......................M.FKFKRrghggkfisqsdkrhvikkgsmirfsvkrvd............................................................temnchitgslmpphtgcmrwlsvhdaeyaseI-------..--S..SGKR.K..P....RD.HT..KS.E..Q...KV..QG.R..TTAN..........................................................RED--------------------...---..-----..---...................---------------smvnserprksrkrav........................................................................................................................................................................................................
A0A1L9U4H9_ASPBC/180-356              .........................PQRGQIL.EGWV..NVQSEGFLGAIVLNLFSVG..I.E.R.K.R.........................L..PP......................S.WKWIP...........................................................................................................................PGEELEEQ.eQEE..QQQA.S..T....TS.AT..EK.D..D...ED..DD.D..SDSSnsegkkkaafdpakelfrpiala...........edvnpladtdptststsnnttggyDDDETAAAEGYFQSVSGHRVRGT..iKFR..VVDVD..VIP..................gSERESGFLSIEGTML........................................................................................................................................................................................................................
A0A667Y766_9TELE/141-376              .........................PKRGQKL.LGKV..NKLGVSHVGCLVHGCFNAS..I.P.K.P.N.........................L..VS......................V.ETWRDagpqigaelefevfaidadmagvllirgrldr..........................................................trvqellamgessdcsipaeppqppdtketaepS-------..QES..PEDT.P..K....KK.KK..KK.E..D...KL..KE.E..ETEDtitspsqldsnmtpe............................lnrttdaangdeageNKKKKKKKKEKRVKEEEEEVE--...---..-----..---...................---------------lssmevhgsdssgyqsdkpskkrkheegsdvtsalnseletpkskkkrk.......................................................................................................................................................................
A0A1J7I7F8_9PEZI/291-428              .........................PSRGAWM.EGTV..NLQSEGHIGVVCWNKFNAS..I.E.A.K.R.........................L..PA......................G.WRWVDlneng................................................................................................................dnsnanG--RAKGK.hTFL..SADP.D..T....PD.AD..PE.N..E...GT..DT.L..DDSP..........................................................LELAELHTTGYWVDEAGARVSAKp.lRFR..IKNFD..V-G...................VAGDYGYISIEGTTL........................................................................................................................................................................................................................
A0A060YX96_ONCMY/57-268               .........................PQRGQKL.LGTV..NKLGVSHVGCLVHGCFNAS..V.P.KpA.H.........................V..TM......................E.-TWREagprigaelefevcqldadivgvllirgrlgrtrvqelmaagessdptdpae...................qleepdaepalepnqdwpdatvkpkkkkkkekhreevasvpapgavvvgtaeD-SSTNGH.tETR..KKKR.K..E....KR.QN..EE.D..E...EK..EV.G..GEGP..........................................................VEVQGSDSSGYLSDKPNRKRKQG...---..-----..---...................---------------dditscl.................................................................................................................................................................................................................
H0YWP4_TAEGU/114-338                  .........................PKKGKKL.VGII..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................I.VQWQElglkigdelkfqvlhldsdtagvffirggltkssmrpkrsaavtegtngl......................eiqkldhqengldncgednvteeplkdtgdlgreneeetsvnalnglcddkK-------..---..----.-..-....--.-K..KK.K..K...KD..KD.K..QGEQ..........................................................-----------------------...---..-----..---...................---------------elvlptsdssgyqsghkkskkkkrkhcdeveeselsqlsekpkakkkrtkerethmqsqaspvdr.......................................................................................................................................................
A0A4Z1KN83_9HELO/159-265              .........................PEKGAWL.EGYI..NLQNEGHLGLVCWNLFNAS..I.E.R.A.R.........................L..PK......................E.WRWIG...........................................................................................................................--------..---..----.-..-....--.-I..ED.Q..E...KD..AE.A..EAEE..........................................................GATYAEDGIGYYVDGEGKKIEGT...VKF..RVKEI..ESN...................HDKERGFLTIDGTML........................................................................................................................................................................................................................
I2G594_USTH4/144-243                  .........................PKIGQML.EGTI..ALSSPSHVSLLLYGLFNAS..I.P.A.S.H.........................L..PG......................D.-EWEF...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...-L..LN.G..EQGG..........................................................IDAAQDRGMGYWRNKLDHSRLGA...SDG..KLKFT..VIS...................LTIANHMLSLHGSLL........................................................................................................................................................................................................................
A0A0G2EKC8_9EURO/237-381              .........................PNPGDVL.EGYV..NVASRGHVGLMSYNVFQVS..V.H.P.N.R.........................I..PK......................S.WEWIEpegvsek.............................................................................................................kkpkttkLRDEDSSP.aQSE..DTPA.D..S....DA.DQ..AF.E..T...AP..ED.N..IPAE..........................................................NKAAPIEETGYFIIKPSNEKVLGp.iKYR..VIDID..MVP..................gLSSDKWSLQLHGTLL........................................................................................................................................................................................................................
A0A1S3IWP8_LINUN/110-159              .........................PGKGSVL.KGVI..NKLGRDHIGCIVHRCFNAS..I.L.K.P.R.........................D.aDS......................D.WQ---...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------nnfkvgqe................................................................................................................................................................................................................
A0A0D3HV98_9ORYZ/81-234               .........................PQPDMIL.EGKV..ELLGKESIHAIVLGVFSAA..I.M.A.D.D.........................I..NE......................K.FKFKRkgdggkfisrsdrhhvirkgsmirfsvkrvdtemnch................................................itgsllpphtgsmpwlsthdaeyaseissgtrrpsnvgI-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------kikneqdhktsdnedsvinserphkksrkralee......................................................................................................................................................................................
A0A3M6VJQ8_9STRA/83-129               .........................PQVGMQL.RGIV..NKIGSNHIGMLFAGVFNGS..V.A.E.A.E.........................L..PK......................G.FVHN-...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------yaqd....................................................................................................................................................................................................................
A0A2S5B0W9_9BASI/166-319              .........................PRVGMKL.TGTL..TLASASHVSLLLHNLFNAS..I.P.V.S.H.........................I..PT......................D.-TWEWdpeypvpsvvler................................................................................................rnaalplkqvmsevVQKANDAA.qEAA..EAEE.G..D....EE.AK..QE.A..D...AE..AK.A..EEEE..........................................................AEEEYLAERGWWVHRKSREPLGG...QDG..RLDFT..LVG...................LTTSNSLLSCTGSLL........................................................................................................................................................................................................................
W9XTP1_9EURO/255-400                  .........................PERGDEL.YGWT..NVTSEGFVGLVSYNYFQTA..V.A.K.N.R.........................I..PQ......................D.WTWTGpsredtvkn.........................................................................................................krkgkkarlR-DED-GA..SSQ..IHGD.D..N....EH.DH..AA.A..A...RQ..ED.D..HGAV..........................................................SQARIVDDGGFFVDANDGSKVQSt.qKFR..VVDAE..IVP..................gHDRHKWSLQIEGTLL........................................................................................................................................................................................................................
A0A3Q1GIT1_9TELE/141-360              .........................PKKGQKL.LGKV..NKLGVSHVGCLVHGCFNAS..I.P.K.P.N.........................L..VS......................V.ETWRDagprigaelefevtaldadtagvllirgrmdrtrvqellamgessestvpee..................qtepqdteptpeptqdspdgtpkkkkkkkkvkedemeeeianvssgqqdssttA-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------alngttdeangdeagekkkkkkkkekrlkeeeeamelsrvevhgsdssgyisdkpskkrkhetanedtsg..................................................................................................................................................
A0A2R6NLF8_9APHY/136-253              .........................PHIGMKL.VGKV..NLCSPDHVSLLVHRTFNVS..I.P.R.H.H.........................I..PA......................D.-QWEF...........................................................................................................................--------..EYG..PAEN.D..P....EF.GM..DA.D..V...EV..EG.A..EEDT..........................................................TATQETEDSGRWVHKLTGAKLGG...ADG..HLELT..VVG...................LTIANQMLSLIGSI-q.......................................................................................................................................................................................................................
A0A2K0WV38_GIBNY/283-396              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................D.WKWVP...........................................................................................................................--------..---..--NE.S..P....EA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWADGNGEKVKGK..iRFR..IRNFD..V-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
A0A4W3HBX3_CALMI/110-269              .........................PEKGQKL.VGVV..NKVAPSHLGCVVHGCFNAS..I.P.K.P.Y.........................H..EN......................G.-TWPGfevkvgnnlqfevvhldadv...................................................................................vgvlcirgkldpnsvqaeynVESEKTLE.nNSN..ETPL.E..N....GN.NH..TA.D..Q...TP..GK.K..KKKK..........................................................KKKHKRKNDEEFSTQDTPEEASE...TVE..LMD--..---...................---------------lslledgvhktng...........................................................................................................................................................................................................
A0A0L0D2E7_THETB/79-132               .........................PVVGQRL.TGTV..NKVSSDHIGLLAYGVFNAA..I.P.A.S.A.........................I.aLD......................E.WYYDA...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------dddawavrg...............................................................................................................................................................................................................
R1EJW2_BOTPV/161-272                  .........................PRKGMWV.DGNV..NLQTESHLGLVCWNLFSAS..I.D.R.R.R.........................L..PD......................D.WTWVE...........................................................................................................................--------..---..----.-..A....-G.DA..AA.A..E...TE..DD.A..ELED..........................................................AAVAATTAQGHFVDAQGKRVGGV..iSFR..IRDFE..TSP..................rTQSDRGFITIEGSLL........................................................................................................................................................................................................................
G4ZTJ4_PHYSP/83-154                   .........................PKEGMQL.RGVV..NKIGSNHVGMLFAGVFNGS..V.A.E.A.E.........................L..PK......................G.YVHNYaqd.....................................................................................................................cwlG-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------edgssisvedevdvkvlatvs...................................................................................................................................................................................................
A0A437A6G1_9PEZI/160-283              .........................PTVGMVL.EGYV..NNVSPSHLGMLYGNVFSVS..V.T.Q.A.G.........................I..PK......................D.WKFVV...........................................................................................................................AKEDDASV.tGEV..EDEA.Y..T....SD.GR..KR.R..E...KQ..KP.V..GGTD..........................................................PIEGLTKAMGRWFDSEGNEVEGL...---..-RKFV..VTA...................VKAEGSMLSLEGSF-k.......................................................................................................................................................................................................................
A0A4Z1PFA6_9PEZI/198-310              ........................r--KGITM.EANV..NLQNESHIGLILWNVFSVT..I.E.K.K.R.........................L..PS......................G.WKWIE...........................................................................................................................--------..---..----.-..T....TD.GD..TE.M..I...NG..NA.D..EDDQ..........................................................PMKRPSEVWGHWENEKGEIVEGM..lRFT..VKDFD..VTLp.................nKDGEQSSLMVEGSLL........................................................................................................................................................................................................................
A0A5C3KPW2_9AGAR/121-233              .........................PRIGMKM.KGRI..ILSSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..PS......................S.-VWEF...........................................................................................................................--------..---..--EY.G..P....AE.ND..PE.F..G...PE..SE.E..EGEG..........................................................SAGSEEASTGKWVHHSSRERLGS...PNG..NVEFT..VVG...................LTVANEMLSLVGSI-q.......................................................................................................................................................................................................................
A0A3D8QHV0_9EURO/190-355              .........................PQRGQTL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PP......................S.WKWIPpgekdynengtapnp.............................................................................................nsdededgtsstpfdP-------..---..----.-..-....--.--..--.-..-...--..--.-..---Ekehfnpvplasdsnpfsfd...................qeqnpeadigadqtengegaVGTDEDSLEGHFQSVSGHRVRGT..vKFR..VVDID..VIP..................gTERDRGFLSIEGTML........................................................................................................................................................................................................................
M2LWW5_BAUPA/299-400                  .........................PSRDAYL.EGCV..NLQNESLLGLICYNYFNAG..I.D.R.S.R.........................L..PT......................D.WSWKD...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..ND.D..VEGV..........................................................AKWGRQPTNGHWVDGDGVKVEGR..lAFR..VRDFE..AVG..................gSELGAGSVNILGTLL........................................................................................................................................................................................................................
A0A2L2TT20_9HYPO/267-380              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................D.WKWVP...........................................................................................................................--------..---..--NE.S..P....EA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWADGSGDKVKGK..iRFR..IRNFD..V-G...................TSGEISYLSLEGTML........................................................................................................................................................................................................................
A0A1E4TB45_9ASCO/98-149               .........................PKVGQVM.AGWV..NLQSPSHIGLLVCNVFNAS..I.K.L.D.G.........................I..PS......................N.WKFKP...........................................................................................................................GQADDE--..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------se......................................................................................................................................................................................................................
A0A034WA80_BACDO/105-332              .........................PIAGAIL.SGVV..KHIGNHHIGVIIYRVFNVS..I.RfA.A.K.........................L..NK......................E.-EFKMddtvqfriknfnlqnvfpyiegdlvtasgdkit.........................................................hkfikvepdsadsnidsgvesrdnheldelvnlIKEEKESE.eECT..PTKA.N..K....KK.DK..AN.S..S...KR..KR.K..TSESaviittptpikke................................pssekkkrkhadsV----------------------...---..-----..---...................---------------eqentktdkvtvksktkkingellnatqikkeelddsfttptkkrrksktnsisld................................................................................................................................................................
A0A316TZ72_9BASI/188-295              .........................PKVGMKV.EGTI..TLSTPSHVSLLVYATFNAS..I.S.S.D.H.........................M..TD......................-.YEFIE...........................................................................................................................--------..---..----.-..-....--.SS..SP.R..P...GE..AG.Q..TESE..........................................................AGAGEEEEYGYWRHKVTRERLGA..sTGG..RVQFA..IVS...................LTISPPSLSLSGSLL........................................................................................................................................................................................................................
A0A3N4L754_9PEZI/163-262              .........................PKKGDVL.QGWV..NLQSASHVGLLVENTWNVS..I.P.K.E.K.........................I..PE......................S.WSYHE...........................................................................................................................--------..---..----.-..-....--.--..--.L..E...EG..ME.G..MEGV..........................................................EYGNAEIDAGGWMDANGEYVDGL...---..-LKFQ..VES...................VQAIGHIFSMEGSLL........................................................................................................................................................................................................................
A0A1L9SM25_9EURO/181-336              .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PP......................T.WQWVPp.........................................................................................................................gEETGTDSD.aVPS..TKPG.S..D....DD.DD..SD.G..L...VS..FN.P..DKEHfkpvplasnenp..................................lsdtlnlvpsssLENPDAGATGYFQSVSGHQVRGT..iRFR..VVDVD..VIP..................gSERDRGFLSIEGTML........................................................................................................................................................................................................................
A0A2X0P533_9BASI/186-342              .........................PRVGQKI.VGSP..TLSTPSHVSLLLHNLFNAT..L.P.A.S.H.........................I..PS......................D.-EWRFdpdyvvpafirerqk.............................................................................................mafpttsatktaneeAEEAERTE.eGIE..ADAE.G..G....EE.KE..EE.L..A...QE..EE.A..RLAM..........................................................EEDEMYADRGWWVNVRTGEPMGG...EKG..SVEFT..IVS...................LTIANSMITVTGSLL........................................................................................................................................................................................................................
A0A3R7H9S3_9STRA/83-280               .........................PKEGMKL.RGIV..NKIGSNHVGMLFAGVFNGS..V.A.E.S.E.........................L..PK......................G.YVHNYaqdcwlgadgssisvndevevrvlrvhvaggmiaveatmrslaapt...............................aspakkskkttlnlsadvtepkktkakkekkaatldlsaevsepkkT-------..---..----.-..-....--.--..-K.E..K...KK..SK.D..ESKK..........................................................RKHKKVEEEEQAVVEEETEV---...---..-----..---...................---------------eeeamvkpkkskhkdkdakkkkhkkskhe...........................................................................................................................................................................................
A0A2S7P9X8_9HELO/160-264              .........................PEKGAWL.EGYI..NLQNEGHLGLVCWNLFNAS..I.E.R.A.R.........................L..PK......................D.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..-V.A..E...QV..KD.A..EAGQ..........................................................GESYAEDGIGYYVDGEGKKVEGT...VKF..RVKEI..ESN...................HDKERGFLTVDGTML........................................................................................................................................................................................................................
A0A1B9GYT0_9TREE/129-243              .........................PKIGQKL.YGTH..SLSSPSHLSLLFSKTFNIS..I.P.L.Q.H.........................I..PT......................D.-LYEF...........................................................................................................................--------..---..EHTD.E..A....QD.DS..DS.E..D...ED..HD.D..DGDA..........................................................FGVSAVEDVGRWKEKATGKSLGE...GGK..GIKFT..VIG...................VQVTNQMLSLTGSLL........................................................................................................................................................................................................................
A0A137PJ21_CONC2/46-98                .........................PVIGSTL.EGTV..SLQSSDHLGLLVFNTFNVS..I.P.A.S.N.........................I..PK......................N.-KYKW...........................................................................................................................KRN-----..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------sedafts.................................................................................................................................................................................................................
A0A074SI40_9AGAM/144-249              .........................PEVGMRI.TGRI..SLHATDHIGLLIHRTFNAS..I.D.R.A.H.........................I..PG......................D.GEWEY...........................................................................................................................--------..---..----.-..-....--.--..VH.G..P...VA..ND.P..EINS..........................................................EERQEDEESGRWINSQTGETLGG...ESG..LVEFT..VIG...................YTIANQMLSLHGSLQ........................................................................................................................................................................................................................
A0A4Y7TTR1_9AGAR/124-246              .........................PRTGMKL.QGRI..NLSSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..PS......................D.-VWEF...........................................................................................................................---EYGPA..END..PQFG.G..N....HE.EE..AE.G..G...DG..SE.E..NPEG..........................................................TSEETDSGSGRWVNRSTGECLGG...SSA..VVEFT..VIG...................LTVANEMLSLLGSI-q.......................................................................................................................................................................................................................
A0A482WPE2_LAOST/99-211               .........................PEVGSVL.TGVV..NQKSEDHVGCLVHRVFNVT..I.P.K.P.A.........................-..--......................-.-----...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------ggeeeavwkatavgqdvrfevvafdmtlkipsihgkildsstpqhsnaldldhrsrealgnestagdgrmdsdsdglg..........................................................................................................................................
A0A0B7MR30_9FUNG/126-243              .........................PKRGTKL.VGRI..NLQSEDHIGLLIYGTFNAS..I.P.K.S.R.........................I..PA......................S.-AFEW...........................................................................................................................-------K..VNE..EEAV.T..E....AV.QE..VN.E..N...ED..QG.I..TETV..........................................................AEERTRTQYGEWINKATGSSIGG...EDG..TLEFN..VMD...................IIEANDILTVTGSL-........................................................................................................................................................................................................................
A0A150UV75_9PEZI/265-364              .........................PSKGTWL.EGYI..NLQNESLLGLVCYNYFNAG..I.D.R.S.R.........................L..PA......................D.WRWVA...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.N..GMNG..........................................................IEKNVAQGEGYWLNGDGEKVEGR..iVFR..VLDFE..AMH..................gSEAVGGSINIIGTLL........................................................................................................................................................................................................................
A0A3Q3GFX4_9LABR/141-372              .........................PTKGQQL.VGKV..NKLGVSHVGCLVHGCFNAS..I.P.K.P.N.........................L..VA......................V.ETWRDagprigaelefevtaldadifgvllirgrldrtrvqellalgessesngttdy................sepaetsqepteespvdghkktkkrkkvekeqtgeeiqslptilesnttqelnrT-MDEANG.nEAG..EKKK.N..K....KK.KE..KH.V..K...EE..EE.E..IELS..........................................................QVQGGSDSSGYLTDKPKKKRKHE...---..-----..---...................---------------tssdvasslsdnveppkskkkrks................................................................................................................................................................................................
A0A2K5VT47_MACFA/125-291              .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWLTmeinmgdelefevfrldsdaagvfcirg..................................................................klnitslrfkrsevseevtengteeaakkPKKKKKKK..DPE..TYEV.D..S....GT.TK..LA.D..D...AD..DT.P..MEES..........................................................ALQNTNNVNGLWEEEPKKKKRKK...---..-----..---...................---------------khqevqdqd...............................................................................................................................................................................................................
A0A4U0UD39_9PEZI/286-385              .........................PTNSTWL.EGYV..NLQNESLLGLVCYNYFNAA..I.E.R.Q.R.........................L..PK......................D.WRWVD...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.D..ASRG..........................................................TARVAKGAHGYWVDGDGQRVDRR..vVFR..VNDFD..AVA..................gGDSGAGSINILGTLL........................................................................................................................................................................................................................
A0A7E6CHL5_9CHIR/125-335              .........................PEPGQKL.LGAV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.H.........................M..PA......................E.-QWQGleinvgdelefevfrldsdaagvfcirgklnitslqakcsavseevteagpeev...............fekplkkkkkkkkdpepdegaggttepadfagvpmteetdpqvnssvnglwdgeP-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................----------------GKKKKEQ...---..-----..---...................---------------hqedqdqdpvfpasdssgyqsdhkkkkkkrkhseeaeftpllehsprkkrk.....................................................................................................................................................................
A0A433DGX9_9FUNG/189-302              ......................cip-------.VGTI..NLQSADHIGLLLYGTFNAS..I.P.R.E.F.........................I..PT.....................aH.YEWRP...........................................................................................................................--------..--S..SFPG.T..P....AE.EP..AA.P..N...AE..GA.E..GEDQ..........................................................GFNKQRTQNGEWVIKKTGESVGA...TDG..VVIFT..VVD...................LVQANDMLTVTGALL........................................................................................................................................................................................................................
C1MWR4_MICPC/117-332                  .........................PVVGSVL.RGVV..NKVGVDFIGLLVLGVFNVS..V.G.A.D.D.........................I..RD......................G.LVHNPapiddecpggrweetspspidrehvirvgstvlftvksvsefdd..................................vlhligsltdeartgeigyvesvggggagggskknglsssvkkgkKEKKEKKE.kKEK..KEKR.D..S....AK.KE..KK.E..K...RD..KG.E..KTPK..........................................................SAERKESR---------------...---..-----..---...................---------------eksakkaskkrerreedddgdgdgdipkasgkkrkkatkp................................................................................................................................................................................
A0A091V7C3_NIPNI/41-248               .........................PKRGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................I.VQWQElgfkigdelkfqvlhldsdaagvffirggltkssmqskqsetvtdstng........................veiqkldnqengfndsggdnvteeplgetdnagrenaeeqsvdavngvcdD-------..---..----.-..-....-K.NK..KK.K..K...KK..KH.K..QEGQ..........................................................-----------------------...---..-----..---...................---------------ehvlptsdssgyqsdhkkskkkkrkhcdefkeselsqlsqepkakkkr........................................................................................................................................................................
F2SUG1_TRIRC/199-341                  .........................PERGQTL.EGWI..NVQSEDFLGAIVFNLFSIG..I.E.R.R.R.........................L..PA......................D.WKWIApgqqsdr.............................................................................................................psttsasPTSSSKDE..EDE..DDDE.P..D....SD.KE..--.-..-...--..--.-..---Nfkplas..............................................nseasqFEDAASAETGYFQTRSGKRVRGT..iRFR..VRDVD..VIP..................gSERDKGFLSLEGTML........................................................................................................................................................................................................................
A0A084QVM3_STAC4/272-385              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PS......................N.WKWIP...........................................................................................................................--------..---..--NE.A..P....EA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWSDERGDRVKGK..iRFR..IRNYD..V-G...................TSGDTSYLSLEGTML........................................................................................................................................................................................................................
E2LDG9_MONPE/14-120                   .........................PRVGMKL.EGKI..NLCSPDHISLLVHKTFNVS..I.P.R.H.H.........................I..PT......................D.-SYVF...........................................................................................................................--------..--E..YGPA.E..N....DP.EY..GA.G..A...QD..DE.G..DAGK..........................................................TDEGGGGGGGRWIHHLTSSTLGA...PDG..TLEFT..VIG...................RERD-----------ay......................................................................................................................................................................................................................
A0A0E0PU12_ORYRU/81-229               .........................PKPDMML.EGKV..EMLGKESIHAIVLGVFSAA..I.M.L.D.D.........................I..HE......................K.FKFKRkkyggkfvsrsdkqhvikkgsmirfsvkrvdae.........................................................mnchvtgslipphtgsmlwlsvhddeyaleinsG-------..---..KRSR.D..N....KI.KT..EQ.H..E...QD..HS.V..KSSG..........................................................RKHKSKSR---------------...---..-----..---...................---------------krsfeer.................................................................................................................................................................................................................
A0A163K1X3_ABSGL/132-256              .........................PKKGSKL.VGRI..NLQSQDHIGLLIYGTFNAS..I.H.K.S.R.........................I..PS......................D.-RFEW...........................................................................................................................--------..RSS..ESSD.K..P....DD.ND..AN.E..N...EN..ED.E..EQTN..........................................................EEEWARSQQGEWVFKESGASVGG...DDG..SLEFN..VLE..................nI--------------aqangdevihniddflteqg....................................................................................................................................................................................................
A0A5N6Z2J3_9EURO/188-339              .........................PQRGQIL.EGWV..NVQSEGFLGAVALNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGDEGSVN.gDKL..KNAA.S..A....TA.SD..DD.E..S...EP..SA.S..FNPEkehfnpvslan....................................pisdtlneeanAEDDESATEGYFQSVSGHRVRGT..vRFR..VVDVD..VIP..................gSERDRSFLSIEGTML........................................................................................................................................................................................................................
A0A1Y2FPE5_9FUNG/84-142               .........................PKKNLEI.VGKV..NKVSADHIGLLLYGVVNAS..I.P.S.D.K.........................I.rKK......................N.FKWDE...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------nsfawketfgdrrk..........................................................................................................................................................................................................
E3RX37_PYRTT/121-225                  .........................PVQNAYI.HAHI..TDQAKTHITLAHLNTFPVS..I.L.A.A.C.........................M..PS......................D.WSWHS...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...QE..TG.K..IKRA..........................................................WDGRLSDEGGWWVNDFGDKVEGDlrvRIR..DVDGR..MDG...................KGKGKGFLRIDGSL-i.......................................................................................................................................................................................................................
A0A2I0S691_9PEZI/142-188              .........................PAPNTYL.KAEV..NLQNESILGLLYLNYFTVS..I.P.K.E.N.........................L..PQ......................D.WRWEN...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------gqw.....................................................................................................................................................................................................................
A0A1C1CNL6_9EURO/244-381              .........................PQKGDEL.YGWT..NVTSEGFVGLVSYNYFQTA..V.G.K.T.R.........................I..PE......................G.WKWNGptre...................................................................................................................eaqgRKKGRKGR.lRDE..DGGD.G..P....QE.QD..TQ.E..T...EA..TF.V..EESA..........................................................SQIPLGEDGGYFADADGAKIKST..lKFR..VVDTE..AVP..................aHDRNKWSLQIHGTLL........................................................................................................................................................................................................................
D8QYX2_SELML/99-157                   .........................PKAGMLI.EGKV..NKVEKDYIGMLVLGLFNAA..I.G.I.N.D.........................I..RQ......................D.LFYDE...........................................................................................................................VATEQ---..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------twisesderh..............................................................................................................................................................................................................
A0A507DUE3_9FUNG/126-189              .........................PKVDAPI.IGVV..NKVSNDHIGLLVHGIFNAS..I.P.S.D.K.........................I..RR......................N.-EFRY...........................................................................................................................SEEEE--A.wKQP..QSDN.S..S....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------sssvv...................................................................................................................................................................................................................
A0A096NPL9_PAPAN/125-291              .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWLTmeinmgdelefevfrldsdaagvfcirg..................................................................klnitslqfkrsevseevtesgteeaakkPKKKKKKK..DPE..TYEV.D..S....GT.TK..LA.D..D...AD..DT.P..MEES..........................................................ALQNTNNVNGLWEEEPKKKKRK-...---..-----..---...................---------------kkhqevqdqd..............................................................................................................................................................................................................
A0A261Y7R2_9FUNG/111-230              .........................PKRGSRL.VGTV..NLQSADHIGLLIYGTFNAS..I.P.R.E.Y.........................I..PS......................D.FEWNPs.........................................................................................................................sMTTTNNAS..LAD..VDGE.T..E....AE.DT..TT.E..E...TE..PS.Q..SEDA..........................................................TATRTTPQNGEWISKSSGETIGA...KEG..VLDFL..VVD...................LVHAND---------........................................................................................................................................................................................................................
A0A197KK38_9FUNG/91-199               .........................PVKGSTL.YGTI..NLQSPDHIGLLLYGTFNAS..I.P.S.E.F.........................I..PK......................D.-KYVF...........................................................................................................................--------..--N..PNK-.-..-....--.-S..YS.G..S...DS..AN.S..DPDS..........................................................PLMGTSLLNGEWVHKSTDESIGH...-DG..VIEFE..VSE...................LVRTNDMLTVTGSL-m.......................................................................................................................................................................................................................
A0A0G2FTJ0_9PEZI/220-344              .........................PSRGAWM.EGVI..NLQSEGHIGVVCFDKFNAS..I.S.R.R.S.........................L..PR......................G.WTWVD...........................................................................................................................--QPEEEE..PEP..EPVA.A..E....DP.FV..EG.Q..E...DG..EG.E..EGKK..........................................................AELPQLRSSGYWLDRKGDKVRGK...IYF..RIKNF..SSG...................STGDYTYLSLQGTML........................................................................................................................................................................................................................
A0A093ENS8_TYTAL/41-247               .........................PRRGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................V.IQWQElglkigdklkfrvlhldsdaaglffirggltkssmrpkqs..........................................etvtdstneddvqkpdhqenglndsggdtiaeeplgetgntG-------..---..----.-..-....--.--..--.-..-...--..--.-..---Renteeqs...........................................vdaanglcD----------------------...---..-----..---...................---------------dknkkkkkkkhkheeqehvlptsdssgyqsdhkkskkrkrkhcdevedselsqlsqepqakkkr........................................................................................................................................................
A0A2N1JFG4_9BASI/95-195               .........................PEIGMML.EGVI..TLSSPSHVSLLLHDTFNAA..I.S.A.E.H.........................L..PV......................G.-EWEF...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...AY..YE.E..GAVQ..........................................................RSDPNDRSLGLWRHKKTGSPLGG...NEH..KLLFT..VIS...................MTVANRMLSLHGSLL........................................................................................................................................................................................................................
A0A670Z7U0_PSETE/132-319              .........................PKPGKKL.TGII..NKVAPSHIGCLVHECFNAS..I.P.KpD.H.........................I..TT......................E.-EWKNfgfqigirlvfkvlhfdsdsagvfcirgklckns......................................................lgeemlkekckkkyekhcdvhigseemevdissvgIEDRE---..MHS..GDDE.D..D....HG.IY..DK.P..E...AE..NG.Q..DGAE..........................................................VGMHASDSSGYHSDHGK------...---..-----..---...................---------------skkkkrkifeeenghsgllkskakkkr.............................................................................................................................................................................................
A0A6I9MZ88_9TELE/141-358              .........................PERGQTL.LGKV..NKLGVSHVGCLVHGCFNAS..I.P.R.P.N.........................L..VS......................V.ETWRDagprigaelefevtaldadmmgvllirgrln.............................................................rtrvqellamaessesgvpadqpepepepepMEESPEDT.pKKK..KKKK.V..K....VK.EE..EM.T..T...PS..CQ.D..TTAE..........................................................LNGTMIEENGNKAGEKKKKKKKKh.lKEE..EVEVE..L--...................---------------srmevngsdssgylsdkqskkrkletdtgvpsslseeapkskk.............................................................................................................................................................................
A0A287R923_HORVV/76-228               .........................PQPEMIL.EGKV..EMLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..PE......................T.FKFKRrghggkfisqldkqhvikkgsmirfsvkrvdte.........................................................mnchitgslmpphtgcmrwlsvhdaeyaseissG-------..---..--KR.K..S....RD.HT..KT.E..H...NV..QG.R..ATVN..........................................................-----------------------...---..-----..---...................---------------sedsvvnserprkskkrsvee...................................................................................................................................................................................................
A0A287R906_HORVV/81-233               .........................PQPEMIL.EGKV..EMLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..PE......................T.FKFKRrghggkfisqldkqhvikkgsmirfsvkrvdte.........................................................mnchitgslmpphtgcmrwlsvhdaeyaseissG-------..---..--KR.K..S....RD.HT..KT.E..H...NV..QG.R..ATVN..........................................................-----------------------...---..-----..---...................---------------sedsvvnserprkskkrsvee...................................................................................................................................................................................................
RPA43_YEAST/127-250                   .........................PQVGDVL.EGYI..FIQSASHIGLLIHDAFNAS..I.K.K.N.N.........................I..PV......................D.WTFVH...........................................................................................................................NDVEEDAD.vINT..DENN.G..N....NN.NE..DN.K..D...SN..GG.S..NSLG..........................................................KFSFGNRSLGHWVDSNGEPIDGK...---..-LRFT..VRN...................VHTTGRVVSVDGTL-i.......................................................................................................................................................................................................................
#=GR RPA43_YEAST/127-250        SS    .........................--TTEEE.EEEE..EEEESSEEEEEETTTEEEE..E.E.G.T.T.........................S..-T......................T.SEEEE...........................................................................................................................CSS-----.----..----.-..-....--.--..--.-..-...--..--.-..----..........................................................----TEEEEEEEE-TTSSB--SE...---..-EEEE..EEE...................EE-SSSS-EEEEES--.......................................................................................................................................................................................................................
A0A0U5GAR5_9EURO/188-364              .........................PQRGQLL.EGWV..NVQSEGFLGAVLLNLFSVG..I.E.R.K.R.........................L..PP......................N.WKWIP...........................................................................................................................PGEEDEMQ..DSS..KPTS.S..A....PT.SS..DE.D..D...EE..ST.S..SPFDpekehfnpvslasdanpfsydsld..........ttapttgeegegegdvtaqdqqgaFDISDESLEGHFQSISGHRVRGT..vKFR..VVDID..VIP..................gSERDRGFLSVEGTML........................................................................................................................................................................................................................
A0A2C5X337_9PEZI/275-387              .........................PSVGAWM.EGEV..VLQTEGHIGVVCWGRFNAS..I.E.A.S.R.........................L..PR......................T.WRWVA...........................................................................................................................--------..---..---A.E..E....AE.LE..DD.S..M...EL..DN.G..TSEG..........................................................AAALTPQTTGYWADENGTPVDGK..vVFR..IKRFD..V-G...................VRDDHSFISIEGSML........................................................................................................................................................................................................................
A0A550CXV5_9AGAR/124-237              .........................PHIGMKL.VGRI..NLSSPDHISLLLHRTFNVS..I.P.R.R.H.........................I..PE......................D.-QWEF...........................................................................................................................--------..---..-EYG.A..A....EN.DP..EF.G..P...AA..DT.N..EDED..........................................................EKAVDSDTGGRWVHHLTREPLAG...ESR..YLSFT..VIG...................LTIANEMLSLVGSI-q.......................................................................................................................................................................................................................
A0A0C2XCV0_9AGAM/135-246              .........................PTIGSKL.QGTI..TICSPDHIGLLVHKTFNVS..I.P.R.H.H.........................I..PA......................D.-EWEF...........................................................................................................................--------..---..---E.H..G....SL.EN..DP.E..Y...GA..AA.E..NEDG..........................................................QQHEEGEDSGRWVHKETGEIIGG...STR..RLEFT..IIG...................LSIADAMLSLIGSV-q.......................................................................................................................................................................................................................
A0A1X2IPT0_9FUNG/123-226              .........................PKKGSKL.VGRI..NLQSQDHIGLLIYGTFNAS..I.P.K.S.R.........................I..SS......................D.-KYEW...........................................................................................................................--------..---..----.-..-....--.--..RP.S..E...ED..GD.D..DGEE..........................................................NDDQIRNQHGEWVVRSSGDSIGG...DKG..SLEFS..VMD...................IIEANDILTVTGTL-........................................................................................................................................................................................................................
A0A059JFF5_TRIIM/200-342              .........................PERGQTL.EGWI..NVQSEDFLGAIVFNLFSIG..I.E.R.R.R.........................L..PA......................D.WKWIApgqqsdr.............................................................................................................psttsasPASSSKDE..EDE..DDDE.P..D....SD.KE..--.-..-...--..--.-..---Nfkplas..............................................nseasqFEDAASAETGYFQTRSGKRVRGT..iRFR..VRDVD..VIP..................gSERDKGFLSLEGTML........................................................................................................................................................................................................................
A0A0F4YKA5_TALEM/188-343              .........................PQRGQIL.EGWV..NVQSEGFLGAVVYNLFSVG..I.E.R.R.R.........................L..PA......................D.WKWIP..........................................................................................................................pGAEDEGSI.dNKS..KNRS.S..K....GA.TS..GE.E..D...ES..SN.P..DFDPekehftplpkpv.................................vhspiesahpleeNPDDSDSATGYFQSASGYRVRGM..iRFR..VRDID..VIP..................gADPDRGFMSIEGTML........................................................................................................................................................................................................................
W7MMW7_GIBM7/283-396                  .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................D.WKWVP...........................................................................................................................--------..---..--NE.S..P....EA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWADGNGDKVKGK..iRFR..IRNFD..V-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
A0A1L9WJ52_ASPA1/186-369              .........................PQRGQLL.EGWV..NVQSEGFLGAIALNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWIPpgderedef.........................................................................................................tttttttttT-TTAKNT.pNDE..TNPS.T..T....NS.DD..SD.S..D...TS..ES.D..SKPKfdpelehfspvtlasdan.....................plnpsnsnpdistindlntNEDDDDGVEGYFQSVSGHRVRGT..iKFR..VVDID..VIP..................gSERDRGFISIEGTML........................................................................................................................................................................................................................
A0A7N4V232_SARHA/108-349              .........................PERGQKL.LGKV..NKVAPSHLGCLVHGCFNAS..I.P.KpE.H.........................M..AA......................E.-QWQGlhfsvgdelefevsrldsdaagvfcirgllllsslpptdsalpkgsgdvssetepg..........aegekpkkskkglkkscsawgdlpatlpsdkaepsdkaepsekaepsdeagavetdsPAQEAEKE.lCEE..QEPR.M..K....KK.KK..K-.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------hhrekqepleldpqcqasdssgyqsdhqkkkkkrkrpsdepegaaapeeeprpkkkkkkeke..........................................................................................................................................................
A0A4U0WWE8_9PEZI/294-393              .........................PTKGSWL.EGFV..NLQNESLLGLVCYNYFNAA..I.E.R.H.R.........................L..PK......................D.WRWVE...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.D..GSQG..........................................................STRVGKGSQGYWVDGNGQKMDGR..vVFR..VKDFE..AAP..................gSESGAGSLNTLGTLL........................................................................................................................................................................................................................
A0A1D6IWQ3_MAIZE/104-156              .........................PQPDMIL.EGMV..EMIGKESIHAIVLGVFSVA..I.M.S.E.D.........................I..KF......................K.FKWVS..........................................................................................................................yIEK-----..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------kndif...................................................................................................................................................................................................................
D8Q8H0_SCHCM/121-235                  .........................PHIGQKL.VGKI..NLSSPDHISLLLHRTFNVS..I.P.R.R.H.........................I..PE......................G.-QWEF...........................................................................................................................--------..--E..YGAA.E..N....DP.EF..GP.A..A...AD..V-.E..ADED..........................................................EKPVESDTGGRWVHHLTREPLGG...DAK..YLSFT..VIG...................LTIANDMLSLIGSI-q.......................................................................................................................................................................................................................
A0A166IHK3_9AGAM/129-252              .........................PHIGMKL.VGKV..NLCSPDHIALLVHRTFNVS..I.P.R.H.H.........................I..PE......................D.-SWEF...........................................................................................................................--------..---..----.E..Y....GA.AE..ND.P..E...FG..TT.A..EDDG..........................................................DEEKPEEEGGRWVHSITREKLGG...PDG..FLEFT..VIGcgsify......pnlgsifFTIANEMLSLRASLQ........................................................................................................................................................................................................................
L8G8K0_PSED2/164-261                  .........................PTRGGWL.EGYV..NLQNEGHLGIVCWNLFNAS..I.E.R.Q.R.........................L..PK......................D.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.A..EDLE..........................................................GEGYAEDGVGYYVDGAGTKIEGI..vKFR..VKDIE..-SS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
C9S9F6_VERA1/181-298                  .........................PKRGAWM.EGSI..NLESEGHVGVVCWGKFNAS..I.E.S.A.R.........................L..PP......................A.WRWVH...........................................................................................................................--------..-LG..TDET.A..A....TS.AY..DD.T..V...SN..FT.A..EEQH..........................................................GAVRQIHATGYWVDEAGQKVKGR..vRFR..IKAFD..V-G...................VSGDHGYLSLEGTML........................................................................................................................................................................................................................
R8BXX5_TOGMI/333-457                  .........................PTRGAWM.EGRV..NLQNEGHVGVLCWEKFSAS..I.D.A.K.R.........................L..PP......................G.WKWID...........................................................................................................................-CLNADSE..EGN..GAIK.P..V....ES.AD..GQ.L..R...DD..TF.A..DEN-..........................................................QSLHQMHTTGYWVDASGNAVRGT..lLFR..IRDFE..I-G...................RVGDHGYLSIVGTML........................................................................................................................................................................................................................
A0A0G4FCQ2_VITBC/148-293              .........................PVPEDLL.LGRV..HYVGSHYIAITVHGLFPAF..V.S.R.Q.R.........................L..PK......................Y.LKYAQnrwwcva.............................................................................................................degqslfTRWKNAVD.rDID..LTKE.D..E....EH.FK..RE.R..V...KG..EI.K..RERD..........................................................LVDDDPDMDRYLVDAERSAAESSi.gIDD..YVQFR..VVSl.................rEGRDGGLMNLDGSL-k.......................................................................................................................................................................................................................
E4ZMP9_LEPMJ/123-235                  .........................PTLHAPL.TGTL..THQSRTHITLSYLNTFPVS..V.L.A.A.H.........................L..PS......................T.WSWQV...........................................................................................................................--------..---..----.-..-....--.DS..NT.A..T...TT..AA.R..YKNG..........................................................WDGRLRDEGGCWVIEGEGKAESG...--R..SVEVR..IRDfdg............rldgKGKGKGFLRIEGSLL........................................................................................................................................................................................................................
A0A2S7QGN0_9HELO/156-260              .........................PEKGAWL.EGYI..NLQNEGHLGLVCWNLFNAS..I.E.R.A.R.........................L..PK......................D.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..-V.A..E...QA..KD.A..EAGE..........................................................GESYAEDGIGYYVDGEGKKVEGT...VKF..RVKEI..ESN...................HDKERGFLTVDGTML........................................................................................................................................................................................................................
RPA43_DICDI/96-157                    .........................PFKDQIL.NGVV..KRVSTTHISLLVFGTISAS..I.P.K.S.N.........................I..PK......................S.FAFDHs........................................................................................................................snM-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------fmnkqtkatisvgt..........................................................................................................................................................................................................
A0A4R0R3G6_9APHY/135-251              .........................PQVGMKL.SGKV..NLCSPDHISLLVHRTFNVS..I.P.R.R.H.........................I..PT......................E.-SWEF...........................................................................................................................--------..-EY..GPAE.N..D....PE.FG..AE.V..E...KD..QA.E..GEEE..........................................................GENQTVEGSGKWVHKLTGSVLGG...SSG..QLEFS..VIG...................LTIANQMLSLVGSLQ........................................................................................................................................................................................................................
A0A3M6U7S8_POCDA/105-261              .........................PTIGSTL.VGTV..NKLGVDYVGCLVHNCFNAS..I.A.K.S.N.........................F..KN......................G.LLFDSldigseflfkvigtea..........................................................................................vngvlaiigevkeqkvnK------R..KRK..HKDI.E..R....YE.QR..SS.D..E...TD..QP.E..RVTE..........................................................LSSE-------------------...---..-----..---...................---------------rlnqnglnltdgntkvkkkknkelrrdvlekfqvrfvehefkeqngrs........................................................................................................................................................................
K7F9I5_PELSI/78-290                   .........................PKKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.N.........................Q..MS......................A.VEWQDlglktgdklefevlhldsdaagvffirgrl..............................................................nkdrhlrascssvhpkypetvpadtnsrdeiP---KKKL.kRAR..KNSE.L..E....ND.TE..PT.D..N...AD..TT.V..VEDA..........................................................EENGPDTVNGYYDKKPKKKKHKQ...EE-..-----..---...................---------------qksvfyesdcsgypsdhkkvkkkkrkhcdideeselsqlsqepkakkrrkl.....................................................................................................................................................................
J4KPJ6_BEAB2/258-371                  .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................S.WKWVS...........................................................................................................................--------..---..--NE.D..P....EA.EG..ME.E..T...AS..IV.A..PDEH..........................................................GVVHQIHSTGFWVDANGDKIKGK..iRFR..IRNFD..V-G...................VSGETTYLSLEGTML........................................................................................................................................................................................................................
A0A2P6NBQ6_9EUKA/85-170               .........................PVIGQPL.EGKV..IQIGYDHIGMLVDGLFNAS..I.F.S.D.Q.........................L.sPAfep...............sqfeD.-KWESkt.......................................................................................................................dsS-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------vsisvgstvrfivdgqgavrnkqkdntevy..........................................................................................................................................................................................
A0A4S2N434_9PEZI/121-208              .........................PRKGMVV.KGHV..NLVSKSHIGLLVDNTWNVS..I.P.L.A.R.........................I..PD......................T.WKWVE...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-AAKAGEGHGYWSNDEGAKVEGD...---..-LRFE..VQE...................VKAGGSLFLIEGSLL........................................................................................................................................................................................................................
A1CG30_ASPCL/183-348                  .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................D.WEWVPpgde...................................................................................................................dedsDSTKHNKK.iVFS..STED.D..A....DA.DE..DS.D..-...--..--.-..---Rspefdperehfkpitlas.....................danpfsetaddenptsaedGGDDDSAAEGYFQSVSGHRVRGT..vRFR..VVDID..VIP..................gTDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A6G1B6A6_CROCR/92-289               .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................E.-QWQIlevnvgdelefevfrldsdaagvfcirgklnttslqtkcstvse...................................evtetgteetvekplkkkkkkkkdldshevesdnreladfadvtV-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------keetdlqinnesglrkeepkkkkkrhqedqdqdpvfqgsdssgyqsdhkkkkkkrkhheeaeftp.......................................................................................................................................................
A0A3M6YJ91_HORWE/298-403              .........................PQKGTYL.EGYV..NLQNESLLGLVCYNYFNAG..I.E.W.N.R.........................L..PK......................D.WQWVS...........................................................................................................................--------..---..----.-..-....--.--..--.D..E...EG..AL.T..GKGK..........................................................GKKATQEGEGHWANAEGKKFDGR..lIFR..VKDFE..ATS..................gSEGGAGSINIVGTLL........................................................................................................................................................................................................................
B8BM96_ORYSI/81-234                   .........................PQPDMIL.EGKV..ELLGKESIHAIVLGVFSAA..I.M.A.D.D.........................I..NE......................K.FKFKRkgdggkfisrsdrhhvirkgsmirfsvkrvdtemnch................................................itgsllpphtgsmpwlsthdaeyaseissgtrrpsnvgI-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------kikneqdhktsdnedsvinserphkksrkralee......................................................................................................................................................................................
A0A061HKW3_BLUGR/157-261              .........................PEKGAWL.EGYI..NLQNDGHLGVVCWNLFNAS..I.E.R.K.R.........................L..PA......................D.WEWRD...........................................................................................................................--------..---..----.-..-....--.--..-S.C..E...AQ..ID.E..DDKD..........................................................NQPLAGETSGYYIDGHGDKVEGM..iKFR..VADVE..S-S...................QDRERGFLTIMGTML........................................................................................................................................................................................................................
A0A074Z2H1_AURSE/166-277              .........................PTPGAVI.EGYV..SLQNESYLGLVCWNFFNAG..V.D.R.K.R.........................I..PS......................N.WRWVP...........................................................................................................................--------..---..----.-..-....NH.NA..NA.G..T...KS..AT.D..WMRG..........................................................LRNKSDESSGHYVDENGKKVEGK..vKFT..VKDFE..SAP..................sTERERGFLSIEGTLL........................................................................................................................................................................................................................
A0A6P3W1B9_CLUHA/140-357              .........................PNKGQKL.EGVI..NKIGQTFVGCLVHGCFNAS..I.L.K.P.R........................eM..TS......................E.-MWRDsglviggslefevvqldadaagvllirgrlhktwyee................................................mlrltdpgtddateepfmpadntateaaldgvdgvqpeKKKKKKKD.kSKD..KEAL.E..D....SV.VK..DS.Q..L...NG..SG.N..TELT..........................................................RTDSDVNSNGHVEKKKKKKKKDK...ETS..SQATE..GVP...................ASDSSGYLSDKGS--kkrkesdeandaslpdn.......................................................................................................................................................................................................
A0A5B0PZA6_PUCGR/169-286              .........................PTIGQKL.VGRP..TLSSPSHLSLVIYRTFNAS..I.N.E.N.H.........................L..RA......................A.-GFHY...........................................................................................................................-------D..INF..EVPA.H..W....KS.IV..EP.A..N...PQ..DQ.S..LSTN..........................................................LPLEHHQDRGCWVDANGVVVGDD...-QG..TVSFT..VMG...................LTIANHMISVVGSLL........................................................................................................................................................................................................................
A0A317VW33_9EURO/156-309              .........................PQRGQVL.EGWV..NVQSEGFLGAISMNLFSVG..I.E.R.K.R.........................L..PP......................N.WKWIP...........................................................................................................................PGEEREEQ.aDGD..QEQE.P..A....ST.TD..SD.S..E...EK..SE.N..GKNTkpfdaekelfnp..................................valatdtdldqvEEAEEATAEGYFQSVSGHRVRGT..iRFR..VVDVD..IIP..................gSERDRGFMSIEGTML........................................................................................................................................................................................................................
A0A4Q4TS61_9PEZI/309-434              .........................PKRGSWM.EGSL..NLQSEGFIGVICFGMFNAS..I.E.A.S.R.........................L..PS......................G.WKWVD..........................................................................................................................lL---SKKG.gKQQ..TGKS.A..A....ET.KL..PT.P..D...PQ..DE.N..EEED..........................................................DGTDQAHSTGYWVDESGSKVGGK...LWF..RIKNY..EVG...................SLGDYGYLSIEGTML........................................................................................................................................................................................................................
A0A0D9WMC6_9ORYZ/81-235               .........................PKPDMML.EGKV..EMLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..RE......................K.FKFKRkndrgkfvsrsdkhhvikkgsmirfsvkrvdae.........................................................mnchitgslipphtgsmlwlsvhdaeyaleinsGKRSRDSN.iKTE..QHEQ.D..H....RT.VN..DE.Q..S...VK..SG.R..QHKS..........................................................KS---------------------...---..-----..---...................---------------rkrsfeer................................................................................................................................................................................................................
A0A250XSV5_9CHLO/84-131               .........................PAEGCML.VGKV..IKIAADFVGLLVLGVFNAS..I.A.A.D.S.........................I..RS......................E.FK---...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------cvdgvrs.................................................................................................................................................................................................................
A0A2C5YF31_9HYPO/312-435              .........................PTRGAWM.EGLI..HIQTEGHIGVVCFGRFNAA..I.E.T.S.R.........................L..PP......................D.WHWVK...........................................................................................................................RDVGN---..DGE..GHDF.L..A....QD.ED..DD.S..R...SV..DS.A..TNQH..........................................................GRVRQANSTGYWVDARGTPIGGR..lRFR..IRNYD..-AG...................LNGNVSYLSLEGTML........................................................................................................................................................................................................................
A0A5C3NB55_9AGAM/55-180               .........................PRVGMKL.VGRV..NLCSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..PT......................D.-QWEF...........................................................................................................................-EYGPAEN.dPEF..GPHA.V..Q....DE.ED..GP.M..N...AD..EG.S..SQNE..........................................................DETHEIEGGGRWVHKITGDRLGG...TGR..QLEFT..VIG...................LTVANNMLSLIGSI-q.......................................................................................................................................................................................................................
A0A178E5I7_9PLEO/136-240              .........................PQQNHHI.TATL..THASQTHITLSYLNTFPVA..V.L.A.A.H.........................L..PA......................S.WTWQA...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...QE..GN.R..VKKG..........................................................WDGRIADEGGWWVDGEGERVDVG..kEIGvwVRDVE..GVG...................KGRGKAFLRIEGSL-v.......................................................................................................................................................................................................................
A0A4W4EFV1_ELEEL/139-345              .........................PRNGEKL.LGVI..NKISVGHVGCLVHGCFNAC..V.L.KpA.Q.........................L.sPE......................Q.WRASGlrvggsltfevfqldadvagvllirgrlersrv.........................................................eelvaafstarsleeatepdssavhgstedvavP-------..KPK..KKKK.K..K....DK.WT..SV.E..D...ES..RE.R..AGSEvtldvngntt......................................hsspdsqlkeEKKKKKKKKDKWQESS-------...---..-----..---...................---------------eelpppadlpgsdssgyvsdkssrkrkvqdds........................................................................................................................................................................................
A0A669CM52_ORENI/176-317              .........................PQKGQKL.RGKV..NKLGISHVGCLVHGCFNAS..I.P.R.P.N.........................L..VS......................V.ETWRDagprigsevefdvtaldadtagvll........................................................................irgrldktrvqellamcegtetsvpaGEEGTETS.vPAG..EEDP.E..P....TQ.DA..SE.E..T...PK..KK.K..KKKK..........................................................VKEEEIE----------------...---..-----..---...................---------------eeipt...................................................................................................................................................................................................................
M7SCV9_EUTLA/250-391                  .........................PKRGSWM.EGTL..NLQSEGFIGVICFDMFNAS..I.E.A.S.R.........................L..PS......................G.WKWVDllsgskd.............................................................................................................kgkrqtgK-IDAGAElpTTE..SQDE.A..Q....DE.AQ..DE.A..Q...DG..AQ.D..EKED..........................................................DGTNQAHSTGYWVDESGSKINGK...LRF..RIKNY..EVG...................SIGDYGYLSIEGTML........................................................................................................................................................................................................................
A0A0H1B7E4_9EURO/245-407              .........................PERGQRL.EGWI..NVQSDGFLGAVVYNLFSVG..I.E.R.R.R.........................L..PA......................D.WEWVA..........................................................................................................................pGEESTTSA.lEAT..TPKK.S..S....ST.DD..DDdD..N...ED..QD.S..DF-Dsdkenfrplpatssav..........................ldlsaqhqnhegmeppFEAFEDAAAGYFRTRSGRRVRGM..vRFR..VRDVD..VIP..................gAEHDKGFLSIEGTML........................................................................................................................................................................................................................
A0A0F8XTH6_9EURO/188-365              .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PS......................D.WKWVPpgeeed...............................................................................................................eaaesgR-------..---..-NSN.N..A....SS.SA..AA.T..T...TT..TT.T..---Ttttttttsdddsdenpspafdpake.......hfnpvtlasdanpfsdtlaadvgadgEAASDDAVEGYFQSVSGHRVRGT..vKFR..VVDID..VIP..................gTERDRGFLSIEGTML........................................................................................................................................................................................................................
A0A161XTV7_9PEZI/292-411              .........................PRRGAWM.EGSI..NLENEGHIGVVCWGKFNAS..I.E.S.A.R.........................L..PP......................E.WRWVH...........................................................................................................................----AGSA..--E..-AAS.Y..V....AD.PF..DD.T..A...ST..RT.A..EDEH..........................................................GAVRQIHTTGFWVDGSGDKVKGR..vRFR..IKAFD..V-G...................VSGDHGYLSLEGTML........................................................................................................................................................................................................................
A0A674A2W3_SALTR/140-354              .........................PQRGQKL.LGTV..NKLGVSHVGCLVHGCFNAS..I.P.KpA.H.........................V..TM......................E.-TWKEagpsigaelefevcqldadtvgvllirgrlgrtrvqelmaagessdpndpt....................eqleepdtepvlepnqdspdatvkpkkkkkkkekhreevvsvpapgdavngtA-EDSSTNghSEE..KRKR.K..E....KR.QN..EE.D..E...ER..EV.G..GRGP..........................................................VEVQGSDSSGYLSDKPNRKRK--...---..-----..---...................---------------rgdditsflhgd............................................................................................................................................................................................................
A0A6J2I5A4_9PASS/117-320              .........................PKKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................V.VQWQElglkigdelkfqvlhldsdtagvffirggltkksmrprrsetvtdstn...........................gneiqkldhqenglndsgednvteeplnetnnlgreneegqsvdavngL-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------cdetgkkkkkkkkdeqeqvlptsdssgyqsdhkkskkkkrkhceieeselsqlsekpkakkkr.........................................................................................................................................................
F9G216_FUSOF/283-396                  .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................D.WKWVP...........................................................................................................................--------..---..--NE.S..P....EA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWADGNGDKVKGK..iRFR..IRNFD..V-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
A0A1M2V451_TRAPU/138-273              .........................PQVGMKL.VGKI..NLSSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..TT......................D.-VYEF...........................................................................................................................--------..EYG..PAEN.D..P....EF.GA..GG.A..E...ET..AQ.D..VPAE..........................................................GAEGQAEGGGRWVHKVTGTKLGD...ADA..SLEFT..VVGcvtsislaf.tsahvksnsLTIANQMLSLVGSI-q.......................................................................................................................................................................................................................
A0A1E4TUA2_PACTA/135-282              .........................PEIGDVV.EGWI..YMQSQSHIGLLIHDTFNAT..I.K.K.N.N.........................I..PS......................N.WYFVP...........................................................................................................................--NQADEY.lEED..EKDG.S..N....DI.ST..EG.D..N...GG..AS.N..GGISvgigagtgtgags................................gsgsndasisqvaNGTSKFRSMGHWVDENNVPVEGK...---..-LRFT..IKS...................LHTAGRVVSVEGTL-i.......................................................................................................................................................................................................................
A0A6P7HM75_9TELE/141-375              .........................PQKGQKL.LGTV..NKLGVSHAGCLVHGCFNAS..I.P.R.P.K.........................L..VS......................V.ETWRDagprigaelefevtaldadvagvllirgrlnrtmvqellamgessgssv.........................pvdqpepqepdtnsnleptqespgetpkkkkkkkkdkvkeeeteeminaP-------..---..----.-..-....--.--..--.-..-...--..--.-..---Tyqpdsmtepnn...................................mteltngsedgeK----------------------...---..-----..---...................---------------kkkkkkkkdkqvkeeedeielsrmeihgsdssgyhsdkpskkrkhetcfnedstptkpkkkkkgdie.....................................................................................................................................................
A0A3Q2W0K6_HAPBU/166-382              .........................PQKGQKL.RGKV..NKLGISHVGCLVHGCFNAS..I.P.R.P.N.........................L..VT......................V.ETWRDagprigsevefdvtaldadtagvllirgrldktrvqellam.........................................cegtetsvpageedpeptqnaseetpkkkkkkkkvkeeeieE-------..---..----.-..-....--.--..--.-..-...--..--.-..---Eiptisacqldngvtpepng....................mrdevngneaaenkkkkkkKKEKRIKEEEEEMDVSQVAVHGS..dSNG..YI---..---...................---------------sdkpskkrkresgndvtssfse..................................................................................................................................................................................................
I0YV46_COCSC/58-104                   .........................PAPGQLI.TGQV..NKIGADYIGLLVLGIFNAA..I.G.H.Q.N.........................I..RA......................E.FQH--...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------saadn...................................................................................................................................................................................................................
A0A1Y1YGF5_9PLEO/132-241              .........................PVAHAII.PCHI..VHQFSSHVALSYLNSFPVS..V.L.K.T.Q.........................V..PK......................S.WTWNT...........................................................................................................................--------..---..----.-..-....--.-Y..SN.T..S...TS..HT.N..KYNG..........................................................TQEGGSEGEGYWTDSDGMPIPNV..lEIR..IRDFE..VKSg.................gGRAGKGHFGIEGSL-i.......................................................................................................................................................................................................................
A0A1V6TTN0_9EURO/156-297              .........................PQRGQTL.EGCV..NVQSEGFLGAVVFNLFSVG..I.E.R.K.R.........................L..PS......................S.WRWVQ...........................................................................................................................PGEEG--E..GET..EANA.T..T....DD.ES..GA.E..R...ME..NF.D..AEKElfqptal...........................................paddldleDGEEEEEGTGHFQSVSGHQVRGN..vKFR..VVDID..VIP..................gSERDRGFLSIEGTML........................................................................................................................................................................................................................
A0A0C9ZXN5_9AGAM/125-264              .........................PRIGTKL.VGKI..NLYSPDHISVLVHRTFNVS..I.P.R.H.H.........................I..PQ......................D.-QWIFeygp...................................................................................................................aendP-------..---..--EF.G..A....GW.DT..DE.H..A...SA..DG.A..TPTSvvqeieiqd........................................ispdtvmkpSKDQMSESSGRWVHHLTGKRLGD...PDG..YLDFT..VIG...................LTVANEMLSLQGSI-q.......................................................................................................................................................................................................................
A0A164ZXI0_9AGAM/98-214               .........................PRIGSKL.VGKV..SLASPDHLGLILHSTFNAS..I.P.R.Q.H.........................I..RT......................DeWEFEY...........................................................................................................................GPAENDPE..FGQ..SVSW.K..T....DE.QT..VI.P..D...GE..QT.G..VEGE..........................................................AEAEEPQQTGKWIRITDGESIGG...EEG..LVEFT..VIG...................---------------yvlf....................................................................................................................................................................................................................
A0A1J9QBL2_9EURO/243-407              .........................PERGQLL.EGWI..NVQSDGFLGAVVYNLFSVG..I.E.R.R.R.........................L..PA......................D.WQWVApgqe...................................................................................................................ptasM-------..LEK..TTAK.S..S....SN.ED..DN.D..D...DN..ED.E..EEDSdfdsdkenfrplpsnsa.......................amldiniqsqnhdgteqpFEALEDTSTGYFQTRSGRRVRGM..vRFR..VREVD..VIP..................gAEPDKAFLSIEGTML........................................................................................................................................................................................................................
W2PYU0_PHYPN/83-269                   .........................PKEGMML.RGVV..NKIGSNHVGMLFAGVFNGS..V.A.E.A.E.........................L..PK......................G.YVHNYaqdcwlgedgssisvedevevkvlrvhvaggmiaie...................................................atmrfdaagvakstapkkvkktshlnlaagepvtkpIKEKKTKK.tKKV..DEAE.D..K....QE.KK..SK.K..R...KH..EK.P..DEEV..........................................................VEEEPVEAEEVKVKSKKHK----...---..-----..---...................---------------hkdkdakkkkhkktkhd.......................................................................................................................................................................................................
H0X025_OTOGA/125-336                  .........................PEPGQKL.VGRV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWQTveinlgdelefevfrldsdaagvfcirgklnitslqfksskvseevtetgpeevv.............ekppkkkkkkkkdpetcdvdsvttkqadfaddtpkeesdlqgtnnvnglceeeptKKKKKKKK.kHQE..DQDQ.D..P....VF.QG..SD.S..S...GY..QS.D..HKKK..........................................................KKKRKHKEEA-------------...---..-----..---...................---------------eftpplacsprkg...........................................................................................................................................................................................................
A0A165N5X1_EXIGL/136-261              .........................PTIGMKL.KGKI..SLCSPDHVSLLVHRTFNVS..I.P.R.H.H.........................I..PT......................D.-DYEF...........................................................................................................................-MWGAAPN.dPEF..GLEA.E..D....DA.TT..TA.A..A...PA..ED.D..DEPA..........................................................EVDVDASKNDRWIRRDNGELLGD...ETG..HLEFT..VIG...................LKLANQMLSLVGSI-q.......................................................................................................................................................................................................................
A0A3Q3M0Y4_9TELE/137-353              .........................PKKGQKL.LGKV..NKVGVSHVGCLVHGCFNAS..I.P.K.P.N.........................L..VT......................I.ETWRDagprigaelefevtaldadtagvllirgrldr..........................................................trvqelmaigessesniptdqpdapdtehipetT---EESS.dKTP..KKKK.K..K....KK.DK..VK.E..E...ER..EA.E..LTPScqqdgnt...........................................avelngtiD----------------------...---..-----..---...................---------------evnanesgekkkkkkkekhlkeeevelsimevhgsdssgyisekpskkrkhesgsdvtsg............................................................................................................................................................
A0A0E0A5L8_9ORYZ/81-180               .........................PKPDMML.EGKV..EMLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..HE......................K.FKFKRkkyggkfv...........................................................................................................srsdkqhvI-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------kkgsmirfsvkrspeksrfdtmalksnkkqsgkgqgisk.................................................................................................................................................................................
A0A165G8M9_9BASI/81-180               .........................PRIGMRL.RGTV..SLCGPDHVGLIMERTWNCS..I.P.R.W.G.........................I..DE......................NvWEFVP...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..-G.V..REWG..........................................................QEGEEGVDNGWWKTRMSGDPLGA...EKK..SVDFT..VVG...................MTIANQMLSLTGSLL........................................................................................................................................................................................................................
N4V489_COLOR/296-419                  .........................PRRGAWM.EGVI..NLENEGHIGVVCWGKFNAS..I.E.S.A.R.........................L..PT......................D.WRWVH...........................................................................................................................----ADSE.eAAN..YVDD.P..F....EQ.AE..GA.D..A...DA..QA.A..ETEH..........................................................GAVRQIHTTGFWVDGNSDKVKGR..vRFR..IKAFD..V-G...................ISGDHGYLSIEGTML........................................................................................................................................................................................................................
A0A091JWD7_EGRGA/41-249               .........................PKKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................V.VQWQGlglkigdelkfqvlhldsdaagvffirggltkssmqpkqsetvtdg..............................tngdeiqkldhqengfndsggdniteeplcetdntgrenadeqsadaV-------..---..-NGV.C..D....DK.NK..KK.K..K...KK..KH.K..QEEQ.........................................................eHVLPTSDSSG-------------...---..-----..---...................---------------yqsdhkkskkkkrkhcdeveenelsqlsqepkakkkrd..................................................................................................................................................................................
A0A2I4CNJ4_9TELE/140-364              .........................PKAGQKL.LGKV..NKLGLSHVGCLVHGCFNAS..I.P.R.P.N.........................L..VS......................V.ETWRDagprigtelefrvkaldadaagvllirgqldrtrvqellalsessesglp......................aaqpepqeaeptpeppddtpkkxkkkkkekekvkdeeieeeitgiplsqlnG-------..---..----.-..-....--.--..--.-..-...-T..TD.E..TSGS..........................................................ERKKKKKKKDKYLKEEEQEMEIS...---..-----..---...................---------------qvedtasnssssekprrkrkhesgtdpsvsedqtptkskkkrkveteq........................................................................................................................................................................
A0A1G4B716_9PEZI/293-416              .........................PRRGAWM.EGSI..NLENEGHVGVVCWGKFNAS..I.E.S.A.R.........................L..PP......................E.WRWVH...........................................................................................................................----AGSA.eAAS..YVAD.P..F....DE.SN..KN.D..D...DD..KT.A..EDEH..........................................................GAVRQIHTTGFWVDGAGDKVKGR..vRFR..IKAFD..V-G...................VSGDHGYLSLEGTML........................................................................................................................................................................................................................
A0A0E0IEF6_ORYNI/81-232               .........................PQPDMIL.EGKV..ELLGKESIHAIVLGVFSAA..I.M.A.D.D.........................I..NE......................K.FKFKRkgdggkfisrsdrhhvirkgsmirvdtemnchitgs...................................................llpphtgsmpwlsthdaeyaseissgtrrpsnvgikI-------..---..----.-..-....--.--..--.K..N...EQ..DH.K..TSDN..........................................................EDSA-------------------...---..-----..---...................---------------rqnslkfwkrqngksnnyfc....................................................................................................................................................................................................
A0A218YU00_9HELO/160-263              .........................PEKGAWL.EGFV..NLQNEGHLGLVCWNLFNAS..I.E.R.K.R.........................L..PS......................D.WEWRD...........................................................................................................................--------..---..----.-..-....--.--..--.V..S...DA..RE.G..NEGD..........................................................GQTYAEEGAGHYVDGEGNKVEGL..iKFK..VREIE..S-S...................HDRERGFLSIEGTLL........................................................................................................................................................................................................................
A0A2B7WPC1_9EURO/230-376              .........................PERGQEL.EACI..NVQSDGFLGAVVYNLFSVG..I.E.R.R.R.........................L..PQ......................D.WEWVApgqes.................................................................................................................etdaaK-------..---..----.-..-....SS.EG..DD.E..I...MD..SD.F..DSDTehfrplpasatn..................................dpsndtqtstdpYASLEDSASGYFRTRSGKRVRGM..iRFR..VRDVD..VIP..................gAEHDKGFMSIEGTML........................................................................................................................................................................................................................
A0A1E4RLK2_9ASCO/134-234              .........................PQLGDVL.EGYI..YMQTASHIGLLLHDTFNAS..I.K.K.Y.N.........................M..PN......................D.WSFIP...........................................................................................................................--------..---..----.-..-....--.--..-S.Q..A...DE..YA.V..EDEE..........................................................ASNNRFKSFGYWVDENEVKIEGK...---..-LNFT..IKA...................IHTTGRVVSVEGTL-i.......................................................................................................................................................................................................................
A0A3Q4GQ09_NEOBR/141-365              .........................PQKGQKL.RGKV..NKLGISHVGCLVHGCFNAS..I.P.R.P.N.........................L..VT......................V.ETWRDagprigsevefdvtaldadtagvllirgrldktrvqellamcegtetsvpa.....................geedpeptqdtseetpkkkkkkvkeeeieeeiptisacqldngvtpepngmRDEVNGNE.aAEN..KKKK.K..K....KK.EK..RI.K..E...EE..EE.I..DVSQ..........................................................VAVHGSDSSGYISDKSSKKRKRE...---..-----..---...................---------------sgndvtssfsedpdpvkpkkk...................................................................................................................................................................................................
A0A091CR13_FUKDA/125-326              .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.K.P.E........................qM..SV......................E.-QWNTvevnvgdelefevfrldsdaagvfcirgklnisslqskcfeiseevtetvteea..............vekiakkkkkkkkapeiddldvsvteladlvdmtpkeeddlqisnnvndpweegpK-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------kkkkkkkkdqeyqdqdpvfqgsdssgyqsdhkkkkkkrkhseeveltp........................................................................................................................................................................
A0A2S4UK29_9BASI/170-298              .........................PTIGHKL.IGRP..TLSSPSHLSLVIYRTFNAS..I.N.E.N.H.........................L..KA......................A.-GFHY...........................................................................................................................-----DIN..FEV..PAHW.K..S....IG.EL..SN.N..N...NT..NK.D..QEPS..........................................................LSDLDHKERGCWVDANGVVIGGD...-EG..TVSFH..MG-...................---------------sllddpftieepvqvraetkmaiht...............................................................................................................................................................................................
A0A2D3UVN0_9PEZI/117-195              .........................PEKGTVL.EGAV..NVVNEGMVGLICYNYFNVA..V.P.R.E.Q.........................L..PK......................G.LMWDGegwl...................................................................................................................ageeR-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------vevgrkvkakvldfeasgteglsisa..............................................................................................................................................................................................
A0A1S7HK16_9SACH/126-231              .........................PQVGDII.EGWI..FIQSASHIGLLIYDAFNAS..I.K.K.N.N.........................I..PA......................D.WTFVD...........................................................................................................................--------..---..----.-..-....KQ.SE..EE.P..S...RD..PN.E..TNEE..........................................................SQGFAYRSLGYWVDADGERIDGK...---..-IKFT..VKS...................VYTTGKVVSVEGTLL........................................................................................................................................................................................................................
A0A4T0FMP4_9BASI/105-200              .........................PTIGQRM.RGKV..TLCSPDHISLLVHHTFNVT..I.P.R.E.Y.........................I..DR......................Q.-TFKY...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..ASDS..........................................................ATDSSGSGGGRWIHTSSTQVLAE...LNR..EVDFT..VME...................RNTANGMLTLTGSIL........................................................................................................................................................................................................................
G0RUR9_HYPJQ/258-371                  .........................PSRGAWM.EGTI..NLQTEGHIGVVCFGQFNAS..I.E.A.R.R.........................L..PS......................S.WKWVS...........................................................................................................................--------..---..--NE.D..P....EA.HG..ME.E..T...AS..VI.T..SDDH..........................................................GVVRQIHSTGFWVDADGNKVKGK..iRFR..IRNFD..V-G...................VSGETSYLSLEGTML........................................................................................................................................................................................................................
A0A1C7N729_9FUNG/129-246              .........................PKRGSKL.VGRI..NLQSEDHIGLLIYGTFNAS..I.P.K.S.R.........................I..PS......................S.-VYEW...........................................................................................................................-------K..VNE..EEEP.V..E....IK.EE..KD.E..S...EQ..DD.E..AEAA..........................................................PEERTRTQYGEWINKSTGASIGG...EDG..ILEFS..VVD...................IIEANDILTVTGSL-........................................................................................................................................................................................................................
A0A0E0L8D4_ORYPU/182-330              .........................PKPDMML.EGKV..EMLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..HE......................K.FKFKRkkyggkfvsrldkqhvikkgsmirfsvkrvdae.........................................................mnchvtgslipphtgsmlwlsvhdaeyvleinsGKRSRDIK.iKTE..QHEQ.D..H....SV.KN..SE.R..Q...HK..SK.S..RKR-..........................................................-----------------------...---..-----..---...................---------------sfeer...................................................................................................................................................................................................................
A0A4Y9YU24_9APHY/128-243              .........................PQIGMKL.VGKV..NLCSPDHVALLVHRTFNVS..I.P.R.H.H.........................I..PT......................D.-QWEF...........................................................................................................................--------..--E..YGPA.E..N....DP.EF..GA.E..P...AQ..DA.I..NDTN..........................................................GGAASMDSGGRWVHSTTMSKLGE...EDG..FIEFT..VVG...................LTIANQMLSLVGSI-q.......................................................................................................................................................................................................................
C1EFU4_MICCC/97-144                   .........................PKPGRKL.LGVV..NKVGADFVGMLVMGVFNAS..V.S.A.A.D.........................I..SD......................E.F----...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------ihnpidas................................................................................................................................................................................................................
A0A093QZR2_PHACA/41-248               .........................PKKGKKL.KGII..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................I.VQWQElglkigdelkfqvlhldsdaagvffirggltkssmqprqsetitdstnggei..................qkldhqengfndsggnnvteepqgemdnaggenaeeqsvdavngvcddknkkkK-------..---..----.-..-....--.--..--.K..K...KK..HK.Q..EE--..........................................................-----------------------...---..-----..---...................---------------qehvlptsdssgyqsdhkkskkkkrkhsdeteeselsqpsqkpkakkkr.......................................................................................................................................................................
A0A670JJ00_PODMU/120-290              .........................PKEGKKL.VGTI..NKMAPSHIGCLVHGCFNAS..I.P.KpD.H.........................M..ST......................D.-EWKDlgfqignrlifkvlcfdsdaag...............................................................................vfcikgklcrksigeefkgkhkG-------..-KH..EKPH.D..V....QN.GT..EE.M..E...MD..IA.T..AGVE..........................................................EMRNNGGDNGMF-----------...---..-----..---...................---------------dtsdrgngqhradlgvhasdssgyhsdhskskkkkrklgeeeggl...........................................................................................................................................................................
C4R5C2_KOMPG/122-227                  .........................PQVGDVV.EGWA..YLQTQSHIGLLVHDTFNAT..L.R.N.S.N.........................I..PS......................N.WRFIP...........................................................................................................................--------..---..----.-..-....HE.AD..EV.D..E...DY..EE.D..GVGE..........................................................NGAEKFRSLGYWVDQDNNPVDGK...---..-IKFT..IKS...................IHTAGRVVSLEGTLL........................................................................................................................................................................................................................
A0A0D2F455_9EURO/236-370              .........................PETGDDL.YGWT..NVTSEGFVGLVSYNYFQTA..V.E.K.S.R.........................I..PA......................A.WKWNG...........................................................................................................................PTKEETTK..NKK..KGKK.G..K....LR.DE..VD.H..R...QD..SE.G..PEDGdtv....................................................aapYQTRIQDDSGYFADASGSKMPST..lEFR..VVDTE..VVP..................aHDRTKWSLQIDGTLL........................................................................................................................................................................................................................
A0A2U3YQH2_LEPWE/107-316              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................E.-QWQNltinvgdelefevfrldsdaagvfcirgk................................................................lnttslqtkcsavseevtetgteeiiekplKKKKKKKK..KDP..ESYE.V..E....SD.NR..EL.A..D...CA..DA.T..MKKE..........................................................TDLQIDNVNGLWKAEPKKKKRHQ...---..-----..---...................---------------edqdqdpvfqgsdssgyqsdhkkkkkkrkhseeaeftpllehspkrkgks......................................................................................................................................................................
A0A0D2IPB3_9EURO/238-375              .........................PQRGDEL.YGWT..NVASEGFVGLVSYNYFQTA..V.G.K.P.R.........................I..PA......................D.WNWHGptk....................................................................................................................eqagKNKKKAKK.gRLR..DGDGvS..Q....AR.EE..DT.Q..E...EP..QS.G..DLSS..........................................................FHVPIGDDVGFFADSTGSKISET..lKFR..VVDTE..MVP..................aHDRHKWALQIDGTLL........................................................................................................................................................................................................................
A0A2B7Y6P4_9EURO/1-141                .........................-------.----..-MQSEGLLGAVVYNLFSVG..I.E.K.R.R.........................L..PL......................N.WKWIA...........................................................................................................................PGQETSSG..VTS..SSTS.P..-....--.--..TC.E..D...SD..FD.S..DRENfrpvppatttslhl.............................glgstsdgtpatnpaEEDDISAGSGFFQTPSGRRVRGV..iRFG..VRDVD..VIP..................gSEREKGFISIEGTML........................................................................................................................................................................................................................
A0A7H9B3V2_ZYGMR/128-244              .........................PQIDDVI.EGWI..FIQSASHIGLLIHDAFNAS..I.K.K.N.Y.........................I..PS......................D.WTFID...........................................................................................................................------NE..VQA..DQDQ.D..E....SG.SN..SR.E..S...ND..AD.N..ANNY..........................................................DSGFRTRSLGYWVDSNGERVDGK...---..-LKFH..VRA...................IHTTGRVISIEGALL........................................................................................................................................................................................................................
A0A0A0A2F3_CHAVO/41-243               .........................PKKGKKL.VGII..NKVAPSHIGCLIHGCFNAS..I.P.K.P.E.........................Q..MS......................I.MQWQElglkigdelkfqvlhldsdaagvffirggltkssmrpkqsetvtdstng........................deiqkfdhqenglndsggdnvtehplgetdntgrenaeeqsvdavnglcdD-------..---..----.-..-....--.KK..KK.K..K...KK..KH.K..QEQE..........................................................-----------------------...---..-----..---...................---------------hvlpasdssgyqsdhkkskkkkrkhcddiketelsqlsqepkak............................................................................................................................................................................
A0A2T9ZK83_9FUNG/187-307              .........................PKRGLTL.EGMI..NIQSPGHIGILLYDTFNVT..I.P.K.A.N.........................I..PS......................GlYEWVEfet.....................................................................................................................pgiEQEDTTEQ.dEEEilDASP.E..N....DA.SK..QA.E..P...KA..TQ.G..NKSY..........................................................AKTQTITQTGQWVDKLTRKAIGN...-NG..YLEFK..V--...................---------------te......................................................................................................................................................................................................................
A0A5Q4BBY1_9PEZI/290-415              .........................PRRGAWM.EGSI..NLENEGHTGVVCWGKFNAS..I.E.S.A.R.........................L..PP......................E.WRWVH...........................................................................................................................--AGSAEA.aSYV..ADPF.D..N....DN.DD..ND.N..A...SA..RA.V..EDEH..........................................................GAVRQIHTTGFWVDGAGDKVKGR..vRFR..IKAFD..V-G...................VSGDHGYLSLEGTML........................................................................................................................................................................................................................
M2S3C6_COCSN/119-223                  .........................PVQNAYL.QAHI..TDHAKTHITLAHLNTFPVS..I.L.K.E.N.........................M..PA......................D.WSWHQ...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...NE..SG.K..VKKG..........................................................WDDKLSDEGGWWANGKGKKVEGElrvRIR..NIDGR..MDG...................KGKGKGFLRVDGSLL........................................................................................................................................................................................................................
A0A4T0I0U4_WALIC/105-198              .........................PTIGQRM.RGKV..TLCSPDHISLLVHHTFNVT..I.P.R.E.F.........................I..DC......................Q.-TFKY...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..--AN..........................................................DSATENSGGGRWLHTSSTQVLAE...QGR..DVDFS..VIE...................RNTTNGMLTLTGSIL........................................................................................................................................................................................................................
A0A0N0RSD7_9BASI/95-196               .........................PQIGMVL.RGTI..TLSSPSHVSLLLYDTFNAA..I.S.A.P.H.........................L..PA......................S.-DWEF...........................................................................................................................--------..---..----.-..-....--.--..--.-..V...YY..TD.V..GEAQ..........................................................RRDAKDRSVGLWRHKQSGERLGG...DDG..SLAFT..VIS...................MTVANQMLSLHGSLL........................................................................................................................................................................................................................
A0A1R1X335_9FUNG/357-445              .................dekgegse-------.----..-------------------..-.-.-.-.-.........................-..--......................-.-----...........................................................................................................................-EKEEGSE..EKT..EESE.E..K....AE.GS..EE.K..G...AT..AT.D..GENH..........................................................SKMRSIKHTGQWVNILTNEPVGS...-EG..YIDFI..VSD...................VYRVNDVIGISGLM-a.......................................................................................................................................................................................................................
A0A0C9YL47_9AGAM/125-165              .........................PRIGTKL.VGKI..NLYSPDHISVLVHRTFNVS..I.P.R.H.H.........................I..PQ......................D.-QW--...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------........................................................................................................................................................................................................................
A0A671Q068_9TELE/128-338              .........................PKKGSKL.VGVI..NKMGVGHVGCLVHGCFNAS..V.V.K.P.S.........................L..LS......................S.EQWRDcglcvgqslefevfqldadaag...............................................................................vllirgrlekcrvqelvaqteqK-------..--E..TTVE.S..A....TE.PE..ST.E..D...TI..DS.P..KPKK..........................................................KKKKDKREKESLNDSSLEQTSEN...QQT..AADTT..EID...................SSA------------nrhhkekkkkkdkrqeadeispsepptsdssgyvsdkssrtraaesddglqhlpaakkkkk...........................................................................................................................................................
A0A1X2G8W2_9FUNG/11-82                ..............risekyewlaf-------.----..-------------------..-.-.-.-.-.........................-..--......................-.-----...........................................................................................................................--------..---..----.-..-....--.--..EN.H..E...ED..EE.E..QSED..........................................................QETRNKSQNGESVSKSSGARIGG...DDG..SLEFI..VVD...................NTEVNDILTVTGSL-........................................................................................................................................................................................................................
A0A0E0DXM9_9ORYZ/81-229               .........................PKPDMML.EGKV..EMLGKESIHAIVLGVFSAA..I.M.S.D.D.........................I..HE......................K.FKFKRkkyggkfasrsdkqhvikkgsmirfsvkrvdae.........................................................mnchvtgslipphtgsmlwlsvhddeyaleinsRKRSRDIK.iKTE..Q---.-..-....--.--..--.H..E...QD..HS.A..KSSG..........................................................RKHKSKS----------------...---..-----..---...................---------------rkrsfeer................................................................................................................................................................................................................
G3XUY5_ASPNA/174-343                  .........................PQRGQIL.EGWV..NVQSEGFLGAIVLNLFSVG..I.E.R.K.R.........................L..PP......................S.WKWIP...........................................................................................................................PGEELEEE..QQE..QGQQ.A..S....TT.EN..EG.D..D...SD..SS.N..SETKksafdpakelfrpialaedv.................npladtdpaststnnnatgdyDDDETAAAEGYFQSVSGHRVRGT..iKFR..VVDVD..VIP..................gSERESGFLSIEGTML........................................................................................................................................................................................................................
A0A2G5B8G2_COERN/128-271              .........................PLSGMAL.QGAI..NVQSPDHIGLLLWDTFNAS..I.P.A.S.L.........................I..PK......................D.-KYEWrpfsdeeva.........................................................................................................aralrngtiINNAADDQ.eDIV..DDDS.E..S....VT.TS..KA.Q..S...GD..GN.V..FNAP..........................................................GAPDARFGSGEWVLKGTSQSVGS...-NG..SLSFV..VVD...................VIRADDVLSVTGAL-r.......................................................................................................................................................................................................................
A0A2N5TP43_9BASI/155-269              .........................PTIGQKL.IGRP..TLSSPSHLSLVIYRTFNAS..I.N.E.H.H.........................L..KA......................A.-GYHY...........................................................................................................................--------..--D..LNFE.V..P....DH.WK..SI.G..E...TT..HP.Q..DTAV..........................................................HLVPENKDRGCWVDANGVVVGGQ...-EG..TISFT..VMG...................LTIANHMISVMGSLL........................................................................................................................................................................................................................
A0A6P8BLX0_MAGGR/328-468              .........................PRRGAWM.EGVV..NLQSEGHLGVVCWNRFNAS..I.E.A.N.R.........................V..PK......................G.WRFIDvvqkae..............................................................................................................dakkakfRNAGKKTN.lEGA..GGEG.E..E....EV.EA..VE.E..A...GE..DD.Q..EDLE..........................................................ASLQQMHATGYWVDAAGKRIAGK..lRFR..IKNFD..V-G...................TAGDHGYISIEGTML........................................................................................................................................................................................................................
A0A2H3J099_9EURO/175-345              .........................PQKGQVL.EGWV..NVQSEGFVGAIAHNLFSVG..I.E.R.K.R.........................V..PK......................S.WKWIP..........................................................................................................................pGADDENVD.aASD..KKKG.Y..V....SA.TS..GD.E..D...GA..AG.S..NKLSfdaekehftplpkkvsrqpi..................nlldsdtnmlveefgeyddeEDDDSSNATGYFQSVSGHRVRGT..iRFR..VRDVD..VIP..................gADPDRGFLSIEGTML........................................................................................................................................................................................................................
H3DK84_TETNG/121-322                  .........................PQKGQKL.LGKV..NKLGVSHVGCLVHGCFNAS..I.P.K.P.N.........................L.vPM......................E.-TWRDagprigadlefevttldadavgvl...........................................................................lirgrldrtrlqtsesstapdqlqPDTEENGD.lNPD..STDE.S..A....VK.DE..EQ.E..E...EV..TD.P..ASVQldaga................................................adlneT----------------------...---..-----..---...................---------------vdgeqgsggkkkrkkdkrlkqeeveqevpisavevhgsdssgyqsdkpskkrtrepaadvtsag........................................................................................................................................................
A0A397JR54_9GLOM/105-208              ........................s--IGCKM.VGKV..VRQSPLHISLLLYDSFNVK..I.N.R.Q.C.........................I..PD......................D.-IFEW...........................................................................................................................--------..---..----.-..-....--.RD..ND.S..L...YT..SI.F..VGNQ..........................................................LELDKLYLEGQWHDKRTGGEITG...--C..LIEFE..STG...................SEIDDGVIFVLGSLQ........................................................................................................................................................................................................................
A0A316Z3H8_9BASI/149-307              .........................PTVGMRV.EGTI..TLSTPSHVSLLLHGTFNAS..I.S.A.A.H.........................M..PSaqaahepss...sfqrpnagaaE.WEFVEdeeaaa...............................................................................................................edaarrRVLEGGSA.sEQS..SVKE.E..A....AD.AD..EE.E..E...ED..KA.D..AEPE..........................................................SKADVERSEGYWKRKSDGQRLGG...ADG..RVAFT..IIG...................MTIANHQLSLHGSLL........................................................................................................................................................................................................................
A0A395T3D3_9HYPO/266-379              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................D.WKWVP...........................................................................................................................--------..---..--NE.S..P....DA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWADGNGEKVKGK..iRFR..IRNFD..V-G...................TSGEISYLSLEGTML........................................................................................................................................................................................................................
A0A0W0FVS3_9AGAR/121-237              .........................PRVGMKL.EGKI..NLCSPDHISLLVHKTFNVS..I.P.R.H.H.........................I..PT......................D.-SYVF...........................................................................................................................--------..-EY..GPAE.N..D....PE.YG..AG.A..Q...DI..EG.E..AGKT..........................................................EESGGGGGGGRWIHHLTSSTLGA...PDG..TLEFT..VIG...................LTIANEMLSLLGSLQ........................................................................................................................................................................................................................
A0A319CNB8_9EURO/189-369              .........................PQRGQLL.EGWV..NVQSEGFLGAIALNLFSVG..I.E.R.K.R.........................L..PS......................N.WKWIPpgdehedett.......................................................................................................titttttttaK-NTPNDE.tNPS..TTTS.D..D....SD.SD..SS.E..S...ET..KS.-..---Kfdpelehfspvtlasdan......................plnpsnsnpdisthdptsNDDDDDGVEGYFQSVSGHRVRGT..iKFR..VVDID..VIP..................gSERDRGFISIEGTML........................................................................................................................................................................................................................
A0A0D2CV49_9EURO/245-382              .........................PERGDEL.YGWT..NVTSEGFVGLVSYNYFQAA..I.G.K.A.R.........................I..PA......................E.WKWNGpsre...................................................................................................................qlqkTKKGRKGR.lRDE..SGLD.D..G....EE.HG..TQ.E..T...AT..TV.V..EAPS..........................................................SQSLLADDGGHFTDASGTKIQST..lKFR..VADTE..IVP..................aHDRHKWSLQIDGTLL........................................................................................................................................................................................................................
A0A5J5EVC8_9PEZI/177-276              .........................PHKGMVL.QGYV..NLQSASHIGLLVDNTWNVS..I.P.L.A.R.........................I..PE......................G.WKYTE...........................................................................................................................--------..---..----.-..-....--.--..--.S..D...GA..EE.M..EVDE..........................................................AEETAATAEGSWVNEKGEKVEGQ...---..-LKFE..VES...................VKAGGSIFIMEGSLL........................................................................................................................................................................................................................
A0A319CYI5_9EURO/181-343              .........................PQRGQIL.EGWV..NVQSEGFLGAVVMNLFSVG..I.E.R.K.R.........................L..PS......................S.WKWVPpgeel................................................................................................................egggsgGSDQG-SS..QKQ..EPQT.S..D....SD.SE..GQ.D..N...T-..--.-..---Kafdpekelfnpqala...........................adanpladadpelqgeEEGEDAAAEGYFQSVSGHRVRGT..vKFR..VVDVD..VIP..................gSERDRGFMSIEGTML........................................................................................................................................................................................................................
A0A673IQD1_9TELE/132-340              .........................PKKGSKL.VGVI..NKMGVGHVGCLVHGCFNGS..V.V.K.P.S.........................L..LS......................S.EQWRDcglcvgqslefevfqldadaagvllirgrlek...........................................................crvqelvaqaeqkettvesatepestedtidsP-------..---..----.-..-....--.--..--.-..-...--..--.K..PKKK..........................................................KKKKDKREKESLNDSSLEQTSEN...QQT..AADTT..EID...................S--------------sanghhkekkkkkkdkrqeadeispselptsdssgyvsdktsrtraaesddglqhapaak............................................................................................................................................................
A0A1C7M1Q4_GRIFR/143-258              .........................PQVGMKL.VGRV..NLCSPDHVSLLVHRTFNVS..I.P.R.Y.H.........................I..PA......................D.-DWEF...........................................................................................................................--------..--E..YGPA.E..N....DP.EF..GP.E..A...AE..ET.D..VAEK..........................................................KEEEHVEGGGSWVHKLSGLKLGG...LNG..FLEFT..VVG...................LTIANQMLSLVGSI-q.......................................................................................................................................................................................................................
M3YR84_MUSPF/125-355                  .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.H.........................M..PA......................E.-QWQNleinvgdelefevfrldsdaagvfcirgklnitslqtkcsgvseeitetgpe..................eitekplkkkkkkkkdpesyevesgnreladyadatmnketdlqidndlwkdaPKKKKKKK..HQE..DQDQ.D..P....VF.QG..SD.S..S...GY..QS.D..HKKK..........................................................KKKRKHSEEAEFTPLLEHSPKKK...---..-----..---...................---------------reklyankldnleemgtfleiskkl...............................................................................................................................................................................................
A0A2T4GV40_FUSCU/273-377              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................D.WKWGF...........................................................................................................................--------..---..----.-..-....--.--..-E.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWADGSGDKVKGK..iRFR..IRNFD..V-G...................TSGEISYLSLEGTML........................................................................................................................................................................................................................
A0A094C1U4_9PEZI/164-261              .........................PTRGGWL.EGYV..NLQNEGHLGIVCWNLFNAS..I.E.R.Q.R.........................L..PK......................D.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.A..EDME..........................................................GDGYAEDGVGYYVDGAGTKIEGI..vKFR..VKDIE..-SS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A3N2PSJ8_9PEZI/292-411              .........................PKRGAWM.EGSI..NLQSEGHVGVVCWGKFNAS..I.E.S.A.R.........................L..PP......................E.WRWVH...........................................................................................................................----LGSD.eAN-..---E.A..G....NN.NM..DD.S..V...SN..YT.A..EEQH..........................................................GAVRQIHATGYWVDGTGSKVKGR..vRFR..IKSFD..V-G...................ITGDHGYLSLEGTML........................................................................................................................................................................................................................
A0A2N3N057_9PEZI/364-472              .........................PKRGSWL.EGEL..ILQNQGHVGVVCWGKFNAS..I.E.A.S.R.........................L..PP......................K.WYWVA...........................................................................................................................--------..---..----.-..-....-A.PE..ED.S..D...VN..ME.F..DADG..........................................................EEHHSATILGHWVDERGNRIHGN..lHFR..INNYD..-VG...................LSGDHSFLCIEGTML........................................................................................................................................................................................................................
A0A5N5KKH0_PANHP/141-373              .........................PKKGETL.VGVI..NKIGVGHVGCLVHGCFNAS..VvK.P.A.Q.........................L.tPE......................Q.--WRDsglklgsslkfevfqldadvagvllirgrle.............................................................ksrvqeliasfssteteqdetvevatepdsvT-------..---..---T.E..D....PS.ES..SD.A..S...KP..KK.K..KKKK..........................................................DKERDKQAVEEVNSNQTDEAV--...---..-----..---...................---------------thdvngnrmevdsdpssrpkektkkkkkdkkqesdaelpspsadlpgsdssgyisdksskkrkaqedellqedsdilpakkkkkm...................................................................................................................................
A0A094ASU3_9PEZI/66-163               .........................PTRGGWL.EGYV..NLQNEGHLGIVCWNLFNAS..I.E.R.Q.R.........................L..PK......................D.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.T..EDLE..........................................................GDGYAEDGVGYYVDGAGTKIEGI..vKFR..VKDIE..-SS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A4S8M006_DENBC/125-235              .........................PHVGMKL.VGKI..NLCSPDHISLLVHKTFNVS..I.P.R.H.H.........................I..PV......................D.-QWEF...........................................................................................................................--------..---..----.E..Y....GA.AE..ND.P..E...YG..AA.A..QQES..........................................................DHKTDEEGIGRWIHKLTAEPLGG...SSS..YLEFT..VIG...................LTVANEMLSLLGSI-q.......................................................................................................................................................................................................................
A0A1A6HI69_NEOLE/1-193                .........................-------.-GTV..NKVSSSHIGCLVHGCFNAS..I.P.K.P.E........................qM..SY......................E.-EWQTleinvgdelqfdvfrldsdsagvfcirgklnatslqlkssvvsediaetgieev...............aekiskkkkkkkdtetyaavdgvtelancadvtpkegtdllcgdsvndlceeepK-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------kkkkkkkrdqedqdpvfqasdssgyqsdhkkkkkkrkhsedidsaspk........................................................................................................................................................................
A0A5E8BZM6_9ASCO/159-303              .........................PQQGDVV.QGVI..NLQAPSHLSLLVNDVFHAS..I.R.R.D.S.........................I..PE......................D.WEFVYfeadetyydand...................................................................................................etanavdaavdsI--EKEQE..QKN..QAKD.G..A....ET.GE..ES.A..D...SK..EK.A..SDAN..........................................................KLAGASKSLGYWVDGNGDKVYEV...---..-VNFS..IKR...................VLVSGRLISVQGTL-r.......................................................................................................................................................................................................................
A0A4D9EHU7_9SAUR/114-320              .........................PKKGKKL.VGVI..NKVAPSHIGCLIHGCFNAS..I.P.K.P.D.........................R..MS......................A.IEWQDlglkigdklefevghldsdaagvffirg...................................................................rlnkdsmqskypeavtedtnsrdeipkkK----HKK..RDR..RNCE.L..E....ND.TK..LT.D..N...AD..TT.V..VEDA..........................................................EEQNADTVNGFY-----------...---..-----..---...................---------------dkkpkkkkkkhkqekqkpvfyesdcsgypsdhkkvkrkkrehcdvdeeselsqlsqepkakkrke.......................................................................................................................................................
A0A1X6NBS3_9APHY/138-257              .........................PQAGMKL.VGKV..KLCSPDHVALLVHRTFNVS..I.P.R.H.H.........................I..PT......................E.-QWEF...........................................................................................................................-------E.yGPA..ENDP.E..F....GT.DT..AA.E..E...ME..MQ.L..DPES..........................................................AADTGLEGTGRWVHKLTGTKLGS...SDG..YLEFT..VVG...................LTIANQMLSLVGSI-q.......................................................................................................................................................................................................................
A0A3N4K1V2_9PEZI/155-253              .........................PLKGMVL.KGWV..NMAGASHVGLLVENTWNVA..I.P.R.E.R.........................I..PE......................G.WRWGE...........................................................................................................................--------..---..----.-..-....--.--..--.-..G...EG..EG.E..GEGE..........................................................GGASAGVDGGYWTDGDGNKVEGF...---..-REFK..VEA...................VKAMGHMVSMEGSLL........................................................................................................................................................................................................................
A0A1B9IVJ8_9TREE/125-240              .........................PKIGQKL.YGTH..SLSSPSHLSLLFNKTFNVS..I.P.L.Q.H.........................I..PT......................D.-LYEF...........................................................................................................................--------..--E..HTDE.T..A....DA.DS..DS.E..D...EE..EE.G..FILG..........................................................MGNGVVEDVGRWKVKETGKSLGE...GGK..GIKFT..VIG...................MQVTNQMLSLTGSLL........................................................................................................................................................................................................................
A0A2H3DKL6_ARMGA/126-244              .........................PHVGMRL.EGRI..NLCSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..PS......................E.-DWEF...........................................................................................................................---EY---..GPA..END-.P..Q....FG.PD..AA.E..K...DG..EE.A..VSPP..........................................................AERSGGEEGGRWIHKLTGDLIGG...KSG..HLEFT..VIG...................LTVANEMLSVVGSI-q.......................................................................................................................................................................................................................
G1KLH7_ANOCA/124-188                  .........................PLAGKKL.VGII..NKVAPSHIGCLVHGCFNAS..I.P.KpD.H.........................L..SI......................D.-EWKN...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------fgfqigntlmfkvshfdsdaa...................................................................................................................................................................................................
A0A395RK70_FUSSP/272-385              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................D.WKWVP...........................................................................................................................--------..---..--NE.S..P....EA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWADGSGEKIKGK..iRFR..IRNFD..V-G...................TSGEISYLSLEGTML........................................................................................................................................................................................................................
A0A507C0U1_9FUNG/130-177              .....................pplr----SNI.VGIV..NKVSPDHIGCLVCGIFNAS..I.P.S.D.A.........................M.rRD......................E.MSWS-...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------deqc....................................................................................................................................................................................................................
A0A2T7PJ08_POMCA/97-131               .........................PRVGSRL.RGCV..NKTSKAHVGILVHNFFNAS..V.A.H.-.-.........................-..--......................-.-----...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------dq......................................................................................................................................................................................................................
A0A1L9RHL8_ASPWE/178-333              .........................PQRGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PT......................S.WKWVP...........................................................................................................................PGEEGESG.aTDD..SGDK.Q..K....NS.ED..DE.D..S...EA..SP.F..FNPEkehfkpvalasda................................nplsetidqelagGEDDDAAAEGYFQSVSGHRVRGT..vKFR..VVDID..VIP..................gTERERGFMSIEGTML........................................................................................................................................................................................................................
A0A370TTU5_9HELO/185-291              .........................PENGIWL.EGYV..NFQNEGHIGIVCWNMFNAS..I.E.R.K.R.........................L..PE......................D.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..-V.E..D...ME..NG.E..HTEE..........................................................VSEKYSDWAGYYVDGSGTKIEGV..vKFR..VKDVD..MSH..................dRDKERGFLSIEGTML........................................................................................................................................................................................................................
A0A6P9AJ58_PANGU/132-321              .........................PKPGKKL.VGII..NKVAPSHIGCLVHECFNAS..I.P.KpD.H.........................I..SI......................E.-EWKNfgfqigirlvfkvlhfdsdaagvfcirgklcknslgeemlkekc..................................kkkyekhcdvhigseemevdissvgledremhngddeddhgiydkPETENGQD.gAEV..GMHA.S..D....SS.GY..HS.D..H...GK..SK.K..KKRK..........................................................LF---------------------...---..-----..---...................---------------eeenghtgllkskakkkrke....................................................................................................................................................................................................
A0A553P5A8_9TELE/144-313              .........................PESGSKL.VGVV..NKLAVGHVGCLVHGCFNAS..V.V.KpS.G.........................L.sPE......................Q.WRNSGfsighnlefevfkvrqlmgqve..............................................................................eqqetveassetetkeggevpeeC-------..---..----.-..-....--.--..--.-..-...--..--.-..---Lempemncnshkhhkek..........................kkkkkdkrreseevsiSEMHTSDSSG-------------...---..-----..---...................---------------ymsdktlrkramedenssetppakkkkkskrsasp.....................................................................................................................................................................................
S9Y1P5_CAMFR/92-302                   ...................prvgts-------.QGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M.aPE......................Q.WQTLEinvgdelefevfrldsdaagvfcirgklsitclqtkrcavseevtgtgteea..................vekppkkkkkkkkdpepyeveggtteladfadvtmketdmqmnnnvnglleekPKKKKKKK.kHQE..DQDQ.D..P....LF.QG..SD.S..S...GY..QS.D..RKKK..........................................................KKKRKHSEEAEFT----------...---..-----..---...................---------------pllehvpkkkrek...........................................................................................................................................................................................................
A0A6J0ZEG4_ODOVR/121-260              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHKCFNAS..I.P.KpE.Q.........................M..PA......................D.-QWQTlqinvgdelefevfrldsdaagvf..........................................................................cirgklsmaslqtkcsavpekapetG---ADEP.vEKP..PKKK.K..K....KK.K-..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------dlepceaegsttepaefadvtmkdetdlq...........................................................................................................................................................................................
E9DHM3_COCPS/186-319                  .........................PERGQTL.EGWI..NVQSEGFLGAVVLNLFSVG..I.E.R.K.R.........................L..PP......................D.WKWVApg.......................................................................................................................qqPESTPTTT.qDED..DSDT.N..S....DT.EI..FR.P..L...KG..DK.H..IPDE..........................................................HDDEASAAMGYFQTRSGKRVRGM..iKFR..VRDVD..VIP..................gSEWDKGFLSLEGTML........................................................................................................................................................................................................................
A0A0B2WLQ9_METAS/299-412              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..V.E.A.R.R.........................L..PP......................A.WKWVS...........................................................................................................................--------..---..--NE.S..P....EA.HG..FE.E..T...AS..VM.T..ADDH..........................................................GVVRQIHSTGFWVDGSGDRVKGK..iRFR..IRNFD..A-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
A0A4Y7QGW8_9AGAM/138-269              .........................PRVGMKL.NGKI..NLCSPDHISLLVHKTFNVS..I.P.R.H.H.........................I..PT......................E.-NWEFeygp...................................................................................................................aendP---EFGA.gAGG..EEAS.T..R....SE.ID..AL.P..D...AD..SM.N..VDGG..........................................................DSSEGVEEGGTWIHKVTGDKLGG...AEG..ELEFT..VVG...................YTIANQMLSLVGSI-q.......................................................................................................................................................................................................................
A0A098VT82_9MICR/83-224               ......................tpn----QLT.CGEI..NKISGDHVGLIMLGTLNAS..I.P.A.S.S.........................L..RS......................A.YFYEIfskkwirlnvn.....................................................................................................decidgemgnmT-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------edhileaekkifrpkqleigqklsfyvdgmtfisedqisltgyrqaasskntkfyngsnsaqtrgsnsaqtrgfns............................................................................................................................................
A0A168DU30_9EURO/183-324              ......................vmf-----IL.EGWV..NVQSEGFLGAIVNNLFSVG..I.D.R.R.R.........................L..PK......................D.WKWVAp........................................................................................................................gdG---TFSS..ASS..VAGT.E..I....ES.EY..ER.D..E...EV..DK.D..AS-Tgpdcvglt..........................................gndnsvatLENAEDDSTGYFVTPSGRRVRGT..iRFR..VRDVD..VIP..................gAERDKGFISIEGSML........................................................................................................................................................................................................................
L5KNR7_PTEAL/125-337                  .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................E.-QWQTleinvgdelefevfrldsdsagvfcirgkvnitslqtkcsavseevteigteed..............vekppkkkkkkkkdpepyevesgtteltdfadvtmkeetdlqvnndmnglweeepK-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------KKKKKK...---..-----..---...................---------------qqqqedqgqdpvfqgsdssgyqsdhkkkkkkrkhseeaeftplleqspkkkrk...................................................................................................................................................................
A0A673SV66_SURSU/152-326              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................E.-QWQIlevnvgdelefevfrldsdaagvfcirgklnisslqakcstvs....................................eevtdtgteeivekplkkkkkkkkdaepceveagsreladladgP-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------vreetdqvtnenglqkeepkkkkkrrhqedqdqdpvfqeflsd.............................................................................................................................................................................
A0A1X2H3R6_SYNRA/132-256              .........................PRKNTRL.VGQI..NLQSQDHIGLLIFGTFNAS..I.P.R.A.R.........................I..PS......................D.-KYEW...........................................................................................................................RAFETPVE..ATP..TEKN.E..E....ED.ED..SE.E..S...EE..NA.E..ENSV..........................................................MVGRKRSKHGEWVVTSTGEALGG...NDG..IVEFN..VVD...................IIEANDILTVTGSL-........................................................................................................................................................................................................................
N1RDV0_FUSC4/283-396                  .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................D.WKWVP...........................................................................................................................--------..---..--NE.S..P....EA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWADGNGDKVKGK..iRFR..IRNFD..V-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
V5ESW5_KALBG/143-239                  .........................PKIGQML.EGTI..CLSSPSHVSLLLYGLFNAS..I.P.A.S.H.........................L..PE......................E.-EWEF...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.V..LNDP..........................................................DAVHTDHGLGHWRNRATGDRLGG...EKG..KLEFT..VIS...................LTIANHMLSLHGSLL........................................................................................................................................................................................................................
A0A1S8B505_9PEZI/168-276              .........................PRKGIWI.EGSV..NLQNESHLGLVCWNLFSAS..I.D.R.K.R.........................L..PE......................D.WTWVA...........................................................................................................................--------..---..----.-..-....--.-A..GE.G..G...AE..DI.D..EDTE..........................................................DAGKPDAGQGYFVDAQGKKVDGV..iKFR..IRDFE..TSP..................rTENDRGFITIEGSLL........................................................................................................................................................................................................................
A0A0D2DU37_9EURO/253-390              .........................PERGDEL.YGWT..NVTSEGFVGLVSYNYFQTA..I.G.K.S.R.........................I..PP......................E.WKWNGpsre..................................................................................................................qlqkaKKKGRKGR..LRD..EDGL.E..N....EE.HN..TQ.E..T...AT..TV.V..VDSS..........................................................SHALLADDGGYFADASGTKIKST..lKFR..VADTE..IVP..................aHDRHKWSLQIDGTLL........................................................................................................................................................................................................................
A0A165PQW9_9AGAM/159-284              .........................PHAGMKL.VGRV..NLCSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..PI......................D.-QWEF...........................................................................................................................-EYGPAEN.dPEF..GPHA.V..P....EG.ED..DP.M..N...AD..ES.Q..NQND..........................................................DETHEIEGGGRWVHKITGDRLGG...AKQ..QLEFT..VIR...................LTIANNMLSLIGSI-q.......................................................................................................................................................................................................................
A0A0J1B532_9TREE/71-173               .........................PVVGQVL.YGTH..SLSSPSHLSLLFAKTFNVS..I.P.L.Q.H.........................I..PR......................D.-KYEF...........................................................................................................................--------..---..----.-..-....--.--..EH.A..D...LA..EE.D..YSSD..........................................................EEDEGVHEVGRW--KEGDKVLGE...GGE..RVAFT..VIG...................LHVTNQMLSLTGSLL........................................................................................................................................................................................................................
A0A0M8ZSW5_9HYME/127-368              .........................PEVGFKL.KGVV..NKKGLDHIGILVHKAFNVS..I.P.K.P.N.........................D..EE......................D.WPGDNveigqevrftitlldfnsklpfirgvlnsndylhgcklmlksinnkr............................ltsknnicsnssnnvskknvehggkhtffttdsedtdedipkvnkeieP-------..---..----.-..K....VS.EK..KK.K..A...KK..RD.K..---Kfneinesktklinveseydhhan............nislngelmsneeselsdpkskiEKKFKIKSSPSWVNENNET----...---..-----..---...................---------------fvdnsprsylkvendtskikve..................................................................................................................................................................................................
A0A423VVB5_9PEZI/223-356              .........................PSRGAWM.EGEI..NLQSEGHIGVVCFEKFNAS..I.S.R.R.S.........................L..PK......................G.WTWVD...........................................................................................................................QPDEEDVV.aEEE..VVEE.E..E....DP.FA..EN.A..G...EG..DE.A..GEDEdgn....................................................tarDTHHQVRSSGHWVDENGDRVSGK...VYF..RIKNF..SSG...................STGDFTYLSLQGTML........................................................................................................................................................................................................................
A0A0P1A5U2_PLAHL/83-129               .........................PKKGMVL.RGFV..NKIGSNHVGMLFAGVFNGS..V.A.E.A.E.........................L..PK......................G.YVHNY...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------aqd.....................................................................................................................................................................................................................
V5G232_BYSSN/177-329                  .........................PQRGQVL.EGWV..NVQSEGFLGAVVYNLFSVG..I.E.R.R.R.........................L..PA......................D.WKWIP...........................................................................................................................PGDEDGSA.dAEG..NNKR.S..K....SA.PT..SA.E..N...SG..DE.E..DSFDpekehftpvrl...................................pltvetqdngpdMDAEDSAATGYFQSASGHRVRGM..iRFR..VRDID..VIP..................gADRERGFISIEGTML........................................................................................................................................................................................................................
A0A135SE95_9PEZI/282-401              .........................PRRGAWM.EGSI..NLENEGHVGVVCWGKFNAS..I.E.S.S.R.........................L..PP......................E.WRWIH...........................................................................................................................-------A.gSAE..AASY.V..A....DP.FD..V-.D..N...TD..AA.A..EDEH..........................................................GAVRQIYTTGFWVDGAGNKVKGR..vRFR..IKAFD..V-G...................VSGDHGYLSLEGTML........................................................................................................................................................................................................................
A0A4Y9ZYE7_9AGAM/122-252              .........................PEVGMKL.SAKI..NLCSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..PT......................D.-QWEFey.......................................................................................................................gpA-ENDPDYgvEAS..TKEE.D..G....PD.EP..MQ.L..D...AQ..TK.D..GEAT..........................................................PGDEGVDRGGRWIHKVTAARLGG...EDG..RLEFT..VVG...................LTIANEMLSLLGSI-q.......................................................................................................................................................................................................................
D8RA84_SELML/99-157                   .........................PKAGMLI.EGKV..NKVEKDYIGMLVLGLFNAA..I.G.I.N.D.........................I..RQ......................D.LFYDE...........................................................................................................................VATEQ---..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------twisesderh..............................................................................................................................................................................................................
A0A2B7XBJ1_9EURO/257-421              .........................PERGQPL.EGWI..NVQSDGFLGAVVYNLFSVG..I.E.R.R.R.........................L..PA......................D.WEWVG...........................................................................................................................PGEESTTS.tLET..TATS.K..K....SS.GT..DD.D..D...DD..DN.E..DKDSdfdsdkenfrplpatss.......................amldmgtqhqshegveppFEAFEDAAAGYFRTRSGRRVRGM..vRFH..VRDVD..VIP..................gAEHDKGFLSIEGTML........................................................................................................................................................................................................................
A0A329SUJ5_9STRA/83-258               .........................PKEGMML.RGVV..NKIGSNHVGMLFAGVFNGS..V.A.E.A.E.........................L..PK......................G.YVHNYaqdcwlgedgssisvenevkvkvlrvhvaggmiaieatm.............................................rfdagvvkatttkkvkkatqlnlaagepvtkpvkdkkekK-------..-SK..KRKH.E..K....PA.DE..EV.L..E...EE..TA.P..VEAE..........................................................EEVEVKPKKHKHKDK--------...---..-----..---...................---------------dakkkkhkkskhd...........................................................................................................................................................................................................
A0A2G8SPY1_9APHY/139-253              .........................PQVGMKL.SGKI..NLCSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..TT......................D.-SYEF...........................................................................................................................--------..---..EYGP.A..E....ND.PE..FG.G..A...QD..EG.A..DGER..........................................................AQEDMEHGGGRWVHKITGTKLGD...ADG..HLEFT..VVG...................LTIANQMLSLVGSI-q.......................................................................................................................................................................................................................
A0A3P8TFT6_AMPPE/141-379              .........................PKKGQKL.LGKV..NKLGVSHVGCLVHGCFNAS..I.P.K.P.N.........................L..VS......................V.ETWRDagprigaelefevtaldadtagvllirgrmdrtrvqellamgessestvpeeqte.............pqdteptpeptqdsldgtpkkkkkkkkvkeeeteeeivsvssgqqdssataalngTTDEANGD.eASE..KKKK.K..K....KK.EK..RL.K..E...E-..--.-..----..........................................................-----------------------...---..-----..---...................---------------eeemelsrvevhgsdssgyisdkpskkrkhetanedtsglsedpepkkskkkrksdie..............................................................................................................................................................
B2ABZ6_PODAN/287-419                  .........................PSRGKWM.EGVV..QLQSEGHIGVVCWNKFNAS..I.E.A.K.R.........................L..PQ......................G.WKWVDisk.....................................................................................................................ddpFARSNSSQ..PET..DENG.E..E....KE.GQ..QQ.E..E...ED..IL.D..GEEL..........................................................QVVEQMHTTGYWVNEKGRKVGGK..lRFR..IMNFD..V-G...................QAGDYGYLSIEGTCL........................................................................................................................................................................................................................
A0A1G4JYK9_9SACH/127-225              .........................PQVGDVV.EGWI..FIQSPSHIGLLIHDAFNAS..I.R.T.N.N.........................M..PT......................E.WTFIS...........................................................................................................................--------..---..----.-..-....--.--..--.-..N...EE..EN.E..TTSD..........................................................SETAKNRSMGHWVDENGQHVNGK...---..-LRFT..VRN...................IYKSGRVVSVEGTLL........................................................................................................................................................................................................................
A0A364MSE5_9PLEO/872-976              .........................PVRNAYL.QAHV..TDHAKTHITLAYLNTFPVS..I.L.K.E.H.........................M..PA......................G.WTWHQ...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...NE..TG.K..VKKG..........................................................WDEKLSDEGGWWMNGDGEKVEGElrvRIR..DVDGR..MDG...................KGKGKGFLRVDGSLL........................................................................................................................................................................................................................
A0A3E2GYP4_SCYLI/118-218              .........................PEAGVTL.EGYV..NLQNEGHLGVVCWNMFNAS..I.E.R.K.R.........................L..PS......................D.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...-A..KE.R..VEDT..........................................................DGIYAEEGIGYYVDGDGNKIPDT..iKFR..VKEIE..-SS...................PDKERGFLNIEGTML........................................................................................................................................................................................................................
A0A5E4DAF3_MARMO/125-313              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.K.P.E........................qM..SV......................E.-QWQTleinvgdelefevfrldsdaagvfcirgkiniaclqskhpnvs.....................................eevtetlteesvekipkkkkkkdpeiyevndgvtepadftgitP-------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------keeeelqvsndmnglceeepkkkkkkkkhqedqdpifqcsdssgyqsdhkkkkkekkt..............................................................................................................................................................
A0A1Z5TBN5_HORWE/286-391              .........................PQKGTYL.EGYV..NLQNESLLGLVCYNYFNAG..I.E.W.N.R.........................L..PK......................D.WQWVS...........................................................................................................................--------..---..----.-..-....--.--..--.D..E...EG..AL.T..GKGK..........................................................GKKATQEGEGHWADAEGKKVDGR..lIFR..VKDFE..ATP..................gSEGGAGSINIVGTLL........................................................................................................................................................................................................................
A0A2Y9F6A3_PHYMC/125-319              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................E.-QWQTleinmgdelefevfrld........................................................................................sdaagvfcirgklnitslQ---TKCS.eVSE..EV-T.E..T....GT.EE..AT.E..K...PQ..KK.K..KKKKtypepyeveggtt...............................eladfsdvtvkeetD----------------------...---..-----..---...................---------------lqinnhvnglweeepkkkkkkkhqdpvfqgsdssgyqsdhkkkkkkrkhseeaeftp...............................................................................................................................................................
A2YYI7_ORYSI/81-229                   .........................PKPDMML.EGKV..EMLGKESIHAIVLGVFSAA..I.M.L.D.D.........................I..HE......................K.FKFKRkkyggkfvsrsdkqhvikkgsmirfsvkrvdae.........................................................mnchvtgslipphtgsmlwlsvhddeyaleinsG-------..---..KRSR.D..N....KI.KT..EQ.H..E...QD..HS.V..KSSG..........................................................RKHKSKSR---------------...---..-----..---...................---------------krsfeer.................................................................................................................................................................................................................
A0A165GSH2_9APHY/128-243              .........................PQIGMKL.VGKV..NLCSPGHVALLLRRTFNVS..I.P.R.H.H.........................I..PE......................D.-QWEF...........................................................................................................................--------..--E..YGPA.E..N....DP.EF..GA.A..I...AD..EK.T..GTQD..........................................................GETEQVGGNGRWVHKLTGVRLGD...SHG..FLEFT..VVG...................LTIANRMLSLVGSI-q.......................................................................................................................................................................................................................
C5DV77_ZYGRC/126-225                  .........................PQVGDII.EGWI..FIQSASHIGLLIHDAFNAS..I.K.K.N.N.........................I..PM......................D.WTFVD...........................................................................................................................--------..---..----.-..-....--.--..--.E..E...DN..NS.R..EQSQ..........................................................EDTQKFRSLGHWVDQDGGRIDGK...---..-LKFK..VKS...................VYTSGRVVSVEGTLL........................................................................................................................................................................................................................
A0A1F7ZUT1_9EURO/188-336              .........................PQKGQIL.EGWV..NVQSEGFLGAVVLNLFSVG..V.E.R.K.R.........................L..PS......................N.WKWVP...........................................................................................................................PGEEGSVS.gDQQ..KTAT.A..S....ED.DE..SE.P..S...AS..FD.Q..EK-Ehfnpvslanp......................................vsdtvneevnAEDDESVAEGYFQSVSGHRVRGT..vRFR..VVDVD..VIP..................gSERDRSFLSIEGTML........................................................................................................................................................................................................................
A8Q6I1_MALGO/97-198                   .........................PEIGMKL.QGTI..TLCSPSHVSLLLYDTFNAA..I.S.A.P.H.........................I..PA......................S.-MWEF...........................................................................................................................--------..---..----.-..-....--.--..--.-..V...YY..SD.V..GEVQ..........................................................RVDAKDRSVGFWRNKESGERLGG...KNH..MLQFS..VIS...................MTVANQMLSLHGSLL........................................................................................................................................................................................................................
A0A2H9TP73_9FUNG/106-172              .........................PRPGVRL.LGVV..NQMSREHVGLLVVNYFTAV..I.Y.A.H.Q.........................L..EA......................V.LKWNE...........................................................................................................................-EEQSWES..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------rrtgklvedgqeitfe........................................................................................................................................................................................................
A0A401KP69_ASPAW/174-343              .........................PQRGQIL.EGWV..NVQSEGFLGAIVLNLFSVG..I.E.R.K.R.........................L..PP......................S.WKWIP...........................................................................................................................PGEELEEE..QQE..QGQQ.A..S....AT.EN..EG.D..D...SD..SS.N..SETKksafdpakelfrpialaedv.................npladtdpaststnnnatgdyDDDETAAAEGYFQSVSGHRVRGT..iKFR..VVDVD..VIP..................gSERESGFLSIEGTML........................................................................................................................................................................................................................
A0A1E3Q307_LIPST/155-272              .........................PKRGDIL.QGRI..NLQSRSHIGLLTFDVFNAS..I.T.R.D.K.........................I..PA......................K.WKFIE...........................................................................................................................------NV.lDED..AELE.T..S....GD.NE..AN.G..E...AN..GD.A..EAVH..........................................................EEDGDSKSLGYWVNEQGKKIEGK...---..-LTFI..IES...................LELSGKLFSVEGSLL........................................................................................................................................................................................................................
A0A2Y9H1J7_NEOSC/125-334              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................E.-QWQNltinvgdelefevfrldsdaagvfcirgk................................................................lnttslqtkcsavseevtetgteeiiekplKKKKKKKK..KDP..ESYE.V..E....SD.NR..EL.A..D...CA..DA.T..MKKE..........................................................TDLQIDNVNGLWKAEPKKKKRHQ...---..-----..---...................---------------edqdqdpvfqgsdssgyqsdhkkkkkkrkhseeaeftpllehspkkkrek......................................................................................................................................................................
A0A1S8WA73_9FUNG/151-192              .........................PKVGSTL.YGVV..NKVSPDHIGLLVYGMFNAS..I.P.S.S.H.........................I..RH......................D.-E---...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------fy......................................................................................................................................................................................................................
A0A2K5QMR4_CEBIM/125-269              .........................PEPGQKL.MGIV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................L..SA......................E.-QWQTmeinmgdelefevfrldsdtag..............................................................................vfcirgklnitslqfkhsevseeV-------..---..TENG.T..E....EA.AE..KP.A..K...KK..KK.K..KKDP..........................................................E----------------------...---..-----..---...................---------------tyevdsgtakladfaddtpmeesalqntnnv.........................................................................................................................................................................................
A0A093Z2S2_9PEZI/205-302              .........................PTRGGWL.EGYV..NLQNEGHLGIVCWNLFNAS..I.E.R.Q.R.........................L..PK......................D.WKWVG...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.A..EDLE..........................................................GDGYAEDGVGYYVDGAGTKIEGI..vKFR..VKDIE..-SS...................HDRERGFLSIEGTML........................................................................................................................................................................................................................
A0A6J0ZF76_ODOVR/121-322              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHKCFNAS..I.P.KpE.Q.........................M..PA......................D.-QWQTlqinvgdelefevfrldsdaagvfcirgklsma.........................................................slqtkcsavpekapetgadepvekppkkkkkkkK-------..DLE..PCEA.E..G....ST.TE..PA.E..F...AD..VT.M..KDET..........................................................DLQVSNSVNGLWEGERKKKKKKK...---..-----..---...................---------------kkkhqegqdqepvfqgsdssgyqsdhtkkkkkrkseeaeltp..............................................................................................................................................................................
A0A2U3X0R0_ODORO/140-349              .........................PEPGQKL.MGTV..NKVSSSHIGCLVHGCFNAS..I.P.KpE.Q.........................M..PA......................E.-QWQNleinvgdelefevfrldsdaagvfcirgk................................................................lnttslqtkcsavseevtetgteeiiekplK-KKKKKK.tTDP..ESYE.V..E....SD.NR..EL.A..D...CA..DA.T..MKEE..........................................................TDLQIDNVNGLWKAEPKKKKRHQ...---..-----..---...................---------------edqdqdpvfqgsdssgyqsdrkkkkkkrkhseeaeftplvehspkkkrek......................................................................................................................................................................
C5M482_CANTT/205-298                  .........................PQVGDVL.EADV..YMQTPSHIGLLINDTFNAS..I.K.K.Y.N.........................I..PT......................S.WTFKS...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.N..QVDE..........................................................VSSDDKKTFGHWLDENETKIEGK...---..-LQFT..VKA...................IYTTGRVVSVEGTL-i.......................................................................................................................................................................................................................
A0A0H2S7S8_9AGAM/131-256              .........................PQVGSKL.TGKI..KLCSPDHIALLVLQTFNVS..I.P.R.H.H.........................I.eTE......................N.WEFQY...........................................................................................................................GPLEND--..PEF..GPFA.T..S....AK.GE..KS.D..D...AM..QV.D..GSQH..........................................................GEGEEQEVGGSWLHKLTGEKLGG...EDG..ILEFT..VIG...................LKIANQMLSLLGSLQ........................................................................................................................................................................................................................
A0A2P7ZU89_9PEZI/336-471              .........................PERGVYL.QGVV..QVQNPSWLGLVCWNYFNAG..I.P.R.R.R.........................L..PR......................G.WRWVDaarv...................................................................................................................qrvkP-------..RIR..EGEI.V..D....LE.AE..GE.E..G...EK..QK.G..EG-Devv...................................................evdkEGVVVDASGGFWVDESGRKVQGL..iEFR..LVDFE..SAP..................sTERERGFVSITGTLL........................................................................................................................................................................................................................
S9XIU4_SCHCR/96-145                   .........................PKKGDRL.EGKI..NLVSPSHIGLLVLGIFNAS..I.P.R.K.S.........................I..PS......................S.WTFIE...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------pdttee..................................................................................................................................................................................................................
A0A109FJV8_9BASI/168-324              .........................PRVGMKL.VGTL..TLASASHVSLLLHNLFNAS..I.P.V.S.H.........................I..PT......................D.-TWEWdpdfpvppvvlerr...............................................................................................taalplkqvvsdvvEKANEAAK.iDEE..EGGG.A..D....AA.TE..EL.E..Kv.vEE..QE.E..AAKE..........................................................EEEAEFAERGWWVHRKSREPLGG...QDG..RLDFT..LVG...................LTTSNSLLSCTGSLL........................................................................................................................................................................................................................
A0A3M2S630_9HYPO/299-412              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................D.WKWVP...........................................................................................................................--------..---..--NE.S..P....EA.QG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWADGSGEKIKGK..iRFR..IRNFD..V-G...................TSGETSYLSLEGTML........................................................................................................................................................................................................................
G4TAG9_SERID/3-111                    .........................PRNWKRP.GGTI..SICSPDHIGLLIHKTFNAS..I.P.R.H.H.........................I..PT......................G.-DWQF...........................................................................................................................--------..---..----.-..-....EY.GA..LE.N..D...PT..FG.A..AALG..........................................................LDQDDAEDTGRWFHKDTGESIGG...PSG..EVEFT..IVS...................LNVSQSMLSILGSLQ........................................................................................................................................................................................................................
A0A2K1JED6_PHYPA/91-265               .........................PKVGIFV.EGKV..NKVEEDYLGVVVLGLFNAA..I.G.S.S.D.........................I..RN......................G.LVYCEgidgtrawmnenderhcikigssirfsvksfqene....................................................eivdltgallgpqtgcvewlalqseekheaestqmlL-------..-EN..GVKK.S..K....HK.ES..RS.A..E...VD..AE.V..SEGI..........................................................SEHTPKKKK--------------...---..-----..---...................---------------krkektvtgdhssvkkrrksldvsa...............................................................................................................................................................................................
A0A1J8QFB5_9AGAM/132-259              .........................PRIAMKL.VGKV..ILCSPDHVSLLVHRTFNVS..I.P.Y.H.H.........................I..PQ......................D.-VWEFe.........................................................................................................................yGPAENDPE..YGA..GAVE.P..S....VD.KG..ED.A..P...MK..DG.D..NAQA..........................................................EGETVEEASGRWVHRVTGTKLGG...SDG..YLEFT..VVG...................QTVANEMLSLQGSI-q.......................................................................................................................................................................................................................
A0A2H1A4Y5_CANAR/127-227              .........................PQPGDVL.EGYI..YMQTQSHIGLLVHDTFNAS..L.K.S.K.S.........................I..PQ......................N.WEFVP...........................................................................................................................--------..---..----.-..-....--.--..-S.Q..A...DE..YG.E..EQGD..........................................................SGNSKFRSYGYWTDENGTKIEGK...---..-IKFT..VKT...................VHTSGKMVSLEGTL-v.......................................................................................................................................................................................................................
U1FYM5_ENDPU/227-336                  eavgnkgemrrkmkkigvkrdgdge-------.----..-------------------..-.-.-.-.-.........................-..--......................-.-----...........................................................................................................................-EEEEEEE.eEEG..MVDT.S..Q....ET.LV..NA.V..A...DG..DQ.G..QEED..........................................................GDGDGEGEIGYFQRGDGTRVHGS..iRFR..VVDCE..IVP..................gHDRESWSLQIEGTLL........................................................................................................................................................................................................................
A0A6G0WA43_APHCR/91-269               .........................PPVGSII.EAIV..NQTSDNHVSCLVHNLFNVS..I.V.R.P.E.........................N.ePY......................D.-QWSGskikkddkidvkvlsfdltk...................................................................................klphitgeiikkkddkcydsTDIQDSS-..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------tkssssknivsdftksfnrntaspskssssdseitemtnitmpkisadksiktsplsinttmkhsekvdltvnssklsssdsessdem................................................................................................................................
A0A2A9PEQ3_9HYPO/451-564              .........................PRRGSWM.EGSI..NLQTEGHIGVVCFGKFNAS..I.E.A.I.R.........................L..PA......................T.WKWVS...........................................................................................................................--------..---..--HE.L..A....ED.QG..FE.E..M...AP..AT.A..ADED..........................................................GVVQQVDSTGFWVDSRGAKVQGK..iRFR..IRNFD..A-G...................TTGDTSYLSLEGTML........................................................................................................................................................................................................................
A0A4Q4YX27_9PEZI/309-434              .........................PKRGSWM.EGSL..NLQSEGFIGVICFGMFNAS..I.E.A.S.R.........................L..PS......................G.WKWVD..........................................................................................................................mLSKEGG--..KQQ..NGKS.A..A....EA.KL..PT.P..E...PQ..DE.N..EAED..........................................................GGTDQAHSTGYWVDESGSKVGGK...LRF..RIKNY..EVG...................SVGDYGYLSIEGTML........................................................................................................................................................................................................................
A0A662XVB4_9STRA/86-254               .........................PQEGMRL.RGFI..NKIGSNHVGMLFAGVFNGS..V.A.E.S.E.........................L..PK......................G.YVHNYaqdcwlaedgssisvndevdvqvlrvhvaggmiaieat..............................................mrvkgaskaspskkskkkatldltaetpkipeikstktkK------A..KKR..KHAE.E..A....VV.VE..EE.A..E...EE..EV.V..V---..........................................................-----------------------...---..-----..---...................---------------kvkkskhkdkdgkkkkhkkskhd.................................................................................................................................................................................................
J4U2K2_SACK1/127-250                  .........................PQVGDVL.EGYI..FIQSASHIGLLIHDAFNAS..I.K.K.N.N.........................I..PM......................D.WTFVH...........................................................................................................................NEIEEDAD.vVNG..DENG.G..N....HN.SE..DD.K..D...KN..SG.D..NSLG..........................................................KFSFANRSLGHWVDSNGEPIDGK...---..-LRFT..VRN...................VYTTGRVVSVDGTL-i.......................................................................................................................................................................................................................
A0A179F7Z8_METCM/296-409              .........................PSRGAWM.EGSV..NLQTEGHIGVVCFGKFNAS..I.E.A.R.R.........................L..PP......................A.WKWVS...........................................................................................................................--------..---..--NE.S..P....EA.HG..FE.E..T...AS..VI.T..ADDH..........................................................GVVRQIHSTGFWVDGNGDRVKGK..vRFR..IRNFD..A-G...................TSGDTSYLSLEGTML........................................................................................................................................................................................................................
A0A0D2NM55_HYPSF/109-224              .........................PRVGLKL.SGKV..NLCSPDHISLLVHRTFNVS..I.P.R.H.H.........................I..PT......................D.-TWEF...........................................................................................................................--------..--E..YGPA.E..N....DP.EY..GS.V..T...KE..DE.E..KPDG..........................................................EADKEHETGGEWVHKVTGKALGG...KTG..VLQFT..VIG...................LTVANEMLSLLGSLQ........................................................................................................................................................................................................................
A0A7H8QMH9_9EURO/183-344              .........................PQKGQIL.EGWV..NVQSEGFLGAVAHNLFSVG..I.E.R.K.R.........................L..PA......................N.WKWVPpg......................................................................................................................edgD-----ED..EDG..TAQT.T..R....TK.GT..VA.S..A...PT..SG.D..EDDSnkssdfdpakehftpl.........................pkpvtnpiemeeaavdgQDEDDLNATGYFESVSGHPVRGT..iRFR..VRDID..VIP..................gADPDRGFISIEGTML........................................................................................................................................................................................................................
A0A1E3QXV7_9ASCO/127-224              .........................PQVGDTL.EGYS..YMQSASHIGLLIHDTFNAS..I.K.K.S.S.........................I..PS......................G.WEFVH...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...NQ..VD.E..YATE..........................................................VEENKFRSLGYWVDENGIKIEGR...---..-MKLT..VKA...................VHSTGRVISVEGTLL........................................................................................................................................................................................................................
A0A317XYM4_9BASI/131-229              .........................PKIGQVL.EGTV..CLSSPSHVSLLLYGLFNAS..I.P.A.S.H.........................L..PE......................D.-EWEF...........................................................................................................................--------..---..----.-..-....--.--..--.-..-...--..VV.N..DGQP..........................................................TSATADQGLGHWCKRSDGSKLGG...SSG..KVTFT..VVS...................LTIANHMLSLHGSLL........................................................................................................................................................................................................................
A0A0W4ZUZ3_PNEJ7/127-180              ........................k--TGDFL.EGIV..NLQSPSHIGLLVSGFFNAS..I.P.K.S.A.........................I..PK......................A.WMYQE...........................................................................................................................IMSQEEVE..---..----.-..-....--.--..--.-..-...--..--.-..----..........................................................-----------------------...---..-----..---...................---------------qne.....................................................................................................................................................................................................................
#=GC SS_cons                          .........................-STTCEE.EEEE..EEEETTEEEEEETTTEEEE..E.E.C.T.T.........................S..-T......................T.SEEEE...........................................................................................................................CSS-----.----..----.-..-....--.--..--.-..-...--..--.-..----..........................................................----TEEEEEEEE-TTSSB--SE...---..-EEEE..EEE...................EE-SSSS-EEEEES--SS.....................................................................................................................................................................................................................
#=GC seq_cons                         .........................PphGphL.pGhV..NhpotuHlGhllashFNAS..I...+.p.c.........................l..Ps......................s.hpWht....................................................................................................................................................................t...tt..tt.t..tttt..........................................................tt.tt.tt.Gha.p..stph.t..........ht.................................................................................................................................................................................................................................................................
//
DBGET integrated database retrieval system