
Database: Pfam
Entry: Ribosomal_60s
LinkDB: Ribosomal_60s
Original site: Ribosomal_60s 
#=GF ID   Ribosomal_60s
#=GF AC   PF00428.22
#=GF DE   60s Acidic ribosomal protein
#=GF PI   60s_ribosomal;
#=GF AU   Finn RD;0000-0001-8626-2148
#=GF SE   Pfam-B_151 (release 1.0)
#=GF GA   28.10 28.10;
#=GF TC   28.10 28.10;
#=GF NC   28.00 28.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   8722011
#=GF RT   Proteins P1, P2, and P0, components of the eukaryotic ribosome
#=GF RT   stalk. New structural and functional aspects. 
#=GF RA   Remacha M, Jimenez-Diaz A, Santos C, Briones E, Zambrano R,
#=GF RA   Rodriguez Gabriel MA, Guarinos E, Ballesta JP; 
#=GF RL   Biochem Cell Biol 1995;73:959-968.
#=GF DR   SCOP; 1s4h; fa;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family includes archaebacterial L12, eukaryotic P0, P1 and
#=GF CC   P2.
#=GF SQ   7635
#=GS A8BKF1_GIAIC/21-105         AC A8BKF1.1
#=GS A0A427Y491_9TREE/17-110     AC A0A427Y491.1
#=GS A0A084VHA0_ANOSI/744-827    AC A0A084VHA0.1
#=GS A0A0D0BXB3_9AGAR/17-113     AC A0A0D0BXB3.1
#=GS A0A4W6DRG5_LATCA/22-112     AC A0A4W6DRG5.1
#=GS A0A1L0BXU2_9ASCO/20-106     AC A0A1L0BXU2.1
#=GS A0A803JQS2_XENTR/17-92      AC A0A803JQS2.1
#=GS A0A7N5K7N3_AILME/22-112     AC A0A7N5K7N3.1
#=GS A0A399GA78_9PLEO/25-117     AC A0A399GA78.1
#=GS A0A5N3XFE1_MUNRE/22-113     AC A0A5N3XFE1.1
#=GS A0A150FY74_GONPE/17-109     AC A0A150FY74.1
#=GS F0ZXE3_DICPU/227-304        AC F0ZXE3.1
#=GS A0A091ISD7_CALAN/17-63      AC A0A091ISD7.1
#=GS A0A4S8JJ09_MUSBA/17-111     AC A0A4S8JJ09.1
#=GS A0A4P1QV23_LUPAN/234-320    AC A0A4P1QV23.1
#=GS G8JWW4_ERECY/92-178         AC G8JWW4.1
#=GS A0A1Y2FID2_PROLT/19-106     AC A0A1Y2FID2.1
#=GS M4ENX5_BRARP/28-120         AC M4ENX5.1
#=GS F6Z136_CALJA/18-88          AC F6Z136.1
#=GS A0A1A6GF20_NEOLE/4-100      AC A0A1A6GF20.1
#=GS M2MFM3_BAUPA/234-321        AC M2MFM3.1
#=GS A0A445B993_ARAHY/23-119     AC A0A445B993.1
#=GS A0A3Q7UY48_VULVU/22-113     AC A0A3Q7UY48.1
#=GS B3S429_TRIAD/231-313        AC B3S429.1
#=GS A0A226NAL5_CALSU/231-316    AC A0A226NAL5.1
#=GS A0A0W7TI05_9ARCH/230-333    AC A0A0W7TI05.1
#=GS A8Y1E6_CAEBR/22-110         AC A8Y1E6.1
#=GS A0A3Q4HEJ8_NEOBR/17-113     AC A0A3Q4HEJ8.1
#=GS A0A162R5H3_MUCCL/228-307    AC A0A162R5H3.1
#=GS M2T1B0_COCSN/17-112         AC M2T1B0.1
#=GS D3S1Z2_FERPA/18-105         AC D3S1Z2.1
#=GS A0A4S3J849_9EURO/21-106     AC A0A4S3J849.1
#=GS A0A5A7SR49_CUCME/17-114     AC A0A5A7SR49.1
#=GS A0A2U1Q8M6_ARTAN/237-320    AC A0A2U1Q8M6.1
#=GS A0A1Y2MFJ4_EPING/17-111     AC A0A1Y2MFJ4.1
#=GS A0A4W4DYU7_ELEEL/77-173     AC A0A4W4DYU7.1
#=GS A0A446YI05_TRITD/227-311    AC A0A446YI05.1
#=GS A0A229XGW7_9EURO/17-111     AC A0A229XGW7.1
#=GS A0A4Z1SUJ6_GIAMU/17-108     AC A0A4Z1SUJ6.1
#=GS R1D864_EMIHU/231-316        AC R1D864.1
#=GS A0A6J1D8P9_MOMCH/17-114     AC A0A6J1D8P9.1
#=GS A0A4P1RQ58_LUPAN/17-114     AC A0A4P1RQ58.1
#=GS A0A4U0VBQ2_9PEZI/21-112     AC A0A4U0VBQ2.1
#=GS A0A5A9NRC4_9TELE/17-114     AC A0A5A9NRC4.1
#=GS A0A2G8JRJ1_STIJA/29-123     AC A0A2G8JRJ1.1
#=GS A0A5N7A9V3_9EURO/17-108     AC A0A5N7A9V3.1
#=GS A0A6J0JCK5_RAPSA/22-112     AC A0A6J0JCK5.1
#=GS A0A1F5LZA1_9EURO/21-106     AC A0A1F5LZA1.1
#=GS X0CM61_FUSOX/17-109         AC X0CM61.1
#=GS I2JUJ7_DEKBR/21-110         AC I2JUJ7.2
#=GS R0EUX9_9BRAS/22-100         AC R0EUX9.1
#=GS A0A5D2SFC0_GOSMU/22-112     AC A0A5D2SFC0.1
#=GS S9XIA7_CAMFR/22-113         AC S9XIA7.1
#=GS A0A0E0I6L3_ORYNI/21-109     AC A0A0E0I6L3.1
#=GS A0A068Y975_ECHMU/17-122     AC A0A068Y975.1
#=GS E9CCZ9_CAPO3/17-110         AC E9CCZ9.1
#=GS A0A103XIF9_CYNCS/21-109     AC A0A103XIF9.1
#=GS A0A0H2R2S6_9AGAM/232-314    AC A0A0H2R2S6.1
#=GS A0A6G2HD99_9EURY/16-107     AC A0A6G2HD99.1
#=GS A0A1J7J678_9PEZI/229-316    AC A0A1J7J678.1
#=GS A0A2P6NBB3_9EUKA/21-108     AC A0A2P6NBB3.1
#=GS A2YT04_ORYSI/17-113         AC A2YT04.1
#=GS A0A1E3QSW0_9ASCO/19-103     AC A0A1E3QSW0.1
#=GS A0A2P6TRH2_CHLSO/233-313    AC A0A2P6TRH2.1
#=GS A0A034VBX9_BACDO/231-316    AC A0A034VBX9.1
#=GS RL12_HALVD/16-112           AC P41197.1
#=GS D7EAE1_METEZ/237-345        AC D7EAE1.1
#=GS V7CH15_PHAVU/234-320        AC V7CH15.1
#=GS D8LSD6_ECTSI/26-112         AC D8LSD6.1
#=GS I1LTT3_SOYBN/17-110         AC I1LTT3.1
#=GS A0A194VCY8_9PEZI/21-107     AC A0A194VCY8.1
#=GS A0A078HWW9_BRANA/34-119     AC A0A078HWW9.1
#=GS A0A068U5S5_COFCA/21-111     AC A0A068U5S5.1
#=GS H2Y4S4_CIOSA/17-109         AC H2Y4S4.1
#=GS A0A0A0LV50_CUCSA/234-319    AC A0A0A0LV50.1
#=GS A0A167PYB1_CALVF/1-55       AC A0A167PYB1.1
#=GS A0A061DU49_THECC/93-184     AC A0A061DU49.1
#=GS A0A673M1Q5_9TELE/17-115     AC A0A673M1Q5.1
#=GS I3TDH6_THEC1/23-114         AC I3TDH6.1
#=GS A0A6J0P6V5_RAPSA/22-112     AC A0A6J0P6V5.1
#=GS A0A077ZUT5_STYLE/32-118     AC A0A077ZUT5.1
#=GS D7LSI6_ARALL/1-57           AC D7LSI6.1
#=GS A0A2P5B216_PARAD/17-108     AC A0A2P5B216.1
#=GS A0A197JGX0_9FUNG/20-106     AC A0A197JGX0.1
#=GS W6KKB3_9TRYP/16-110         AC W6KKB3.1
#=GS L0PBR1_PNEJ8/17-106         AC L0PBR1.1
#=GS Q7PQG7_ANOGA/231-313        AC Q7PQG7.1
#=GS A0A3Q1F923_9TELE/22-112     AC A0A3Q1F923.1
#=GS A0A6J0T1C2_9SAUR/17-113     AC A0A6J0T1C2.1
#=GS A0A395HP26_ASPHC/21-107     AC A0A395HP26.1
#=GS A0A367IW73_RHIST/20-103     AC A0A367IW73.1
#=GS A0A2K5KU25_CERAT/22-113     AC A0A2K5KU25.1
#=GS A0A1Q9DP29_SYMMI/549-634    AC A0A1Q9DP29.1
#=GS A0A0H5S275_BRUMA/21-116     AC A0A0H5S275.1
#=GS A0A0E0HF91_ORYNI/33-128     AC A0A0E0HF91.1
#=GS A0A210QYK4_MIZYE/22-109     AC A0A210QYK4.1
#=GS A0A251SUJ1_HELAN/233-316    AC A0A251SUJ1.1
#=GS A0A0D2XDL8_FUSO4/229-312    AC A0A0D2XDL8.1
#=GS A0A4U1F2G0_MONMO/229-315    AC A0A4U1F2G0.1
#=GS A0A6J3LA80_9HYME/17-113     AC A0A6J3LA80.1
#=GS G0NY22_CAEBE/231-311        AC G0NY22.1
#=GS A0A0M9VXK6_9HYPO/21-107     AC A0A0M9VXK6.1
#=GS A0A4D8YNV2_SALSN/289-379    AC A0A4D8YNV2.1
#=GS A0A3L6T4J7_PANMI/17-111     AC A0A3L6T4J7.1
#=GS A0A674ENL3_SALTR/22-110     AC A0A674ENL3.1
#=GS A0A6I9QE30_ELAGV/17-111     AC A0A6I9QE30.1
#=GS A0A672KCV0_SINGR/17-96      AC A0A672KCV0.1
#=GS M3HIT8_CANMX/17-108         AC M3HIT8.1
#=GS A0A5N5FYC0_9ROSA/17-114     AC A0A5N5FYC0.1
#=GS A9V5U8_MONBE/22-104         AC A9V5U8.1
#=GS RLA0_CHICK/231-315          AC P47826.1
#=GS A0A2I3LSE1_PAPAN/20-98      AC A0A2I3LSE1.1
#=GS W2QB22_PHYPN/231-311        AC W2QB22.1
#=GS A0A6P5KV53_PHACI/15-87      AC A0A6P5KV53.1
#=GS A0A553HKJ1_9PEZI/17-111     AC A0A553HKJ1.1
#=GS A0A175W089_9PEZI/17-109     AC A0A175W089.1
#=GS A0A498JSZ6_MALDO/21-110     AC A0A498JSZ6.1
#=GS B9RNK0_RICCO/21-112         AC B9RNK0.1
#=GS A0A484GXI6_SOUCH/308-397    AC A0A484GXI6.1
#=GS A0A4Q9KTW3_9MICR/8-101      AC A0A4Q9KTW3.1
#=GS A0A6P5MDL8_ARADU/57-144     AC A0A6P5MDL8.1
#=GS A0A166UK57_9PEZI/229-312    AC A0A166UK57.1
#=GS A0A0F4YT67_TALEM/21-126     AC A0A0F4YT67.1
#=GS A0A3N4INN3_ASCIM/17-110     AC A0A3N4INN3.1
#=GS A0A4U5MP81_POPAL/21-108     AC A0A4U5MP81.1
#=GS A0A0V0R7S0_PSEPJ/29-108     AC A0A0V0R7S0.1
#=GS A0A1S3MIY2_SALSA/17-115     AC A0A1S3MIY2.1
#=GS A0A6P7GGK6_DIAVI/231-314    AC A0A6P7GGK6.1
#=GS A6R7C5_AJECN/21-109         AC A6R7C5.1
#=GS A0A195FCE2_9HYME/231-317    AC A0A195FCE2.1
#=GS A0A1B8G8I0_9PEZI/229-311    AC A0A1B8G8I0.1
#=GS A0A5J5C265_9ASTE/39-114     AC A0A5J5C265.1
#=GS A0A5N5GNX9_9ROSA/17-114     AC A0A5N5GNX9.1
#=GS A0A6J1DK62_MOMCH/34-119     AC A0A6J1DK62.1
#=GS E2B864_HARSA/22-110         AC E2B864.1
#=GS W9QTA2_9ROSA/17-115         AC W9QTA2.1
#=GS A0A6J2KK52_BOMMA/231-315    AC A0A6J2KK52.1
#=GS A0A2K6CQT1_MACNE/17-114     AC A0A2K6CQT1.1
#=GS A0A5N6KCC0_9HELO/44-132     AC A0A5N6KCC0.1
#=GS A0A2I0TDM5_LIMLA/22-113     AC A0A2I0TDM5.1
#=GS A0A7N5JGY6_AILME/21-106     AC A0A7N5JGY6.1
#=GS H0ZQZ1_TAEGU/22-113         AC H0ZQZ1.1
#=GS A0A251S133_HELAN/1-51       AC A0A251S133.1
#=GS A0A1S3JLM9_LINUN/22-112     AC A0A1S3JLM9.1
#=GS A0A420I0K8_9PEZI/17-110     AC A0A420I0K8.1
#=GS W1QEQ6_OGAPD/17-108         AC W1QEQ6.1
#=GS A0A1R3KG69_COCAP/17-113     AC A0A1R3KG69.1
#=GS W6QLH1_PENRF/21-106         AC W6QLH1.1
#=GS A0A1S2XL12_CICAR/234-320    AC A0A1S2XL12.1
#=GS A6UTF7_META3/16-98          AC A6UTF7.1
#=GS A0A509AJ86_PLABA/32-118     AC A0A509AJ86.1
#=GS A0A0F8XGE4_9EURO/229-312    AC A0A0F8XGE4.1
#=GS A0A091UHF5_PHORB/17-114     AC A0A091UHF5.1
#=GS A0A3Q7QHU1_CALUR/231-316    AC A0A3Q7QHU1.1
#=GS A0A5E4GIK0_PRUDU/16-116     AC A0A5E4GIK0.1
#=GS A0A3P9MU45_POERE/169-251    AC A0A3P9MU45.1
#=GS A0A6J5WP27_PRUAR/21-111     AC A0A6J5WP27.1
#=GS A0A1U8LLR2_GOSHI/234-320    AC A0A1U8LLR2.1
#=GS A0A2P8A5D0_9PEZI/17-111     AC A0A2P8A5D0.1
#=GS A0A5C3EVH8_9BASI/17-111     AC A0A5C3EVH8.1
#=GS N4UH12_FUSC1/17-109         AC N4UH12.1
#=GS A0A643CHP5_BALPH/441-521    AC A0A643CHP5.1
#=GS I3EIJ4_NEMP3/21-99          AC I3EIJ4.1
#=GS A1C664_ASPCL/17-110         AC A1C664.1
#=GS W0K3A8_9EURY/16-113         AC W0K3A8.1
#=GS A0A151N9F0_ALLMI/43-117     AC A0A151N9F0.1
#=GS A0A1L0DN57_9ASCO/229-311    AC A0A1L0DN57.1
#=GS A0A1Q9E0V8_SYMMI/86-178     AC A0A1Q9E0V8.1
#=GS A0A6P5M545_PHACI/231-316    AC A0A6P5M545.1
#=GS M4EWV0_BRARP/63-153         AC M4EWV0.1
#=GS A9S6G5_PHYPA/17-113         AC A9S6G5.1
#=GS A0A061GR04_THECC/18-120     AC A0A061GR04.1
#=GS A0A2K6GLN6_PROCO/22-113     AC A0A2K6GLN6.1
#=GS J7S764_KAZNA/229-312        AC J7S764.1
#=GS A0A059BIC8_EUCGR/233-319    AC A0A059BIC8.1
#=GS A0A0Q4B269_9ARCH/16-102     AC A0A0Q4B269.1
#=GS A0A509AI60_PLABA/19-110     AC A0A509AI60.1
#=GS A0A094GEC3_9PEZI/64-151     AC A0A094GEC3.1
#=GS A0A1J9PR42_9EURO/229-312    AC A0A1J9PR42.1
#=GS A0A1U8JIR4_GOSHI/16-114     AC A0A1U8JIR4.1
#=GS A0A5D2Z0J4_GOSMU/17-119     AC A0A5D2Z0J4.1
#=GS I0YK96_COCSC/20-115         AC I0YK96.1
#=GS A0A6I8SKG2_XENTR/169-251    AC A0A6I8SKG2.1
#=GS RLA2_MOUSE/17-114           AC P99027.3
#=GS RLA2A_MAIZE/17-111          AC P46252.3
#=GS A0A2I0WBU6_9ASPA/18-108     AC A0A2I0WBU6.1
#=GS R0HZN3_9BRAS/233-319        AC R0HZN3.1
#=GS A0A1V6R9H6_9EURO/17-108     AC A0A1V6R9H6.1
#=GS L9KS94_TUPCH/44-138         AC L9KS94.1
#=GS A0A6A3DU44_9STRA/17-107     AC A0A6A3DU44.1
#=GS A0A6J2X8N7_SITOR/17-111     AC A0A6J2X8N7.1
#=GS A0A673X185_SALTR/17-116     AC A0A673X185.1
#=GS A0A383YW62_BALAS/19-94      AC A0A383YW62.1
#=GS A0A4D9A598_SALSN/25-119     AC A0A4D9A598.1
#=GS A0A5N7BFX2_9EURO/16-107     AC A0A5N7BFX2.1
#=GS A0A6A3NKD7_9STRA/231-311    AC A0A6A3NKD7.1
#=GS A0A095AN35_SCHHA/17-112     AC A0A095AN35.1
#=GS A0A0P7XY39_SCLFO/22-112     AC A0A0P7XY39.1
#=GS A0A2H5PJT9_CITUN/20-102     AC A0A2H5PJT9.1
#=GS A0A0F4GXM4_9PEZI/17-110     AC A0A0F4GXM4.1
#=GS A0A3P8TTM0_AMPPE/17-113     AC A0A3P8TTM0.1
#=GS S0E8J0_GIBF5/17-109         AC S0E8J0.1
#=GS A0A4Q4X8C7_9PEZI/229-311    AC A0A4Q4X8C7.1
#=GS A0A2V3IZH6_9FLOR/17-106     AC A0A2V3IZH6.1
#=GS A0A5E8BG66_9ASCO/21-107     AC A0A5E8BG66.1
#=GS A0A1Y2VIY1_9PEZI/229-312    AC A0A1Y2VIY1.1
#=GS A0A218NNM9_9ARCH/16-101     AC A0A218NNM9.1
#=GS A0A4Y7QFM8_9AGAM/229-313    AC A0A4Y7QFM8.1
#=GS E3S6K2_PYRTT/21-111         AC E3S6K2.1
#=GS A0A0V1K4Y5_TRIPS/231-318    AC A0A0V1K4Y5.1
#=GS A0A2K5JVY5_COLAP/231-317    AC A0A2K5JVY5.1
#=GS W7L7T8_9CREN/16-103         AC W7L7T8.1
#=GS A0A094AE68_9PEZI/66-153     AC A0A094AE68.1
#=GS G8YFW0_PICSO/80-163         AC G8YFW0.1
#=GS G3B9G8_CANTC/17-109         AC G3B9G8.1
#=GS R9T4G7_METII/9-101          AC R9T4G7.1
#=GS A0A061FL90_THECC/234-319    AC A0A061FL90.1
#=GS Q5CR36_CRYPI/239-317        AC Q5CR36.1
#=GS A0A1D1VXI9_RAMVA/22-113     AC A0A1D1VXI9.1
#=GS A0A365T938_9EURY/16-114     AC A0A365T938.1
#=GS A0A0V1PJV9_9BILA/22-119     AC A0A0V1PJV9.1
#=GS RLA2_BRUMA/18-113           AC P90703.1
#=GS A0A663ETR5_AQUCH/17-114     AC A0A663ETR5.1
#=GS A0A5N6KII1_9HELO/17-108     AC A0A5N6KII1.1
#=GS RLA2_CAEEL/17-106           AC O01504.2
#=GS A0A3S3PYQ8_9ACAR/238-320    AC A0A3S3PYQ8.1
#=GS A0A5E8B597_9ASCO/229-310    AC A0A5E8B597.1
#=GS A0A124SFA5_CYNCS/126-213    AC A0A124SFA5.1
#=GS H3GGS5_PHYRM/27-114         AC H3GGS5.1
#=GS F0YQD0_AURAN/17-110         AC F0YQD0.1
#=GS A0A1S7HUC7_9SACH/17-109     AC A0A1S7HUC7.1
#=GS A0A0F7IG78_9EURY/16-105     AC A0A0F7IG78.1
#=GS A0A6P4YAR9_BRABE/17-113     AC A0A6P4YAR9.1
#=GS A0A4S4EPU0_CAMSI/17-109     AC A0A4S4EPU0.1
#=GS A0A4P1RAG9_LUPAN/17-114     AC A0A4P1RAG9.1
#=GS W2QPS0_PHYPN/27-114         AC W2QPS0.1
#=GS A0A1J8QY12_9AGAM/30-119     AC A0A1J8QY12.1
#=GS A0A2V5GSV4_ASPV1/21-106     AC A0A2V5GSV4.1
#=GS A0A260ZCD4_9PELO/17-106     AC A0A260ZCD4.1
#=GS A0A2P5I356_9PEZI/229-312    AC A0A2P5I356.1
#=GS A0A3P7DZS8_WUCBA/189-250    AC A0A3P7DZS8.1
#=GS A0A026VZT8_OOCBI/231-316    AC A0A026VZT8.1
#=GS A0A024XF36_PLAFC/19-111     AC A0A024XF36.1
#=GS A0A0V0YPL7_9BILA/17-70      AC A0A0V0YPL7.1
#=GS A0BDW7_PARTE/34-121         AC A0BDW7.1
#=GS A0A1X2J0Q3_9FUNG/17-108     AC A0A1X2J0Q3.1
#=GS A0A1E4RSB0_9ASCO/17-105     AC A0A1E4RSB0.1
#=GS L1I8D2_GUITC/1-95           AC L1I8D2.1
#=GS A0A1V1SUP7_9FUNG/17-110     AC A0A1V1SUP7.1
#=GS A0A6J2PRD0_COTGO/17-116     AC A0A6J2PRD0.1
#=GS A0A507FI07_9FUNG/17-111     AC A0A507FI07.1
#=GS A0A2B7XFY1_9EURO/21-109     AC A0A2B7XFY1.1
#=GS A0A0A2L9T9_PENIT/17-107     AC A0A0A2L9T9.1
#=GS A0A6J1CGB2_MOMCH/21-110     AC A0A6J1CGB2.1
#=GS A0A6P5ZUY5_DURZI/234-321    AC A0A6P5ZUY5.1
#=GS A0A672UCN0_STRHB/231-317    AC A0A672UCN0.1
#=GS A0A183W8R7_TRIRE/17-114     AC A0A183W8R7.1
#=GS A0A1E3PRK0_9ASCO/229-310    AC A0A1E3PRK0.1
#=GS A0A2H0ZCD7_CANAR/50-139     AC A0A2H0ZCD7.1
#=GS K8EDG0_9CHLO/232-314        AC K8EDG0.1
#=GS D7EAE2_METEZ/16-105         AC D7EAE2.1
#=GS Q22XR4_TETTS/108-197        AC Q22XR4.2
#=GS A0A4X2LAL2_VOMUR/21-113     AC A0A4X2LAL2.1
#=GS G4T639_SERID/17-115         AC G4T639.1
#=GS RL10_THEKO/232-339          AC Q5JH36.1
#=GS B8D5P6_DESA1/16-106         AC B8D5P6.1
#=GS A0A0E0MTI5_ORYRU/53-118     AC A0A0E0MTI5.1
#=GS A0A2H3IC99_9EURO/229-312    AC A0A2H3IC99.1
#=GS J8Q3S6_SACAR/17-109         AC J8Q3S6.1
#=GS RLA4_YEAST/17-109           AC P02400.2
#=GS RLA4_YEAST/17-109           DR PDB; 3N2D B; 1-6;
#=GS RLA4_YEAST/17-109           DR PDB; 3N3X B; 1-6;
#=GS A0A0M9G2S6_9TRYP/238-325    AC A0A0M9G2S6.1
#=GS A0A1S7H870_9SACH/20-106     AC A0A1S7H870.1
#=GS A0A319DG01_9EURO/229-311    AC A0A319DG01.1
#=GS A0A024TZ76_9STRA/29-112     AC A0A024TZ76.1
#=GS A0A553PX30_9TELE/22-112     AC A0A553PX30.1
#=GS L9KM63_TUPCH/231-323        AC L9KM63.1
#=GS A0A1U8AI74_NELNU/21-110     AC A0A1U8AI74.1
#=GS W2ZH53_PHYPR/231-311        AC W2ZH53.1
#=GS K6VAU9_PLACD/32-118         AC K6VAU9.1
#=GS A0A0C3JZ86_PISTI/229-311    AC A0A0C3JZ86.1
#=GS A0A4Q4VAN5_9PEZI/21-110     AC A0A4Q4VAN5.1
#=GS RLA1_HUMAN/22-113           AC P05386.1
#=GS RLA1_HUMAN/22-113           DR PDB; 2LBF A; 22-69;
#=GS RLA1_HUMAN/22-113           DR PDB; 4BEH A; 22-113;
#=GS A0A544ZX35_9PEZI/21-107     AC A0A544ZX35.1
#=GS A0A2K5KWB2_CERAT/186-268    AC A0A2K5KWB2.1
#=GS A0A0C4EIJ4_PUCT1/17-111     AC A0A0C4EIJ4.1
#=GS M4CAU5_BRARP/233-320        AC M4CAU5.1
#=GS S2JPQ0_MUCC1/20-104         AC S2JPQ0.1
#=GS A0A1S3DWV9_CICAR/1-75       AC A0A1S3DWV9.1
#=GS A0A2G5D6W1_AQUCA/17-113     AC A0A2G5D6W1.1
#=GS A0A317SZA7_9PEZI/228-315    AC A0A317SZA7.1
#=GS A0A1U8NFT9_GOSHI/17-105     AC A0A1U8NFT9.1
#=GS L8IEM2_9CETA/10-83          AC L8IEM2.1
#=GS A0A0V0U7F6_9BILA/22-112     AC A0A0V0U7F6.1
#=GS A0A1U8P582_GOSHI/234-319    AC A0A1U8P582.1
#=GS A0A2G2VUC0_CAPBA/1-77       AC A0A2G2VUC0.1
#=GS F0LI19_THEBM/16-103         AC F0LI19.1
#=GS A0A0W8DX01_PHYNI/27-107     AC A0A0W8DX01.1
#=GS A0A6J2LDJ9_9CHIR/24-112     AC A0A6J2LDJ9.1
#=GS A0A2K6R6K1_RHIRO/5-102      AC A0A2K6R6K1.1
#=GS A0A2K5QM44_CEBIM/17-114     AC A0A2K5QM44.1
#=GS A0A059CSI3_EUCGR/16-119     AC A0A059CSI3.1
#=GS A0A1S4E3U5_CUCME/17-112     AC A0A1S4E3U5.1
#=GS A0A2H3E6B9_ARMGA/17-111     AC A0A2H3E6B9.1
#=GS K3ZVC4_SETIT/234-318        AC K3ZVC4.1
#=GS A0A5J4NYS6_9TREM/21-117     AC A0A5J4NYS6.1
#=GS A0A267G194_9PLAT/27-121     AC A0A267G194.1
#=GS W4KDF3_HETIT/229-312        AC W4KDF3.1
#=GS A0A7D5KKH9_9EURY/16-112     AC A0A7D5KKH9.1
#=GS G1UBJ0_METIK/16-101         AC G1UBJ0.1
#=GS A0A1S3PW10_SALSA/33-129     AC A0A1S3PW10.1
#=GS A0A139HJP5_9PEZI/17-112     AC A0A139HJP5.1
#=GS A0A3L6PF67_PANMI/16-119     AC A0A3L6PF67.1
#=GS Q2UKH6_ASPOR/229-312        AC Q2UKH6.1
#=GS A0A099P5Y8_PICKU/19-102     AC A0A099P5Y8.1
#=GS E1Z866_CHLVA/233-313        AC E1Z866.1
#=GS A0A177B0Y2_9BILA/25-109     AC A0A177B0Y2.1
#=GS G0QS62_ICHMG/241-325        AC G0QS62.1
#=GS A0A2N6NY00_BEABA/21-107     AC A0A2N6NY00.1
#=GS A0A6I9SZL2_SESIN/21-119     AC A0A6I9SZL2.1
#=GS A0A084WHE2_ANOSI/23-113     AC A0A084WHE2.1
#=GS A0A0V0X243_9BILA/22-119     AC A0A0V0X243.1
#=GS A0A096PAI6_OSTTA/229-310    AC A0A096PAI6.1
#=GS A0A1R3JJS3_COCAP/307-395    AC A0A1R3JJS3.1
#=GS H2LPR5_ORYLA/17-112         AC H2LPR5.1
#=GS A0A545A093_9PEZI/21-108     AC A0A545A093.1
#=GS A0A545AD34_9PEZI/230-312    AC A0A545AD34.1
#=GS A0A2T3Z8E0_9HYPO/21-108     AC A0A2T3Z8E0.1
#=GS A0A2R8ZWV3_PANPA/17-114     AC A0A2R8ZWV3.1
#=GS A0A5N5X1I4_9EURO/229-311    AC A0A5N5X1I4.1
#=GS A0A0D9WH38_9ORYZ/17-111     AC A0A0D9WH38.1
#=GS A0A183TEY4_SCHSO/17-115     AC A0A183TEY4.1
#=GS A0A0D1Z6K8_9EURO/17-113     AC A0A0D1Z6K8.1
#=GS A0A7H9B229_ZYGMR/17-110     AC A0A7H9B229.1
#=GS A0A0V1CZ80_TRIBR/231-319    AC A0A0V1CZ80.1
#=GS A0A6G1G7K6_9PEZI/229-313    AC A0A6G1G7K6.1
#=GS A0A0N4VYA0_HAEPC/17-71      AC A0A0N4VYA0.1
#=GS C1MX55_MICPC/17-108         AC C1MX55.1
#=GS G1QHI2_NOMLE/231-316        AC G1QHI2.3
#=GS L5LCV2_MYODS/2-92           AC L5LCV2.1
#=GS A0A6A5P2D0_LUPAL/253-337    AC A0A6A5P2D0.1
#=GS RLA25_ARATH/17-113          AC Q9LUK2.1
#=GS A0A091FQM0_9AVES/17-114     AC A0A091FQM0.1
#=GS A9PCM7_POPTR/17-112         AC A9PCM7.1
#=GS A0A1B7P4U5_9EURO/17-111     AC A0A1B7P4U5.1
#=GS A0A1S3C8T5_CUCME/17-114     AC A0A1S3C8T5.1
#=GS A0A397XNN1_BRACM/35-120     AC A0A397XNN1.1
#=GS S5Z820_9CREN/16-105         AC S5Z820.1
#=GS A0A6H5HSK8_9HEMI/17-114     AC A0A6H5HSK8.1
#=GS A0A067KDN6_JATCU/17-86      AC A0A067KDN6.1
#=GS A0A401L5J7_ASPAW/229-311    AC A0A401L5J7.1
#=GS A0A3P9P5U6_POERE/22-114     AC A0A3P9P5U6.1
#=GS A0A6J0YDX1_ODOVR/231-317    AC A0A6J0YDX1.1
#=GS A0A409YIH8_9AGAR/59-147     AC A0A409YIH8.1
#=GS A0A1S3ZR95_TOBAC/234-318    AC A0A1S3ZR95.1
#=GS RLA2_BOVIN/17-114           AC P42899.1
#=GS S9W177_SCHCR/17-108         AC S9W177.1
#=GS Q9U1X9_CAEEL/17-109         AC Q9U1X9.1
#=GS A0A6P6SX37_COFAR/17-113     AC A0A6P6SX37.1
#=GS A0A6J8BDM3_MYTCO/85-156     AC A0A6J8BDM3.1
#=GS Q4DWU6_TRYCC/16-106         AC Q4DWU6.1
#=GS Q5DBM5_SCHJA/17-114         AC Q5DBM5.1
#=GS A0A1B7MWK1_9AGAM/21-110     AC A0A1B7MWK1.1
#=GS A0A3B1IRI4_ASTMX/17-110     AC A0A3B1IRI4.1
#=GS A0A0L9UNI9_PHAAN/17-77      AC A0A0L9UNI9.1
#=GS A0A2S4PMA6_9PEZI/21-109     AC A0A2S4PMA6.1
#=GS C5Z967_SORBI/61-118         AC C5Z967.1
#=GS A0A0E0FJ28_ORYNI/53-118     AC A0A0E0FJ28.1
#=GS A0A642UMG5_DIURU/20-105     AC A0A642UMG5.1
#=GS A0A0P7V4N1_SCLFO/231-295    AC A0A0P7V4N1.1
#=GS A0A0X8V2L6_9ARCH/16-102     AC A0A0X8V2L6.1
#=GS A0A1S2Z8G7_CICAR/21-75      AC A0A1S2Z8G7.1
#=GS E4WQM2_OIKDI/20-106         AC E4WQM2.1
#=GS A0A669PEW4_PHACC/169-253    AC A0A669PEW4.1
#=GS A8A9N2_IGNH4/16-106         AC A8A9N2.1
#=GS A0A1U8FRL2_CAPAN/22-113     AC A0A1U8FRL2.1
#=GS A0A3M2T558_9EURO/229-308    AC A0A3M2T558.1
#=GS A0A423W645_9PEZI/21-107     AC A0A423W645.1
#=GS D7MFV8_ARALL/23-118         AC D7MFV8.1
#=GS A0A4Q1BRK1_TREME/24-113     AC A0A4Q1BRK1.1
#=GS A0A093Q0C2_9PASS/17-114     AC A0A093Q0C2.1
#=GS G0QTQ2_ICHMG/21-107         AC G0QTQ2.1
#=GS A0A1X2GV06_9FUNG/20-104     AC A0A1X2GV06.1
#=GS A0A340Y2K7_LIPVE/15-105     AC A0A340Y2K7.1
#=GS A0A7E6CXT0_9CHIR/248-329    AC A0A7E6CXT0.1
#=GS A0A6P3XXN6_DINQU/17-114     AC A0A6P3XXN6.1
#=GS A0A1L7X3R8_9HELO/21-109     AC A0A1L7X3R8.1
#=GS K5XEM2_AGABU/17-111         AC K5XEM2.1
#=GS A0A0S4IV06_BODSA/21-106     AC A0A0S4IV06.1
#=GS A0A177VL13_9BASI/21-108     AC A0A177VL13.1
#=GS C6T463_SOYBN/33-124         AC C6T463.1
#=GS F9XB28_ZYMTI/229-312        AC F9XB28.1
#=GS A0A5B0LRL1_PUCGR/229-311    AC A0A5B0LRL1.1
#=GS A0A2K6FQ69_PROCO/17-114     AC A0A2K6FQ69.1
#=GS A0A397XR95_BRACM/22-110     AC A0A397XR95.1
#=GS A0A2K6S5L2_SAIBB/22-113     AC A0A2K6S5L2.1
#=GS A2STT7_METLZ/16-102         AC A2STT7.1
#=GS A0A6J3Q112_TURTR/34-124     AC A0A6J3Q112.1
#=GS A0A4X2KQF5_VOMUR/21-109     AC A0A4X2KQF5.1
#=GS A0A367L5F5_9HYPO/17-110     AC A0A367L5F5.1
#=GS W5JMB2_ANODA/231-315        AC W5JMB2.1
#=GS A0A6A2ZGM1_HIBSY/23-113     AC A0A6A2ZGM1.1
#=GS A0A2K6UU45_SAIBB/17-114     AC A0A2K6UU45.1
#=GS D7G7B6_ECTSI/10-100         AC D7G7B6.1
#=GS A0A0L0D948_THETB/17-104     AC A0A0L0D948.1
#=GS A0A154NZP4_DUFNO/231-316    AC A0A154NZP4.1
#=GS F2X232_AILME/17-114         AC F2X232.1
#=GS A0A2C5WV68_9PEZI/17-107     AC A0A2C5WV68.1
#=GS A0A6I9SB91_ELAGV/71-162     AC A0A6I9SB91.1
#=GS A0A3P6S7H1_LITSI/65-160     AC A0A3P6S7H1.1
#=GS G8JUX7_ERECY/20-104         AC G8JUX7.1
#=GS N4V8B6_COLOR/17-109         AC N4V8B6.1
#=GS A0A6J1JAB2_CUCMA/47-136     AC A0A6J1JAB2.1
#=GS A0A5A8CCW5_CAFRO/665-750    AC A0A5A8CCW5.1
#=GS A0A341D826_NEOAA/22-113     AC A0A341D826.1
#=GS A0A0E0IXV3_ORYNI/687-772    AC A0A0E0IXV3.1
#=GS D7LPU7_ARALL/17-115         AC D7LPU7.1
#=GS A4FVF5_XENLA/17-110         AC A4FVF5.1
#=GS A0A2G9GVC5_9LAMI/17-114     AC A0A2G9GVC5.1
#=GS A0A498KJ55_MALDO/391-475    AC A0A498KJ55.1
#=GS A0A0R3SI00_HYMDI/231-320    AC A0A0R3SI00.1
#=GS A0A6P6EPZ4_OCTDE/232-317    AC A0A6P6EPZ4.1
#=GS A0A016VCV0_9BILA/17-92      AC A0A016VCV0.1
#=GS A0A1J6K3D1_NICAT/234-321    AC A0A1J6K3D1.1
#=GS A0A3A5W6R8_9ARCH/16-99      AC A0A3A5W6R8.1
#=GS G3SDP0_GORGO/231-316        AC G3SDP0.2
#=GS U6MU67_9EIME/9-107          AC U6MU67.1
#=GS A0A7H9HLM3_9SACH/17-110     AC A0A7H9HLM3.1
#=GS A2FUC9_TRIVA/17-102         AC A2FUC9.1
#=GS K3YIN8_SETIT/234-317        AC K3YIN8.1
#=GS A0A151X8W5_9HYME/231-317    AC A0A151X8W5.1
#=GS A0A061ED56_THECC/66-142     AC A0A061ED56.1
#=GS A0A6P6SF28_COFAR/234-321    AC A0A6P6SF28.1
#=GS A0A6A4JGC7_APOLU/1-90       AC A0A6A4JGC7.1
#=GS A0A4U0VR39_9BASI/229-312    AC A0A4U0VR39.1
#=GS R1EJ84_EMIHU/17-113         AC R1EJ84.1
#=GS A0A0D2DFG5_9EURO/229-314    AC A0A0D2DFG5.1
#=GS A0A6P8TPK2_GYMAC/22-112     AC A0A6P8TPK2.1
#=GS H2AX77_KAZAF/229-310        AC H2AX77.1
#=GS A0A267ERC2_9PLAT/15-105     AC A0A267ERC2.1
#=GS A0A4Y9Y6T2_9AGAM/17-110     AC A0A4Y9Y6T2.1
#=GS A0A059DCP2_EUCGR/17-105     AC A0A059DCP2.1
#=GS A0A0D3AWE2_BRAOL/17-112     AC A0A0D3AWE2.1
#=GS A0A6S7PIG6_LACSI/233-320    AC A0A6S7PIG6.1
#=GS A0A195CJ37_9HYME/231-317    AC A0A195CJ37.1
#=GS A0A1U7QK56_MESAU/22-113     AC A0A1U7QK56.1
#=GS M0CQB0_9EURY/16-113         AC M0CQB0.1
#=GS A0A200R957_9MAGN/51-120     AC A0A200R957.1
#=GS A0A507DXA6_9FUNG/23-108     AC A0A507DXA6.1
#=GS Q12UP7_METBU/16-99          AC Q12UP7.1
#=GS A0A367XQY6_9ASCO/20-106     AC A0A367XQY6.1
#=GS U1HEL1_ENDPU/17-113         AC U1HEL1.1
#=GS A0A2H0ZMX0_CANAR/20-107     AC A0A2H0ZMX0.1
#=GS A0A7H8QQJ9_9EURO/21-109     AC A0A7H8QQJ9.1
#=GS D4AV09_ARTBC/21-109         AC D4AV09.1
#=GS A0A017S3R6_9EURO/229-310    AC A0A017S3R6.1
#=GS I1JPZ4_SOYBN/17-112         AC I1JPZ4.1
#=GS W4J340_PLAFP/1-47           AC W4J340.1
#=GS A0A165CDA1_9APHY/229-314    AC A0A165CDA1.1
#=GS A0A5N7CRZ9_PETAA/229-311    AC A0A5N7CRZ9.1
#=GS A0A5C7IWG5_9ROSI/17-112     AC A0A5C7IWG5.1
#=GS A0A1F5LFD3_9EURO/229-312    AC A0A1F5LFD3.1
#=GS A0A4U5P4J4_POPAL/19-124     AC A0A4U5P4J4.1
#=GS A0A5N4CV35_CAMDR/1-90       AC A0A5N4CV35.1
#=GS A0A0D2BED2_9EURO/17-112     AC A0A0D2BED2.1
#=GS A0A0D2VUN1_CAPO3/231-314    AC A0A0D2VUN1.1
#=GS A0A2T7D2R2_9POAL/21-108     AC A0A2T7D2R2.1
#=GS A0A4W6DP41_LATCA/1-86       AC A0A4W6DP41.1
#=GS A0A5J5AKM5_9ASTE/329-414    AC A0A5J5AKM5.1
#=GS A0A6I9T1P4_SESIN/44-130     AC A0A6I9T1P4.1
#=GS I3J3T8_ORENI/22-113         AC I3J3T8.1
#=GS F4Q1Q9_CAVFA/17-102         AC F4Q1Q9.1
#=GS M7T3Z7_9ARCH/16-107         AC M7T3Z7.1
#=GS A0A063BT28_USTVR/22-108     AC A0A063BT28.1
#=GS A0A6I9RRH0_ELAGV/23-121     AC A0A6I9RRH0.1
#=GS A0A3Q0EHY5_CARSF/180-265    AC A0A3Q0EHY5.1
#=GS A0A2H3CEN0_9AGAR/229-311    AC A0A2H3CEN0.1
#=GS A0A3S0Z9A8_ELYCH/231-315    AC A0A3S0Z9A8.1
#=GS A0A0G2K4Q1_RAT/60-92        AC A0A0G2K4Q1.1
#=GS G7KGX1_MEDTR/234-320        AC G7KGX1.1
#=GS A0A0V0X2Y9_9BILA/251-339    AC A0A0V0X2Y9.1
#=GS A0A1S7HIY6_9SACH/20-106     AC A0A1S7HIY6.1
#=GS A0A3L6QLE0_PANMI/158-238    AC A0A3L6QLE0.1
#=GS A0A1C7NK93_9FUNG/20-105     AC A0A1C7NK93.1
#=GS A0A1J4L1F2_9EUKA/21-105     AC A0A1J4L1F2.1
#=GS A0A2A9PE40_9HYPO/229-312    AC A0A2A9PE40.1
#=GS A0A319C0N5_9EURO/17-108     AC A0A319C0N5.1
#=GS A0A4U0XIG1_9PEZI/17-112     AC A0A4U0XIG1.1
#=GS A0A094E2H5_9PEZI/60-137     AC A0A094E2H5.1
#=GS A0A3Q7PBY0_CALUR/8-86       AC A0A3Q7PBY0.1
#=GS A0A091D0U3_FUKDA/22-113     AC A0A091D0U3.1
#=GS I7MA52_TETTS/93-183         AC I7MA52.2
#=GS A0A484F2Q4_9EURY/16-100     AC A0A484F2Q4.1
#=GS A0A1S3E015_CICAR/21-111     AC A0A1S3E015.1
#=GS A0A0D2MQK0_HYPSF/229-311    AC A0A0D2MQK0.1
#=GS A0A1J1H4Q7_PLARL/32-117     AC A0A1J1H4Q7.1
#=GS A0A1L9PUF3_ASPVE/17-113     AC A0A1L9PUF3.1
#=GS B6H919_PENRW/229-311        AC B6H919.1
#=GS A0A4P1RD60_LUPAN/17-112     AC A0A4P1RD60.1
#=GS I2GVW8_TETBL/16-105         AC I2GVW8.1
#=GS A0A2K5N115_CERAT/13-96      AC A0A2K5N115.1
#=GS U1QTC0_9EURY/16-113         AC U1QTC0.1
#=GS A0A654GPP4_9CEST/17-117     AC A0A654GPP4.1
#=GS A0A0D3DC34_BRAOL/17-112     AC A0A0D3DC34.1
#=GS A0A7H8QHC0_9EURO/229-312    AC A0A7H8QHC0.1
#=GS A0A5N7B1R9_9EURO/21-107     AC A0A5N7B1R9.1
#=GS C6H5J3_AJECH/21-109         AC C6H5J3.1
#=GS A0A2K5JI75_COLAP/22-113     AC A0A2K5JI75.1
#=GS J9K3E2_ACYPI/23-110         AC J9K3E2.1
#=GS A0A4Z1NNC7_9PEZI/17-110     AC A0A4Z1NNC7.1
#=GS A0A6J1PBK3_BICAN/22-111     AC A0A6J1PBK3.1
#=GS A0A0Q4B8R9_9ARCH/231-332    AC A0A0Q4B8R9.1
#=GS A0A3Q2ZEU3_KRYMA/17-114     AC A0A3Q2ZEU3.1
#=GS A0A6H5JK28_9PHAE/110-193    AC A0A6H5JK28.1
#=GS A0A2U3V2E1_TURTR/22-113     AC A0A2U3V2E1.1
#=GS M1D5E9_SOLTU/21-107         AC M1D5E9.1
#=GS A4I2U1_LEIIN/238-323        AC A4I2U1.1
#=GS A0A6J1CC92_MOMCH/49-139     AC A0A6J1CC92.1
#=GS A0A6P9E0H4_JUGRE/234-320    AC A0A6P9E0H4.1
#=GS A0A060S2P3_PYCCI/21-109     AC A0A060S2P3.1
#=GS A0A6P5N2H7_ARADU/24-119     AC A0A6P5N2H7.1
#=GS Q7PNA9_ANOGA/23-112         AC Q7PNA9.4
#=GS V8NRP9_OPHHA/69-153         AC V8NRP9.1
#=GS A0A2J8XS55_PONAB/17-114     AC A0A2J8XS55.1
#=GS A0A2N1JFU1_9BASI/21-109     AC A0A2N1JFU1.1
#=GS A0A182XZS7_ANOST/37-127     AC A0A182XZS7.1
#=GS G3HDY7_CRIGR/192-273        AC G3HDY7.1
#=GS A0A0B0MIG5_GOSAR/166-252    AC A0A0B0MIG5.1
#=GS H0XF20_OTOGA/17-114         AC H0XF20.1
#=GS A0A2H3E459_ARMGA/229-311    AC A0A2H3E459.1
#=GS A0A3L6R9C2_PANMI/17-111     AC A0A3L6R9C2.1
#=GS B9SNZ6_RICCO/35-121         AC B9SNZ6.1
#=GS Q29N41_DROPS/22-111         AC Q29N41.1
#=GS A0A238C5U1_9BILA/23-118     AC A0A238C5U1.1
#=GS H2P057_PONAB/231-311        AC H2P057.1
#=GS B4N0U4_DROWI/22-112         AC B4N0U4.1
#=GS B7GA61_PHATC/17-105         AC B7GA61.1
#=GS A0A1L8I062_XENLA/231-313    AC A0A1L8I062.1
#=GS A0A6P6TNA6_COFAR/17-93      AC A0A6P6TNA6.1
#=GS A0A6P7Y273_9AMPH/17-95      AC A0A6P7Y273.1
#=GS A0A6A3TGI9_9STRA/231-311    AC A0A6A3TGI9.1
#=GS A0A6P6SGQ7_COFAR/17-115     AC A0A6P6SGQ7.1
#=GS A0A0D3HR34_9ORYZ/795-880    AC A0A0D3HR34.1
#=GS A0A399GB34_9PLEO/21-110     AC A0A399GB34.1
#=GS A0A6A5C0J5_NAEFO/17-109     AC A0A6A5C0J5.1
#=GS L5LJH3_MYODS/63-135         AC L5LJH3.1
#=GS A0A6P4DF40_ARADU/17-112     AC A0A6P4DF40.1
#=GS A0A2I0WBT7_9ASPA/23-114     AC A0A2I0WBT7.1
#=GS M4E983_BRARP/17-112         AC M4E983.1
#=GS A0A068XUG9_ECHMU/22-120     AC A0A068XUG9.1
#=GS A0A078IFI2_BRANA/35-119     AC A0A078IFI2.1
#=GS A0A4X2M2D4_VOMUR/17-114     AC A0A4X2M2D4.1
#=GS A0A2P5EC79_TREOI/17-114     AC A0A2P5EC79.1
#=GS A0A6P3ZZZ8_ZIZJJ/21-110     AC A0A6P3ZZZ8.1
#=GS A0A453HLF7_AEGTS/235-320    AC A0A453HLF7.1
#=GS A0A6J1DWE3_MOMCH/234-319    AC A0A6J1DWE3.1
#=GS A0A427A297_ENSVE/48-131     AC A0A427A297.1
#=GS A0A0L0SPN6_ALLM3/231-310    AC A0A0L0SPN6.1
#=GS L0AAV7_CALLD/21-108         AC L0AAV7.1
#=GS A0A6J1SFT5_FRAOC/22-112     AC A0A6J1SFT5.1
#=GS A0A1B7NG81_9AGAM/17-89      AC A0A1B7NG81.1
#=GS A0A2V1APR2_9ASCO/29-118     AC A0A2V1APR2.1
#=GS A0A4S3JS17_9EURO/17-108     AC A0A4S3JS17.1
#=GS A0A4X2LR94_VOMUR/193-268    AC A0A4X2LR94.1
#=GS A0A3R7KRR7_TRYRA/21-106     AC A0A3R7KRR7.1
#=GS A0A6P7ZGA7_9AMPH/231-313    AC A0A6P7ZGA7.1
#=GS A0A2K5HM78_COLAP/23-114     AC A0A2K5HM78.1
#=GS RLA1_SCHPO/21-108           AC P17476.1
#=GS F2U1N9_SALR5/229-310        AC F2U1N9.1
#=GS A0A5N6ZXZ7_9EURO/229-312    AC A0A5N6ZXZ7.1
#=GS A0A341CR56_NEOAA/34-125     AC A0A341CR56.1
#=GS A0A5J5BAB8_9ASTE/33-120     AC A0A5J5BAB8.1
#=GS A0A5N5QWZ9_9AGAM/246-328    AC A0A5N5QWZ9.1
#=GS A0A4D8ZCA8_SALSN/17-110     AC A0A4D8ZCA8.1
#=GS A0A4D8ZHL7_SALSN/201-285    AC A0A4D8ZHL7.1
#=GS A4SAM0_OSTLU/232-312        AC A4SAM0.1
#=GS A0A518SD21_9EURY/16-111     AC A0A518SD21.1
#=GS B4LE06_DROVI/231-316        AC B4LE06.1
#=GS A0A0G4KSX6_9PEZI/192-274    AC A0A0G4KSX6.1
#=GS A0A195BNB3_9HYME/231-317    AC A0A195BNB3.1
#=GS A0A0C2YUF0_9AGAM/21-110     AC A0A0C2YUF0.1
#=GS A0A2J7QH48_9NEOP/17-115     AC A0A2J7QH48.1
#=GS A0A6Q2YUZ2_ESOLU/17-87      AC A0A6Q2YUZ2.1
#=GS A0A1E3H9Z9_9TREE/229-313    AC A0A1E3H9Z9.1
#=GS A0A238F902_9BASI/229-310    AC A0A238F902.1
#=GS A0A074XFT6_AURPU/17-108     AC A0A074XFT6.1
#=GS A0A4P9XCV8_9FUNG/23-106     AC A0A4P9XCV8.1
#=GS A0A0D9WTS8_9ORYZ/58-119     AC A0A0D9WTS8.1
#=GS Q5ANH5_CANAL/17-110         AC Q5ANH5.1
#=GS A0A1R2BCH2_9CILI/246-329    AC A0A1R2BCH2.1
#=GS A0A165UA00_9AGAM/17-111     AC A0A165UA00.1
#=GS F4WNI7_ACREC/22-109         AC F4WNI7.1
#=GS A0A067Q3X5_9AGAM/17-111     AC A0A067Q3X5.1
#=GS L8HQG6_9CETA/67-158         AC L8HQG6.1
#=GS A0A5A7PM87_STRAF/426-513    AC A0A5A7PM87.1
#=GS F4PNB1_CAVFA/622-701        AC F4PNB1.1
#=GS M2XVP1_GALSU/18-114         AC M2XVP1.1
#=GS A0A670IAX3_PODMU/22-112     AC A0A670IAX3.1
#=GS A0A024UC28_9STRA/26-113     AC A0A024UC28.1
#=GS A0A093NXI2_PYGAD/17-114     AC A0A093NXI2.1
#=GS B9PJK1_TOXGV/19-112         AC B9PJK1.1
#=GS A0A285N6F7_9EURY/16-115     AC A0A285N6F7.1
#=GS A0A0D0D097_9AGAR/229-311    AC A0A0D0D097.1
#=GS A0A2K5MZV3_CERAT/17-114     AC A0A2K5MZV3.1
#=GS A0A7N5JYN0_AILME/17-97      AC A0A7N5JYN0.1
#=GS A0A2U3VT92_ODORO/22-113     AC A0A2U3VT92.1
#=GS L0KZG3_METHD/16-101         AC L0KZG3.1
#=GS A0A087TID0_STEMI/17-104     AC A0A087TID0.1
#=GS RLA6_SCHPO/17-109           AC O14317.2
#=GS A0A1X7RAJ0_9SACH/229-311    AC A0A1X7RAJ0.1
#=GS A0A319A0L1_9EURO/229-311    AC A0A319A0L1.1
#=GS A0A498JQY0_MALDO/21-112     AC A0A498JQY0.1
#=GS A0A3Q4HJH9_NEOBR/169-251    AC A0A3Q4HJH9.1
#=GS A0A093XNG5_9PEZI/54-141     AC A0A093XNG5.1
#=GS A0A6P6U1E3_COFAR/17-113     AC A0A6P6U1E3.1
#=GS A0A2C9UCL2_MANES/21-111     AC A0A2C9UCL2.1
#=GS A0A3P3R9T0_9EURY/16-110     AC A0A3P3R9T0.1
#=GS A0A0K0CUE7_ANGCA/18-89      AC A0A0K0CUE7.1
#=GS A0A671E1K9_RHIFE/17-114     AC A0A671E1K9.1
#=GS A0A371DXW1_9APHY/229-309    AC A0A371DXW1.1
#=GS A0A151ZJ20_9MYCE/227-306    AC A0A151ZJ20.1
#=GS A0A660KM69_9ROSI/17-111     AC A0A660KM69.1
#=GS H3AB03_LATCH/17-111         AC H3AB03.1
#=GS A0A1V9YFB0_9STRA/29-111     AC A0A1V9YFB0.1
#=GS A0A1U7LUW1_NEOID/172-253    AC A0A1U7LUW1.1
#=GS A0A0F9XN31_TRIHA/21-107     AC A0A0F9XN31.1
#=GS RLA22_ARATH/17-114          AC Q9SLF7.1
#=GS A0A671L6T8_9TELE/220-301    AC A0A671L6T8.1
#=GS A0A251TCE4_HELAN/61-156     AC A0A251TCE4.1
#=GS A0A1E5REY8_9ASCO/16-107     AC A0A1E5REY8.1
#=GS N1PQL2_DOTSN/21-111         AC N1PQL2.1
#=GS A0A139A309_GONPJ/26-117     AC A0A139A309.1
#=GS A0A2G3CRU5_CAPCH/234-317    AC A0A2G3CRU5.1
#=GS A0A1Y1UL69_9FUNG/57-146     AC A0A1Y1UL69.1
#=GS A0A2U1MNZ9_ARTAN/36-88      AC A0A2U1MNZ9.1
#=GS I2GVA9_TETBL/17-108         AC I2GVA9.1
#=GS A0A5C3QH39_9AGAR/21-109     AC A0A5C3QH39.1
#=GS A0A1X0NTR3_9TRYP/20-106     AC A0A1X0NTR3.1
#=GS A0A0F4G702_9PEZI/21-110     AC A0A0F4G702.1
#=GS M4D695_BRARP/17-112         AC M4D695.1
#=GS A0A1Y3N6M7_PIRSE/228-312    AC A0A1Y3N6M7.1
#=GS A0A4Z2HE25_9TELE/53-119     AC A0A4Z2HE25.1
#=GS A0A504XRE9_LEIDO/18-83      AC A0A504XRE9.1
#=GS A0A395HG37_ASPHC/229-312    AC A0A395HG37.1
#=GS A0A653D3Y2_CALMS/169-250    AC A0A653D3Y2.1
#=GS A0A2P6VJE0_9CHLO/21-105     AC A0A2P6VJE0.1
#=GS A0A6J0BQI5_NEOLC/231-315    AC A0A6J0BQI5.1
#=GS V9F855_PHYPR/231-311        AC V9F855.1
#=GS A0A0D7BGG0_9AGAR/229-311    AC A0A0D7BGG0.1
#=GS A0A422NFR1_TRYRA/238-325    AC A0A422NFR1.1
#=GS A0A540NQQ4_MALBA/21-110     AC A0A540NQQ4.1
#=GS A0A2R6S280_ACTCC/44-117     AC A0A2R6S280.1
#=GS I1H2D6_BRADI/17-109         AC I1H2D6.1
#=GS A0A2J6SGP2_9HELO/17-112     AC A0A2J6SGP2.1
#=GS A0A167XV60_9PEZI/17-109     AC A0A167XV60.1
#=GS A0A1D5PMT8_CHICK/17-114     AC A0A1D5PMT8.1
#=GS Q0PXZ8_DIACI/22-112         AC Q0PXZ8.1
#=GS A0A6I9LC57_PERMB/28-97      AC A0A6I9LC57.1
#=GS A0A151NXJ6_ALLMI/43-118     AC A0A151NXJ6.1
#=GS A0A4Y7L3T0_PAPSO/234-319    AC A0A4Y7L3T0.1
#=GS A0A3P9DP53_9CICH/169-252    AC A0A3P9DP53.1
#=GS A0A2G3CXU2_CAPCH/21-109     AC A0A2G3CXU2.1
#=GS A0A087UME9_STEMI/2-70       AC A0A087UME9.1
#=GS A0A395H949_9EURO/17-108     AC A0A395H949.1
#=GS A0A165GAE5_9APHY/17-81      AC A0A165GAE5.1
#=GS V7BL51_PHAVU/17-113         AC V7BL51.1
#=GS A0A0C2YV85_HEBCY/17-110     AC A0A0C2YV85.1
#=GS R8BRB9_TOGMI/21-109         AC R8BRB9.1
#=GS A0A2U3V7H1_TURTR/22-113     AC A0A2U3V7H1.1
#=GS A0A6P5ZIL8_DURZI/17-112     AC A0A6P5ZIL8.1
#=GS A0A109FEK9_9BASI/17-109     AC A0A109FEK9.1
#=GS A0A0R3UK10_9CEST/17-121     AC A0A0R3UK10.1
#=GS W2SC27_9EURO/21-113         AC W2SC27.1
#=GS A0A5B6WLN2_9ROSI/234-320    AC A0A5B6WLN2.1
#=GS B8CG46_THAPS/231-316        AC B8CG46.1
#=GS A0A168CTC5_9EURO/21-109     AC A0A168CTC5.1
#=GS A4S7T7_OSTLU/17-106         AC A4S7T7.1
#=GS A0A165T2J2_9AGAM/7-97       AC A0A165T2J2.1
#=GS A0A672ZBE8_9TELE/22-112     AC A0A672ZBE8.1
#=GS A0A4D6H965_9EURY/16-113     AC A0A4D6H965.1
#=GS C1GLK3_PARBD/21-110         AC C1GLK3.1
#=GS G4MKJ9_MAGO7/229-312        AC G4MKJ9.1
#=GS V4KPP2_EUTSA/17-114         AC V4KPP2.1
#=GS A0A2T7ED55_9POAL/52-146     AC A0A2T7ED55.1
#=GS A0A200QQZ5_9MAGN/21-108     AC A0A200QQZ5.1
#=GS A0A1S3LEC7_SALSA/81-176     AC A0A1S3LEC7.1
#=GS A0A1A6GCN7_NEOLE/30-86      AC A0A1A6GCN7.1
#=GS A0A195B898_9HYME/22-109     AC A0A195B898.1
#=GS A0A5M6C704_9TREE/229-314    AC A0A5M6C704.1
#=GS A0A2V0PQA9_9CHLO/17-107     AC A0A2V0PQA9.1
#=GS A0A4U0VIG9_9PEZI/259-343    AC A0A4U0VIG9.1
#=GS A0A2U3YCF3_LEPWE/17-114     AC A0A2U3YCF3.1
#=GS A0A1D2VIL8_9ASCO/12-104     AC A0A1D2VIL8.1
#=GS A0A395TAT1_9HYPO/228-310    AC A0A395TAT1.1
#=GS J3MJT3_ORYBR/17-122         AC J3MJT3.1
#=GS A0A0D9Y5M9_9ORYZ/53-118     AC A0A0D9Y5M9.1
#=GS A0A0V1I0I6_9BILA/231-318    AC A0A0V1I0I6.1
#=GS A0A0R3PL14_ANGCS/17-112     AC A0A0R3PL14.1
#=GS A0A0U5G341_9EURO/229-313    AC A0A0U5G341.1
#=GS J4UJH5_BEAB2/17-110         AC J4UJH5.1
#=GS A0A0D3C2E8_BRAOL/17-112     AC A0A0D3C2E8.1
#=GS A0A1V6QLN2_9EURO/17-107     AC A0A1V6QLN2.1
#=GS A0A670ZIR1_PSETE/22-112     AC A0A670ZIR1.1
#=GS A0A093BVF1_TAUER/207-293    AC A0A093BVF1.1
#=GS A0A091CK14_FUKDA/177-262    AC A0A091CK14.1
#=GS A0A1U8N2L0_GOSHI/234-320    AC A0A1U8N2L0.1
#=GS A0A3B6RNX6_WHEAT/36-119     AC A0A3B6RNX6.1
#=GS A0A024W572_PLAFA/231-315    AC A0A024W572.1
#=GS A0A0D2N385_GOSRA/17-115     AC A0A0D2N385.1
#=GS A0A1X2G9F4_9FUNG/20-104     AC A0A1X2G9F4.1
#=GS A0A445CPM4_ARAHY/21-112     AC A0A445CPM4.1
#=GS A0A7F8RI09_LEPWE/23-106     AC A0A7F8RI09.1
#=GS A0A6G1CZ77_9ORYZ/17-68      AC A0A6G1CZ77.1
#=GS A0A078JT63_BRANA/15-83      AC A0A078JT63.1
#=GS A0A0S3STC7_PHAAN/17-113     AC A0A0S3STC7.1
#=GS A0A0E0CLG0_9ORYZ/586-681    AC A0A0E0CLG0.1
#=GS A0A6P7M4I2_BETSP/17-114     AC A0A6P7M4I2.1
#=GS A0A6P5RZH9_PRUAV/17-113     AC A0A6P5RZH9.1
#=GS A0A0M9FQ02_9TRYP/85-173     AC A0A0M9FQ02.1
#=GS K7MZ77_SOYBN/17-112         AC K7MZ77.1
#=GS A0A094HEI7_9PEZI/63-140     AC A0A094HEI7.1
#=GS A2EIR1_TRIVA/17-105         AC A2EIR1.1
#=GS A0A067S6N2_GALM3/41-133     AC A0A067S6N2.1
#=GS A0A392TXT2_9FABA/1-40       AC A0A392TXT2.1
#=GS A0A074WAS3_9PEZI/21-108     AC A0A074WAS3.1
#=GS A0A0S3SHC8_PHAAN/21-111     AC A0A0S3SHC8.1
#=GS A0A0E0EHH4_9ORYZ/234-318    AC A0A0E0EHH4.1
#=GS B3S1Z8_TRIAD/22-109         AC B3S1Z8.1
#=GS A0A2X0LVZ8_9BASI/229-310    AC A0A2X0LVZ8.1
#=GS B0DA55_LACBS/229-311        AC B0DA55.1
#=GS A0A251SQ67_HELAN/56-152     AC A0A251SQ67.1
#=GS A0A4D9E3F7_9SAUR/22-111     AC A0A4D9E3F7.1
#=GS A0A5J9SIL3_9POAL/234-318    AC A0A5J9SIL3.1
#=GS A0A0L0C8Z6_LUCCU/22-112     AC A0A0L0C8Z6.1
#=GS A0A087VLU5_BALRE/213-295    AC A0A087VLU5.1
#=GS X6NNN7_RETFI/14-130         AC X6NNN7.1
#=GS A0A1G4JZC9_9SACH/17-107     AC A0A1G4JZC9.1
#=GS A0A078G324_BRANA/22-110     AC A0A078G324.1
#=GS S7Q1Q1_MYOBR/22-112         AC S7Q1Q1.1
#=GS A0A1X2G5R7_9FUNG/17-106     AC A0A1X2G5R7.1
#=GS A0A6N0NRF6_9EURY/16-104     AC A0A6N0NRF6.1
#=GS J3LDF6_ORYBR/17-112         AC J3LDF6.1
#=GS A7E8S1_SCLS1/17-111         AC A7E8S1.1
#=GS A0A2Y9K3H1_ENHLU/22-113     AC A0A2Y9K3H1.1
#=GS A0A2I2F2Z6_9EURO/17-106     AC A0A2I2F2Z6.1
#=GS D3ZJT4_RAT/193-278          AC D3ZJT4.3
#=GS C6T1E4_SOYBN/17-113         AC C6T1E4.1
#=GS L9XJ51_9EURY/16-116         AC L9XJ51.1
#=GS A0A1U7YB93_NICSY/22-111     AC A0A1U7YB93.1
#=GS A0A4X2LGD8_VOMUR/29-120     AC A0A4X2LGD8.1
#=GS Q6BGT0_DEBHA/20-104         AC Q6BGT0.1
#=GS A0A1U8K049_GOSHI/23-110     AC A0A1U8K049.1
#=GS F4IGR5_ARATH/35-126         AC F4IGR5.1
#=GS A0A167A7K5_METRR/17-109     AC A0A167A7K5.1
#=GS R7TGE7_CAPTE/231-306        AC R7TGE7.1
#=GS A0A7N5JLF0_AILME/231-309    AC A0A7N5JLF0.1
#=GS A0A5N6PUI7_9ASTR/21-109     AC A0A5N6PUI7.1
#=GS A0A1Y2BVI4_9FUNG/23-113     AC A0A1Y2BVI4.1
#=GS A0A663M1W1_ATHCN/231-317    AC A0A663M1W1.1
#=GS I2H6R1_TETBL/229-311        AC I2H6R1.1
#=GS A0A150VEX9_9PEZI/21-110     AC A0A150VEX9.1
#=GS A0A251UIM0_HELAN/8-94       AC A0A251UIM0.1
#=GS A0A0P7B2G0_9HYPO/21-107     AC A0A0P7B2G0.1
#=GS A0A094ASH8_9PEZI/229-310    AC A0A094ASH8.1
#=GS A0A388MF19_CHABU/234-322    AC A0A388MF19.1
#=GS A0A1B8C7A3_9PEZI/17-109     AC A0A1B8C7A3.1
#=GS A0A367LQI1_9HYPO/22-110     AC A0A367LQI1.1
#=GS A0A1Y2F3F5_9BASI/20-106     AC A0A1Y2F3F5.1
#=GS R9NZM7_PSEHS/230-312        AC R9NZM7.1
#=GS A0A0W7VSD8_9HYPO/21-107     AC A0A0W7VSD8.1
#=GS A0A401RRE6_CHIPU/231-311    AC A0A401RRE6.1
#=GS A0A2I0RXH8_9PEZI/17-57      AC A0A2I0RXH8.1
#=GS A0A2K6L8Y5_RHIBE/219-301    AC A0A2K6L8Y5.1
#=GS A0A4T0FFK2_9BASI/17-107     AC A0A4T0FFK2.1
#=GS S8APN6_DACHA/21-108         AC S8APN6.1
#=GS W7LXA2_GIBM7/229-312        AC W7LXA2.1
#=GS M3YCB9_MUSPF/19-116         AC M3YCB9.1
#=GS A0A1R3IP07_COCAP/234-320    AC A0A1R3IP07.1
#=GS A0A4U0W265_9BASI/21-107     AC A0A4U0W265.1
#=GS I7J968_BABMR/21-107         AC I7J968.1
#=GS A0A3M6VKE8_9STRA/27-112     AC A0A3M6VKE8.1
#=GS A0A2U1KYD5_ARTAN/186-272    AC A0A2U1KYD5.1
#=GS A0A4Y7KB61_PAPSO/22-111     AC A0A4Y7KB61.1
#=GS M0SWA9_MUSAM/234-318        AC M0SWA9.1
#=GS A0A0L7REM3_9HYME/16-112     AC A0A0L7REM3.1
#=GS A0A5D2XRH3_GOSMU/234-320    AC A0A5D2XRH3.1
#=GS C7YQC5_FUSV7/228-309        AC C7YQC5.1
#=GS A0A0D2TLY9_GOSRA/17-112     AC A0A0D2TLY9.1
#=GS U5DHQ6_AMBTC/17-117         AC U5DHQ6.1
#=GS A0A6A5LT48_LUPAL/58-146     AC A0A6A5LT48.1
#=GS A0A1A8YW79_9APIC/218-300    AC A0A1A8YW79.1
#=GS A0A1J8QFZ6_9AGAM/17-110     AC A0A1J8QFZ6.1
#=GS A0A1Y2GJH5_9FUNG/17-109     AC A0A1Y2GJH5.1
#=GS A0A6P8H8Z8_ACTTE/22-110     AC A0A6P8H8Z8.1
#=GS A0A3S2LR49_CHISP/290-373    AC A0A3S2LR49.1
#=GS L8GPQ3_ACACA/232-322        AC L8GPQ3.1
#=GS A0A5C3EJ43_9BASI/230-312    AC A0A5C3EJ43.1
#=GS A0A0M0JB82_9EUKA/232-325    AC A0A0M0JB82.1
#=GS G4ZT58_PHYSP/27-112         AC G4ZT58.1
#=GS A0A4Q4TN40_9PEZI/229-311    AC A0A4Q4TN40.1
#=GS A0A452F1F7_CAPHI/17-114     AC A0A452F1F7.1
#=GS A0A2P5C4Q5_TREOI/17-112     AC A0A2P5C4Q5.1
#=GS A0A1Y2HST7_9FUNG/21-110     AC A0A1Y2HST7.1
#=GS A0A2V3J612_9FLOR/22-104     AC A0A2V3J612.1
#=GS G0QFB8_NANS0/16-102         AC G0QFB8.1
#=GS H0ERP3_GLAL7/17-111         AC H0ERP3.1
#=GS A0A0A2VU65_BEABA/21-107     AC A0A0A2VU65.1
#=GS A2DI07_TRIVA/20-103         AC A2DI07.1
#=GS W2ZYT7_PHYPR/27-114         AC W2ZYT7.1
#=GS A0A162R9D5_MUCCL/228-307    AC A0A162R9D5.1
#=GS A0A0E0F2E3_9ORYZ/722-807    AC A0A0E0F2E3.1
#=GS A0A0J9EAQ8_9RHOB/16-99      AC A0A0J9EAQ8.1
#=GS A0A1Y2DLM8_9PEZI/226-312    AC A0A1Y2DLM8.1
#=GS A7TPM0_VANPO/16-106         AC A7TPM0.1
#=GS A0A5A7SLD3_CUCME/3-89       AC A0A5A7SLD3.1
#=GS A0A482VCV7_9CUCU/22-110     AC A0A482VCV7.1
#=GS G1NA41_MELGA/17-114         AC G1NA41.2
#=GS S9WQI4_CAMFR/1-92           AC S9WQI4.1
#=GS A0EAT4_PARTE/17-112         AC A0EAT4.1
#=GS A0A1U8PQ91_GOSHI/17-113     AC A0A1U8PQ91.1
#=GS A0A0N0RXU2_9EURO/229-311    AC A0A0N0RXU2.1
#=GS I1JS37_SOYBN/21-102         AC I1JS37.1
#=GS A0A6S7KXN0_LACSI/37-119     AC A0A6S7KXN0.1
#=GS A0A4W5QVX3_9TELE/3-52       AC A0A4W5QVX3.1
#=GS A0A024VN04_PLAFA/9-66       AC A0A024VN04.1
#=GS G8JV68_ERECY/229-311        AC G8JV68.1
#=GS B5DGC7_SALSA/231-314        AC B5DGC7.1
#=GS V9EUP6_PHYPR/27-114         AC V9EUP6.1
#=GS M4C7I1_BRARP/234-318        AC M4C7I1.1
#=GS A0A1D6FKX5_MAIZE/25-119     AC A0A1D6FKX5.1
#=GS Q9HL72_THEAC/10-105         AC Q9HL72.1
#=GS A0A6H5HAI3_9HEMI/231-313    AC A0A6H5HAI3.1
#=GS A0A484BQA1_DRONA/22-111     AC A0A484BQA1.1
#=GS A0A5N5I4T5_9ROSA/2-75       AC A0A5N5I4T5.1
#=GS B9SEJ7_RICCO/21-109         AC B9SEJ7.1
#=GS A0A1Y2WHB6_9PEZI/21-109     AC A0A1Y2WHB6.1
#=GS A0A1U8L658_GOSHI/22-113     AC A0A1U8L658.1
#=GS A0A0L9UA58_PHAAN/211-295    AC A0A0L9UA58.1
#=GS A2WLK9_ORYSI/17-113         AC A2WLK9.1
#=GS A0A0G4NWQ8_PENCA/17-107     AC A0A0G4NWQ8.1
#=GS A0A022R988_ERYGU/17-114     AC A0A022R988.1
#=GS A0A2G2Z109_CAPAN/17-114     AC A0A2G2Z109.1
#=GS A0A6A2WHQ2_HIBSY/21-107     AC A0A6A2WHQ2.1
#=GS A0A2H3U1X8_FUSOX/17-109     AC A0A2H3U1X8.1
#=GS A0A0D2HGP3_9EURO/17-113     AC A0A0D2HGP3.1
#=GS A0A137R1G9_9AGAR/21-109     AC A0A137R1G9.1
#=GS RLA2_ASPFU/17-110           AC Q9UUZ6.2
#=GS A0A1Y1VD95_9FUNG/17-107     AC A0A1Y1VD95.1
#=GS A0A135UZE1_9PEZI/21-108     AC A0A135UZE1.1
#=GS A0A1S3V1S5_VIGRR/17-113     AC A0A1S3V1S5.1
#=GS A0A2K6ANA7_MACNE/22-113     AC A0A2K6ANA7.1
#=GS F7GPD3_CALJA/22-113         AC F7GPD3.1
#=GS A0A2T0FHJ7_9ASCO/17-107     AC A0A2T0FHJ7.1
#=GS G9NNF9_HYPAI/17-109         AC G9NNF9.1
#=GS I2JTS8_DEKBR/23-113         AC I2JTS8.1
#=GS A0A2P5WBN3_GOSBA/22-64      AC A0A2P5WBN3.1
#=GS A0A287CUL9_ICTTR/205-285    AC A0A287CUL9.1
#=GS A0A517KWZ2_9PEZI/227-311    AC A0A517KWZ2.1
#=GS A7TRI9_VANPO/20-105         AC A7TRI9.1
#=GS A0A251UPU1_HELAN/234-320    AC A0A251UPU1.1
#=GS G3B2H7_CANTC/24-114         AC G3B2H7.1
#=GS A0A4Q9Q1D4_9APHY/17-112     AC A0A4Q9Q1D4.1
#=GS A0A482VB80_9CUCU/231-315    AC A0A482VB80.1
#=GS A0A0E0Q290_ORYRU/57-118     AC A0A0E0Q290.1
#=GS K0KCA6_WICCF/20-111         AC K0KCA6.1
#=GS V4MWJ8_EUTSA/22-112         AC V4MWJ8.1
#=GS A0A0Q0VR99_9ARCH/16-103     AC A0A0Q0VR99.1
#=GS A0A0F4ZHZ3_9PEZI/229-312    AC A0A0F4ZHZ3.1
#=GS G2YZN2_BOTF4/229-311        AC G2YZN2.1
#=GS A0A2P6RBL5_ROSCH/17-111     AC A0A2P6RBL5.1
#=GS RLA4_SCHPO/17-109           AC P17478.1
#=GS A0A2Z2HVZ5_9EURY/16-111     AC A0A2Z2HVZ5.1
#=GS A0A2X0N9P0_9BASI/17-110     AC A0A2X0N9P0.1
#=GS A0A803JZQ7_XENTR/17-93      AC A0A803JZQ7.1
#=GS A0A367JRV4_RHIST/102-181    AC A0A367JRV4.1
#=GS A0A3P9QIE7_POERE/17-113     AC A0A3P9QIE7.1
#=GS A0A150FUL6_GONPE/21-106     AC A0A150FUL6.1
#=GS A0A1R3RPW4_ASPC5/17-104     AC A0A1R3RPW4.1
#=GS A0A5N4C935_CAMDR/231-318    AC A0A5N4C935.1
#=GS A0A0K9PTP6_ZOSMR/17-110     AC A0A0K9PTP6.1
#=GS A0A2Y9JNW5_ENHLU/17-114     AC A0A2Y9JNW5.1
#=GS A0A553I0Y9_9PEZI/229-312    AC A0A553I0Y9.1
#=GS A0A093Q1J4_9PASS/231-317    AC A0A093Q1J4.1
#=GS A0A1S3XMA7_TOBAC/17-110     AC A0A1S3XMA7.1
#=GS A0A074VQP9_9PEZI/21-108     AC A0A074VQP9.1
#=GS Q5I7K5_WHEAT/21-109         AC Q5I7K5.1
#=GS A0A2P6Q4N1_ROSCH/17-103     AC A0A2P6Q4N1.1
#=GS E1RJY9_METP4/16-102         AC E1RJY9.1
#=GS H1VUX6_COLHI/17-109         AC H1VUX6.1
#=GS A0A2U1KVQ7_ARTAN/61-121     AC A0A2U1KVQ7.1
#=GS A0A392VBJ7_9FABA/1-49       AC A0A392VBJ7.1
#=GS M2Y4X8_GALSU/230-318        AC M2Y4X8.1
#=GS A0A1S3E061_CICAR/8-98       AC A0A1S3E061.2
#=GS A9U0Z9_PHYPA/17-114         AC A9U0Z9.1
#=GS A0A388M5E2_CHABU/17-115     AC A0A388M5E2.1
#=GS A0A6I9JBA0_CHRAS/22-101     AC A0A6I9JBA0.1
#=GS A0A1Q9BWW4_SYMMI/23-119     AC A0A1Q9BWW4.1
#=GS A0A1I7VVN4_LOALO/60-159     AC A0A1I7VVN4.1
#=GS A0A2B7Z3Z2_9EURO/21-107     AC A0A2B7Z3Z2.1
#=GS A0A4Y7K8F6_PAPSO/17-111     AC A0A4Y7K8F6.1
#=GS A0A0D2SI41_GOSRA/23-110     AC A0A0D2SI41.1
#=GS D5U264_THEAM/16-104         AC D5U264.1
#=GS Q6P5K5_DANRE/22-112         AC Q6P5K5.1
#=GS B5DGX0_SALSA/17-112         AC B5DGX0.1
#=GS G8YNS3_PICSO/17-107         AC G8YNS3.1
#=GS B2ATQ3_PODAN/17-110         AC B2ATQ3.1
#=GS W6YB45_COCCA/21-119         AC W6YB45.1
#=GS Q69UI8_ORYSJ/21-109         AC Q69UI8.1
#=GS A0A0V1BWB0_TRISP/178-267    AC A0A0V1BWB0.1
#=GS A0A0U1LS43_TALIS/21-110     AC A0A0U1LS43.1
#=GS A0A4X2L1B2_VOMUR/17-115     AC A0A4X2L1B2.1
#=GS A0A1S2Y8Z9_CICAR/234-321    AC A0A1S2Y8Z9.1
#=GS A0A6P7FBB2_DIAVI/17-112     AC A0A6P7FBB2.1
#=GS A0A067E181_CITSI/25-120     AC A0A067E181.1
#=GS A0A2K6KI11_RHIBE/220-306    AC A0A2K6KI11.1
#=GS A0A0F4Z4N1_TALEM/229-311    AC A0A0F4Z4N1.1
#=GS A0A0D2H0D6_9EURO/21-113     AC A0A0D2H0D6.1
#=GS A0A068UFH5_COFCA/17-113     AC A0A068UFH5.1
#=GS A0A2V1AWK2_9ASCO/17-109     AC A0A2V1AWK2.1
#=GS A0A0D2QAP7_GOSRA/17-112     AC A0A0D2QAP7.1
#=GS A0A168PKS2_ABSGL/24-88      AC A0A168PKS2.1
#=GS A0A0B0MDL8_GOSAR/17-119     AC A0A0B0MDL8.1
#=GS A0A6A5BNK1_NAEFO/30-117     AC A0A6A5BNK1.1
#=GS A0A0L0T5V5_ALLM3/17-107     AC A0A0L0T5V5.1
#=GS A0A1G4JK94_9SACH/17-105     AC A0A1G4JK94.1
#=GS A0A3M6VA89_9STRA/272-360    AC A0A3M6VA89.1
#=GS A0A452E2X4_CAPHI/25-115     AC A0A452E2X4.1
#=GS A0A6S7MD48_LACSI/234-320    AC A0A6S7MD48.1
#=GS A0A0Q3H814_BRADI/17-95      AC A0A0Q3H814.1
#=GS A0A0D3B7B5_BRAOL/17-113     AC A0A0D3B7B5.1
#=GS W5JPX9_ANODA/23-101         AC W5JPX9.1
#=GS A9P894_POPTR/17-113         AC A9P894.1
#=GS A0A0D3F5X5_9ORYZ/402-497    AC A0A0D3F5X5.1
#=GS A0A397V9K6_9GLOM/21-110     AC A0A397V9K6.1
#=GS J9FK46_9SPIT/60-140         AC J9FK46.1
#=GS A0A0D3CLR0_BRAOL/233-320    AC A0A0D3CLR0.1
#=GS A0A421J789_9ASCO/229-309    AC A0A421J789.1
#=GS V4M9T3_EUTSA/209-296        AC V4M9T3.1
#=GS D7LEE5_ARALL/234-316        AC D7LEE5.1
#=GS F4R3M9_MELLP/229-309        AC F4R3M9.1
#=GS A0A5D2U7A3_GOSMU/17-113     AC A0A5D2U7A3.1
#=GS A0A1S3TZJ4_VIGRR/21-111     AC A0A1S3TZJ4.1
#=GS A0A367JY24_RHIAZ/20-104     AC A0A367JY24.1
#=GS A0A2A2L4J1_9BILA/17-112     AC A0A2A2L4J1.1
#=GS A0A196SNE7_BLAHN/234-318    AC A0A196SNE7.1
#=GS A0A7M7P932_STRPU/17-110     AC A0A7M7P932.1
#=GS A0A317VIH2_9EURO/17-107     AC A0A317VIH2.1
#=GS A0A6J2VZU8_CHACN/18-90      AC A0A6J2VZU8.1
#=GS A0A179FY22_METCM/229-312    AC A0A179FY22.1
#=GS I3EDG3_NEMP3/17-100         AC I3EDG3.1
#=GS A0A3P9P679_POERE/22-92      AC A0A3P9P679.1
#=GS A0A2N3NHT4_9PEZI/228-312    AC A0A2N3NHT4.1
#=GS A0A2V3JLF4_9EURY/16-109     AC A0A2V3JLF4.1
#=GS A0A6A3AVK8_HIBSY/22-112     AC A0A6A3AVK8.1
#=GS A0A2K5XU17_MANLE/17-113     AC A0A2K5XU17.1
#=GS A0A4V6A9I9_POPAL/20-122     AC A0A4V6A9I9.1
#=GS A0A6I9T3T1_SESIN/234-320    AC A0A6I9T3T1.1
#=GS A0A2H6K6Z4_9APIC/32-117     AC A0A2H6K6Z4.1
#=GS RL12_METJA/16-101           AC P54048.1
#=GS A0A1Y1WDH5_9FUNG/21-106     AC A0A1Y1WDH5.1
#=GS W9YCK1_9EURO/17-112         AC W9YCK1.1
#=GS A0A2R6X0W3_MARPO/17-113     AC A0A2R6X0W3.1
#=GS A0A5N5IBH9_9ROSA/38-129     AC A0A5N5IBH9.1
#=GS A0A3Q7E7T6_SOLLC/21-111     AC A0A3Q7E7T6.1
#=GS A0A2K5KHQ3_CERAT/17-114     AC A0A2K5KHQ3.1
#=GS A3LPG9_PICST/20-106         AC A3LPG9.1
#=GS A0A3P7L895_STRVU/229-311    AC A0A3P7L895.1
#=GS A0A078JAM1_BRANA/234-317    AC A0A078JAM1.1
#=GS A0A482S986_9ARCH/231-316    AC A0A482S986.1
#=GS A0A1V6Y2X6_PENNA/17-108     AC A0A1V6Y2X6.1
#=GS A0A367K354_RHIAZ/20-106     AC A0A367K354.1
#=GS A0A4Y7QJ75_9AGAM/42-132     AC A0A4Y7QJ75.1
#=GS A0A395RXE3_FUSSP/21-108     AC A0A395RXE3.1
#=GS A0A0D0AC10_9AGAM/21-111     AC A0A0D0AC10.1
#=GS A0A3N4K9D5_9PEZI/21-111     AC A0A3N4K9D5.1
#=GS A0A2K6N290_RHIBE/22-107     AC A0A2K6N290.1
#=GS A0A673ZTD4_SALTR/17-111     AC A0A673ZTD4.1
#=GS L9KWE4_TUPCH/13-90          AC L9KWE4.1
#=GS A0A445K978_GLYSO/21-94      AC A0A445K978.1
#=GS A0A1Y2FGH4_PROLT/17-109     AC A0A1Y2FGH4.1
#=GS A0A2V1ANK5_9ASCO/20-106     AC A0A2V1ANK5.1
#=GS A0A671KNF6_9TELE/17-113     AC A0A671KNF6.1
#=GS G0S079_CHATD/17-111         AC G0S079.1
#=GS A0A0A1N974_RHIZD/20-106     AC A0A0A1N974.1
#=GS L5KN85_PTEAL/17-114         AC L5KN85.1
#=GS A0A1D6FPC0_MAIZE/40-121     AC A0A1D6FPC0.1
#=GS A4H3L0_LEIBR/21-105         AC A4H3L0.2
#=GS A0A1J6IH17_NICAT/22-111     AC A0A1J6IH17.1
#=GS R0FYN6_9BRAS/17-113         AC R0FYN6.1
#=GS A0A318ZEZ4_9EURO/21-107     AC A0A318ZEZ4.1
#=GS RLA03_ARATH/233-320         AC P57691.1
#=GS A0A3L6QWD9_PANMI/17-111     AC A0A3L6QWD9.1
#=GS A0A653HGY5_9APIC/231-315    AC A0A653HGY5.1
#=GS L5KF91_PTEAL/141-216        AC L5KF91.1
#=GS A0A1A8VZC5_PLAMA/32-118     AC A0A1A8VZC5.1
#=GS D8LP25_ECTSI/194-276        AC D8LP25.1
#=GS A0A1E4TFQ6_9ASCO/20-108     AC A0A1E4TFQ6.1
#=GS A0A453BXP3_AEGTS/17-108     AC A0A453BXP3.1
#=GS A0A2S6C146_9PEZI/17-111     AC A0A2S6C146.1
#=GS A0A444C0E2_ENSVE/66-160     AC A0A444C0E2.1
#=GS A0A2I3FRW1_NOMLE/161-230    AC A0A2I3FRW1.1
#=GS A0A166DPC9_9EURY/16-100     AC A0A166DPC9.1
#=GS I1C401_RHIO9/20-105         AC I1C401.1
#=GS A0A0D2VSS8_GOSRA/186-272    AC A0A0D2VSS8.1
#=GS A0A1Y1YV42_9FUNG/20-105     AC A0A1Y1YV42.1
#=GS A0A5B0LMR1_PUCGR/229-311    AC A0A5B0LMR1.1
#=GS D7FZX8_ECTSI/66-150         AC D7FZX8.1
#=GS A0A024X6S0_PLAFC/32-117     AC A0A024X6S0.1
#=GS A0A2K6E2B8_MACNE/43-93      AC A0A2K6E2B8.1
#=GS A0A6A2ZYH3_HIBSY/17-111     AC A0A6A2ZYH3.1
#=GS A0A0L0N2X0_TOLOC/21-97      AC A0A0L0N2X0.1
#=GS M0C479_9EURY/30-119         AC M0C479.1
#=GS A0A1U7Z0P0_NELNU/17-113     AC A0A1U7Z0P0.1
#=GS A0A444YD77_ARAHY/234-321    AC A0A444YD77.1
#=GS G9MJN9_HYPVG/21-107         AC G9MJN9.1
#=GS A0A0M9G6H9_9TRYP/16-106     AC A0A0M9G6H9.1
#=GS A0A6P8P4J0_GEOSA/17-74      AC A0A6P8P4J0.1
#=GS W7JSZ3_PLAFO/231-315        AC W7JSZ3.1
#=GS A0A5N6HS26_9EURO/21-107     AC A0A5N6HS26.1
#=GS A0A484ATA0_DRONA/20-117     AC A0A484ATA0.1
#=GS N1JC20_BLUG1/21-109         AC N1JC20.1
#=GS A0A0H1B6I4_9EURO/17-71      AC A0A0H1B6I4.1
#=GS A0A2P7YT23_9ASCO/229-309    AC A0A2P7YT23.1
#=GS L9VME7_9EURY/16-113         AC L9VME7.1
#=GS S7QDW7_MYOBR/36-121         AC S7QDW7.1
#=GS A0A2K3QLL8_9HYPO/229-311    AC A0A2K3QLL8.1
#=GS A0A1S4B492_TOBAC/22-114     AC A0A1S4B492.1
#=GS A0A2P5HU79_9PEZI/17-110     AC A0A2P5HU79.1
#=GS A0A671E1E3_RHIFE/22-113     AC A0A671E1E3.1
#=GS A0A3P7EE49_WUCBA/231-299    AC A0A3P7EE49.1
#=GS A9P8R9_POPTR/21-109         AC A9P8R9.1
#=GS G0W5B5_NAUDC/16-105         AC G0W5B5.1
#=GS A0A4U5M0U7_STECR/231-306    AC A0A4U5M0U7.1
#=GS A0A3P7IJA0_STRVU/22-124     AC A0A3P7IJA0.1
#=GS A0A5N3XLH4_MUNRE/22-113     AC A0A5N3XLH4.1
#=GS A0A1V6N526_9EURY/230-338    AC A0A1V6N526.1
#=GS A0A512U9B9_9ASCO/20-105     AC A0A512U9B9.1
#=GS A0A0B7NHQ5_9FUNG/17-102     AC A0A0B7NHQ5.1
#=GS E9DE71_COCPS/229-311        AC E9DE71.1
#=GS A0A6P7INT3_9TELE/17-115     AC A0A6P7INT3.1
#=GS A0A1V8UUC9_9PEZI/17-112     AC A0A1V8UUC9.1
#=GS A0A665TMX5_ECHNA/231-312    AC A0A665TMX5.1
#=GS A0A061DRB7_THECC/54-124     AC A0A061DRB7.1
#=GS A0A0L0V2H7_9BASI/17-112     AC A0A0L0V2H7.1
#=GS A0A0D3EC30_BRAOL/24-120     AC A0A0D3EC30.1
#=GS A0A5N6D871_ASPPA/17-108     AC A0A5N6D871.1
#=GS A0A2K6Q2A2_RHIRO/154-237    AC A0A2K6Q2A2.1
#=GS G3QN05_GORGO/18-88          AC G3QN05.2
#=GS A0A383WG65_TETOB/233-313    AC A0A383WG65.1
#=GS A0A0A2IJH7_PENEN/229-311    AC A0A0A2IJH7.1
#=GS A0A2I1CAX7_ASPN1/239-322    AC A0A2I1CAX7.1
#=GS A0A670KF64_PODMU/169-252    AC A0A670KF64.1
#=GS A0A6I9W0D4_BACDO/6-86       AC A0A6I9W0D4.1
#=GS W7TDP6_9STRA/29-116         AC W7TDP6.1
#=GS A0A1B8C4V5_9PEZI/229-311    AC A0A1B8C4V5.1
#=GS A0A4S4DBB0_CAMSI/139-230    AC A0A4S4DBB0.1
#=GS A0A0B2UJS3_9MICR/16-102     AC A0A0B2UJS3.1
#=GS A0A662X689_9STRA/29-124     AC A0A662X689.1
#=GS A0A421JN70_9ASCO/229-312    AC A0A421JN70.1
#=GS Q7S796_NEUCR/21-108         AC Q7S796.1
#=GS A0A2R6R0Z9_9APHY/21-109     AC A0A2R6R0Z9.1
#=GS A0A1G4AWP6_9PEZI/17-110     AC A0A1G4AWP6.1
#=GS Q5CRL2_CRYPI/32-121         AC Q5CRL2.1
#=GS M7TCF8_9ARCH/16-100         AC M7TCF8.1
#=GS A0A2Y9HD41_NEOSC/22-113     AC A0A2Y9HD41.1
#=GS A0A1L9TCF4_9EURO/229-311    AC A0A1L9TCF4.1
#=GS A0A100IL88_ASPNG/17-109     AC A0A100IL88.1
#=GS A0A0L0SVI2_ALLM3/21-74      AC A0A0L0SVI2.1
#=GS C5M7W4_CANTT/17-109         AC C5M7W4.1
#=GS A0A218V367_9PASE/231-317    AC A0A218V367.1
#=GS D7M357_ARALL/20-84          AC D7M357.1
#=GS L8HHW3_ACACA/30-120         AC L8HHW3.1
#=GS J3KX68_ORYBR/175-270        AC J3KX68.1
#=GS A0A0J8CB08_BETVV/311-382    AC A0A0J8CB08.1
#=GS A0A0A1NW39_RHIZD/17-107     AC A0A0A1NW39.1
#=GS B3GUY4_SCHJA/231-316        AC B3GUY4.1
#=GS U6GIL0_EIMAC/19-112         AC U6GIL0.1
#=GS A0A2K5EAG9_AOTNA/17-102     AC A0A2K5EAG9.1
#=GS A0A118JWU7_CYNCS/51-119     AC A0A118JWU7.1
#=GS A0A2K6LAX5_RHIBE/22-113     AC A0A2K6LAX5.1
#=GS A0A6J0M0A4_RAPSA/17-113     AC A0A6J0M0A4.1
#=GS A0A1C7N3E0_9FUNG/17-108     AC A0A1C7N3E0.1
#=GS J4CCW5_THEOR/19-109         AC J4CCW5.1
#=GS A0A1Q6DTC4_9EURY/16-99      AC A0A1Q6DTC4.1
#=GS A0A5J4YPD5_PORPP/228-313    AC A0A5J4YPD5.1
#=GS A0A5N5MWH7_PANHP/17-114     AC A0A5N5MWH7.1
#=GS Q5B161_EMENI/21-108         AC Q5B161.1
#=GS C5DQ37_ZYGRC/20-107         AC C5DQ37.1
#=GS A0A061HIZ5_BLUGR/17-109     AC A0A061HIZ5.1
#=GS A0A4S8IFX7_MUSBA/21-120     AC A0A4S8IFX7.1
#=GS A0A369HHP6_9HYPO/17-110     AC A0A369HHP6.1
#=GS A0A0E0F294_9ORYZ/228-313    AC A0A0E0F294.1
#=GS A0A4Z1L5Y3_9HELO/17-110     AC A0A4Z1L5Y3.1
#=GS A0A1E4RRL4_9ASCO/229-310    AC A0A1E4RRL4.1
#=GS H9B912_EIMTE/32-121         AC H9B912.1
#=GS A0A151GML1_9HYPO/229-311    AC A0A151GML1.1
#=GS A0A178AEL0_9PLEO/23-114     AC A0A178AEL0.1
#=GS A0A0Q3MBG8_AMAAE/78-175     AC A0A0Q3MBG8.1
#=GS A0A2U3W6P4_ODORO/17-114     AC A0A2U3W6P4.1
#=GS A0A5M6C0P3_9TREE/33-129     AC A0A5M6C0P3.1
#=GS R9P2N1_PSEHS/52-138         AC R9P2N1.1
#=GS A0A498SK54_ACAVI/21-117     AC A0A498SK54.1
#=GS A0A6I9KX34_PERMB/22-104     AC A0A6I9KX34.1
#=GS A0A0D2MTN5_9CHLO/21-105     AC A0A0D2MTN5.1
#=GS A0A2T4BU01_TRILO/17-110     AC A0A2T4BU01.1
#=GS A0A5N6Z4X2_9EURO/17-109     AC A0A5N6Z4X2.1
#=GS A0A103XH98_CYNCS/17-114     AC A0A103XH98.1
#=GS A0A0C9MD30_9FUNG/17-106     AC A0A0C9MD30.1
#=GS A0A6A2YQM3_HIBSY/19-94      AC A0A6A2YQM3.1
#=GS A0A4P9ZZQ8_9FUNG/17-109     AC A0A4P9ZZQ8.1
#=GS G2YND2_BOTF4/17-110         AC G2YND2.1
#=GS A0A384BDS6_BALAS/22-113     AC A0A384BDS6.1
#=GS R1BXG8_EMIHU/66-128         AC R1BXG8.1
#=GS A0A1U7ZST4_NELNU/234-318    AC A0A1U7ZST4.1
#=GS A0A6G1AW22_CROCR/213-298    AC A0A6G1AW22.1
#=GS B0CUH7_LACBS/17-111         AC B0CUH7.1
#=GS A0A1D6FKZ1_MAIZE/25-119     AC A0A1D6FKZ1.1
#=GS A0A2H5NJP1_CITUN/234-318    AC A0A2H5NJP1.1
#=GS A0A067NRR6_PLEOS/17-111     AC A0A067NRR6.1
#=GS A0A2I0VF36_9ASPA/30-123     AC A0A2I0VF36.1
#=GS A0A1J9REG0_9PEZI/229-312    AC A0A1J9REG0.1
#=GS A0A0P7BLS0_9HYPO/229-311    AC A0A0P7BLS0.1
#=GS C5KMM7_PERM5/17-108         AC C5KMM7.1
#=GS A0A1E3QGY1_9ASCO/20-105     AC A0A1E3QGY1.1
#=GS A2WMF3_ORYSI/53-118         AC A2WMF3.1
#=GS A0A0R3T310_RODNA/22-117     AC A0A0R3T310.1
#=GS A0A0C7N2Z3_9SACH/19-105     AC A0A0C7N2Z3.1
#=GS A0A2K6F355_PROCO/231-317    AC A0A2K6F355.1
#=GS A0A1V4L2F9_PATFA/22-65      AC A0A1V4L2F9.1
#=GS A0A2R6W7D8_MARPO/21-109     AC A0A2R6W7D8.1
#=GS A0A0D7B7R6_9AGAR/20-107     AC A0A0D7B7R6.1
#=GS A0A087S8N5_9ARCH/16-104     AC A0A087S8N5.1
#=GS W5MX37_LEPOC/17-113         AC W5MX37.1
#=GS H2AWZ4_KAZAF/20-106         AC H2AWZ4.1
#=GS K3ZAW7_SETIT/17-111         AC K3ZAW7.1
#=GS A0A668U343_OREAU/231-314    AC A0A668U343.1
#=GS A0A2T7DUJ1_9POAL/22-119     AC A0A2T7DUJ1.1
#=GS A0A0D9ZZX9_9ORYZ/17-112     AC A0A0D9ZZX9.1
#=GS A0A137PF35_CONC2/17-108     AC A0A137PF35.1
#=GS A0A2V1DQ70_9PLEO/25-81      AC A0A2V1DQ70.1
#=GS S7MGA9_MYOBR/17-114         AC S7MGA9.1
#=GS A0A428TJP4_9HYPO/229-309    AC A0A428TJP4.1
#=GS A0A166C8D7_DAUCS/86-182     AC A0A166C8D7.1
#=GS A0A183KFV1_9TREM/17-112     AC A0A183KFV1.1
#=GS A0A6J1YQ01_ACIJB/17-114     AC A0A6J1YQ01.1
#=GS A0A1U7LWC9_NEOID/21-108     AC A0A1U7LWC9.1
#=GS A0A5A7QQN7_STRAF/69-158     AC A0A5A7QQN7.1
#=GS A0A672T3G5_SINGR/22-89      AC A0A672T3G5.1
#=GS A0A1G4M880_LACFM/229-310    AC A0A1G4M880.1
#=GS A0A4U1FQJ0_MONMO/80-161     AC A0A4U1FQJ0.1
#=GS D4AQF6_ARTBC/17-112         AC D4AQF6.1
#=GS A0A096MLS9_PAPAN/15-111     AC A0A096MLS9.2
#=GS A0A2U1S5R8_9EURY/16-100     AC A0A2U1S5R8.1
#=GS D7DR74_METV3/238-336        AC D7DR74.1
#=GS A0A1S2Z7B4_CICAR/21-111     AC A0A1S2Z7B4.1
#=GS A0A2K5R3Q2_CEBIM/22-113     AC A0A2K5R3Q2.1
#=GS A0A1G4IT97_9SACH/17-109     AC A0A1G4IT97.1
#=GS L8IM91_9CETA/34-102         AC L8IM91.1
#=GS A0A3R7LMG3_9TRYP/238-325    AC A0A3R7LMG3.1
#=GS V4M5E8_EUTSA/22-112         AC V4M5E8.1
#=GS Q0CTP9_ASPTN/21-107         AC Q0CTP9.1
#=GS A0A2G5VTM5_9PELO/22-110     AC A0A2G5VTM5.1
#=GS A0A0D2N962_9CHLO/233-312    AC A0A0D2N962.1
#=GS C1G5J1_PARBD/17-112         AC C1G5J1.1
#=GS A0A2R5GRA8_9STRA/17-107     AC A0A2R5GRA8.1
#=GS X6MF38_RETFI/17-128         AC X6MF38.1
#=GS A0A4Q7JFV4_METCM/12-72      AC A0A4Q7JFV4.1
#=GS A0A0P1B0G7_PLAHL/231-311    AC A0A0P1B0G7.1
#=GS A0A0N4TX79_BRUPA/21-117     AC A0A0N4TX79.1
#=GS A0A093J7C0_EURHL/17-114     AC A0A093J7C0.1
#=GS A0A4U5Q220_POPAL/21-109     AC A0A4U5Q220.1
#=GS A0A0N5D0F2_THECL/231-316    AC A0A0N5D0F2.1
#=GS E3NNU7_CAERE/17-106         AC E3NNU7.1
#=GS A0A7D5C2I8_9EURY/16-113     AC A0A7D5C2I8.1
#=GS B8P0N4_POSPM/17-112         AC B8P0N4.1
#=GS A0A1J4JHT4_9EUKA/17-104     AC A0A1J4JHT4.1
#=GS A0A5N6QBV1_9ROSI/233-320    AC A0A5N6QBV1.1
#=GS Q8H3F5_ORYSJ/17-107         AC Q8H3F5.1
#=GS B8LU13_TALSN/21-110         AC B8LU13.1
#=GS A0A1X2IEN1_9FUNG/228-308    AC A0A1X2IEN1.1
#=GS A0A0D3HR33_9ORYZ/795-880    AC A0A0D3HR33.1
#=GS A0A2G5U6B9_9PELO/17-109     AC A0A2G5U6B9.1
#=GS A0A6I9W5H9_9HYME/17-113     AC A0A6I9W5H9.1
#=GS A0A2I0WEA4_9ASPA/155-222    AC A0A2I0WEA4.1
#=GS A0A1R2B392_9CILI/17-111     AC A0A1R2B392.1
#=GS A0A0K8LH41_9EURO/17-109     AC A0A0K8LH41.1
#=GS A0A162U7I4_PHYB8/17-107     AC A0A162U7I4.1
#=GS A0A1C7N841_9FUNG/17-107     AC A0A1C7N841.1
#=GS V4SWS1_CITCL/48-143         AC V4SWS1.1
#=GS A0A4W5JXP7_9TELE/17-112     AC A0A4W5JXP7.1
#=GS A0A2A2LXZ0_9BILA/22-111     AC A0A2A2LXZ0.1
#=GS A0A428QJF5_9HYPO/229-299    AC A0A428QJF5.1
#=GS A0A0V0X2Y4_9BILA/231-319    AC A0A0V0X2Y4.1
#=GS A0A6A6MYY8_HEVBR/172-258    AC A0A6A6MYY8.1
#=GS A0A4S2LVX2_OPIFE/231-321    AC A0A4S2LVX2.1
#=GS A9UW12_MONBE/229-309        AC A9UW12.1
#=GS A0A6I9YKT5_9SAUR/231-314    AC A0A6I9YKT5.1
#=GS A0A4U8V4Z5_STECR/17-83      AC A0A4U8V4Z5.1
#=GS A0A024WY34_PLAFA/19-108     AC A0A024WY34.1
#=GS A0A4D9BZM9_SALSN/17-115     AC A0A4D9BZM9.1
#=GS A0A2K5XQB9_MANLE/22-113     AC A0A2K5XQB9.1
#=GS A0A643ATX1_BALPH/1-57       AC A0A643ATX1.1
#=GS Q201W9_ACYPI/231-313        AC Q201W9.1
#=GS A0A314XV27_PRUYE/207-290    AC A0A314XV27.1
#=GS A0A1R3I165_9ROSI/234-320    AC A0A1R3I165.1
#=GS A0A0C4E8M8_MAGP6/21-108     AC A0A0C4E8M8.1
#=GS A0A7E6CGA6_9CHIR/54-145     AC A0A7E6CGA6.1
#=GS A0A1X2HWM7_SYNRA/17-108     AC A0A1X2HWM7.1
#=GS A0A3Q3MBJ3_9TELE/22-112     AC A0A3Q3MBJ3.1
#=GS A0A2V1CSA9_9HELO/229-312    AC A0A2V1CSA9.1
#=GS A0A196S8A5_BLAHN/27-96      AC A0A196S8A5.1
#=GS S9U7X0_9TRYP/224-312        AC S9U7X0.1
#=GS A0A6I8NX79_ORNAN/18-88      AC A0A6I8NX79.1
#=GS A0A3Q2ZQ55_KRYMA/169-251    AC A0A3Q2ZQ55.1
#=GS A0A6I9MTL7_9TELE/17-114     AC A0A6I9MTL7.1
#=GS U5HIN6_USTV1/229-310        AC U5HIN6.1
#=GS A0A6A8FIX0_9ARCH/16-104     AC A0A6A8FIX0.1
#=GS A0A059JID4_TRIIM/21-109     AC A0A059JID4.1
#=GS A0A2K5HSA0_COLAP/141-226    AC A0A2K5HSA0.1
#=GS A0A3M9YM85_9PEZI/17-109     AC A0A3M9YM85.1
#=GS A0A6J0NB52_RAPSA/17-112     AC A0A6J0NB52.1
#=GS A0A0B2V1V8_TOXCA/779-875    AC A0A0B2V1V8.1
#=GS F0YNB0_AURAN/231-314        AC F0YNB0.1
#=GS A0A6J1IM66_CUCMA/17-111     AC A0A6J1IM66.1
#=GS E9ADB9_LEIMA/238-323        AC E9ADB9.1
#=GS A0A5D3BEN1_CUCME/234-319    AC A0A5D3BEN1.1
#=GS A0A423VI41_9PEZI/21-107     AC A0A423VI41.1
#=GS W2RM11_9EURO/17-112         AC W2RM11.1
#=GS A0A1V9YVN6_9STRA/243-323    AC A0A1V9YVN6.1
#=GS A0A0C2N4Z5_THEKT/17-109     AC A0A0C2N4Z5.1
#=GS A0A0C4ER72_PUCT1/229-310    AC A0A0C4ER72.1
#=GS A0A5N5MQ72_9ROSI/225-311    AC A0A5N5MQ72.1
#=GS A0A2U9BGL3_SCOMX/151-216    AC A0A2U9BGL3.1
#=GS A4H3L1_LEIBR/21-106         AC A4H3L1.1
#=GS A0A4S8K9A6_MUSBA/17-113     AC A0A4S8K9A6.1
#=GS B4N4U1_DROWI/231-316        AC B4N4U1.1
#=GS J9IP67_9SPIT/32-113         AC J9IP67.1
#=GS E3LY25_CAERE/22-110         AC E3LY25.1
#=GS K3WB98_GLOUD/29-111         AC K3WB98.1
#=GS A0A6J3H9H1_SAPAP/17-121     AC A0A6J3H9H1.1
#=GS A0A0E0LQM6_ORYPU/21-109     AC A0A0E0LQM6.1
#=GS A0A6S7KY26_LACSI/113-205    AC A0A6S7KY26.1
#=GS K1VVH0_TRIAC/20-108         AC K1VVH0.1
#=GS A0A151U3E9_CAJCA/17-115     AC A0A151U3E9.1
#=GS A0A103X3K8_CYNCS/2-54       AC A0A103X3K8.1
#=GS A0A6P5SJ24_PRUAV/16-118     AC A0A6P5SJ24.1
#=GS H2Q9Q0_PANTR/22-113         AC H2Q9Q0.1
#=GS A0A081CIF0_PSEA2/17-111     AC A0A081CIF0.1
#=GS A0A7J6J8A7_COLFN/21-108     AC A0A7J6J8A7.1
#=GS A0A1E5RBV8_9ASCO/17-108     AC A0A1E5RBV8.1
#=GS A0A103YEE3_CYNCS/21-111     AC A0A103YEE3.1
#=GS Q6BKG1_DEBHA/229-309        AC Q6BKG1.1
#=GS A0A2H5V1W5_9ARCH/26-113     AC A0A2H5V1W5.1
#=GS A0A2R9AIX1_PANPA/231-317    AC A0A2R9AIX1.1
#=GS C0NFV7_AJECG/97-190         AC C0NFV7.1
#=GS A0A5N3XDX9_MUNRE/22-101     AC A0A5N3XDX9.1
#=GS W4JZI6_HETIT/17-110         AC W4JZI6.1
#=GS F0XM60_GROCL/21-106         AC F0XM60.1
#=GS S9W308_CAMFR/1-73           AC S9W308.1
#=GS E3GXB7_METFV/16-106         AC E3GXB7.1
#=GS A0A1J9R310_9EURO/17-110     AC A0A1J9R310.1
#=GS A0A4U5QTI6_POPAL/21-109     AC A0A4U5QTI6.1
#=GS A0A2T4C026_TRILO/21-108     AC A0A2T4C026.1
#=GS A0A4X2LLH3_VOMUR/21-114     AC A0A4X2LLH3.1
#=GS A0A5N5LQW9_9ROSI/234-320    AC A0A5N5LQW9.1
#=GS A0A5N5I2Q1_9ROSA/21-110     AC A0A5N5I2Q1.1
#=GS A0A4Z1K1T4_9HELO/21-109     AC A0A4Z1K1T4.1
#=GS A0A1S3XWE6_TOBAC/22-111     AC A0A1S3XWE6.1
#=GS A0A194XQ09_9HELO/229-313    AC A0A194XQ09.1
#=GS A0A428UJ49_9HYPO/17-109     AC A0A428UJ49.1
#=GS A0A6P5RS75_PRUAV/21-111     AC A0A6P5RS75.1
#=GS A0A1Q3AN60_CEPFO/201-285    AC A0A1Q3AN60.1
#=GS A0A4Q4SUM3_9PEZI/17-111     AC A0A4Q4SUM3.1
#=GS A0A6J0YDR1_ODOVR/13-94      AC A0A6J0YDR1.1
#=GS A0A139IIM3_9PEZI/17-112     AC A0A139IIM3.1
#=GS A0A6I9X4X8_9HYME/22-112     AC A0A6I9X4X8.1
#=GS A0A1G4MBX8_LACFM/17-105     AC A0A1G4MBX8.1
#=GS A0A2K6BPC8_MACNE/169-255    AC A0A2K6BPC8.1
#=GS A2EXW1_TRIVA/20-103         AC A2EXW1.1
#=GS A0A1L9PI79_ASPVE/17-107     AC A0A1L9PI79.1
#=GS A0A3G2S3S7_9BASI/17-110     AC A0A3G2S3S7.1
#=GS A0A200R5J5_9MAGN/21-108     AC A0A200R5J5.1
#=GS A0A6J3KBI7_9HYME/231-316    AC A0A6J3KBI7.1
#=GS A0A0A0KEV8_CUCSA/38-133     AC A0A0A0KEV8.1
#=GS G3AVC0_SPAPN/229-311        AC G3AVC0.1
#=GS A0A0E0J9Y5_ORYNI/17-105     AC A0A0E0J9Y5.1
#=GS R7S7G9_TRAVS/31-118         AC R7S7G9.1
#=GS C1N665_MICPC/20-107         AC C1N665.1
#=GS A0A5D2TEF3_GOSMU/234-320    AC A0A5D2TEF3.1
#=GS A0A6I9LFY4_PERMB/32-123     AC A0A6I9LFY4.1
#=GS A0A1Y1XUG0_9FUNG/17-108     AC A0A1Y1XUG0.1
#=GS I1CTB0_RHIO9/17-107         AC I1CTB0.1
#=GS A0A287DFY5_ICTTR/225-299    AC A0A287DFY5.1
#=GS C3Z9A6_BRAFL/17-114         AC C3Z9A6.1
#=GS A0A7H9HJJ3_9SACH/20-105     AC A0A7H9HJJ3.1
#=GS A0A267EDL6_9PLAT/16-110     AC A0A267EDL6.1
#=GS A0A314KXV5_NICAT/234-318    AC A0A314KXV5.1
#=GS A0A2Y9F0F4_PHYMC/22-113     AC A0A2Y9F0F4.1
#=GS A0A3M2S0V9_9HYPO/229-309    AC A0A3M2S0V9.1
#=GS A0A328SD38_9EURY/16-101     AC A0A328SD38.1
#=GS G7DUM9_MIXOS/1-64           AC G7DUM9.1
#=GS A0A7N5P5C9_AILME/231-314    AC A0A7N5P5C9.1
#=GS E9HEV2_DAPPU/24-114         AC E9HEV2.1
#=GS Q5JH09_THEKO/16-105         AC Q5JH09.1
#=GS A0A367JF61_RHIAZ/20-106     AC A0A367JF61.1
#=GS A0A0C2W484_9AGAM/17-114     AC A0A0C2W484.1
#=GS A0A0A1SRQ6_9HYPO/21-108     AC A0A0A1SRQ6.1
#=GS A0A1U8NXW5_GOSHI/22-113     AC A0A1U8NXW5.1
#=GS A0A2U3YP61_LEPWE/231-316    AC A0A2U3YP61.1
#=GS A0A6P8YJN1_THRPL/17-110     AC A0A6P8YJN1.1
#=GS RLA2_PLAF7/19-111           AC O00806.1
#=GS A0A1S3Z2P9_TOBAC/21-111     AC A0A1S3Z2P9.1
#=GS A0A162V479_PHYB8/20-105     AC A0A162V479.1
#=GS A0A2Z4LAP1_9EURY/16-101     AC A0A2Z4LAP1.1
#=GS A0A2K6LAY9_RHIBE/18-88      AC A0A2K6LAY9.1
#=GS A0A392PXN6_9FABA/2-86       AC A0A392PXN6.1
#=GS A0A2V1CFC4_9HELO/21-109     AC A0A2V1CFC4.1
#=GS A0A7E6DR60_9CHIR/22-119     AC A0A7E6DR60.1
#=GS A0A0V0R719_PSEPJ/17-106     AC A0A0V0R719.1
#=GS E0SP24_IGNAA/16-108         AC E0SP24.1
#=GS A0A0S3QYL1_PHAAN/31-118     AC A0A0S3QYL1.1
#=GS A0A1S4C2S4_TOBAC/22-113     AC A0A1S4C2S4.1
#=GS A0A540N021_MALBA/3-88       AC A0A540N021.1
#=GS D7LJ06_ARALL/17-113         AC D7LJ06.1
#=GS A0A6P9D8A8_PANGU/22-112     AC A0A6P9D8A8.1
#=GS A0A4W5PTC7_9TELE/1-57       AC A0A4W5PTC7.1
#=GS D2EF07_PARA4/16-98          AC D2EF07.1
#=GS A0A6J2A4W5_ACIJB/22-113     AC A0A6J2A4W5.1
#=GS A7AP88_BABBO/32-117         AC A7AP88.1
#=GS A0A2K5R3P5_CEBIM/18-88      AC A0A2K5R3P5.1
#=GS A0A6P6Y8Q9_DERPT/21-118     AC A0A6P6Y8Q9.1
#=GS U3JYW6_FICAL/231-317        AC U3JYW6.1
#=GS G3XRX2_ASPNA/229-311        AC G3XRX2.1
#=GS G7L532_MEDTR/21-111         AC G7L532.1
#=GS A9A571_NITMS/16-104         AC A9A571.1
#=GS M3Z077_MUSPF/22-113         AC M3Z077.1
#=GS A0A3P4S2E5_GULGU/22-102     AC A0A3P4S2E5.1
#=GS A8MAF5_CALMQ/16-107         AC A8MAF5.1
#=GS W2SSC6_NECAM/17-110         AC W2SSC6.1
#=GS A0A2U3WST2_ODORO/22-113     AC A0A2U3WST2.1
#=GS A0A3Q2Z9V8_KRYMA/231-313    AC A0A3Q2Z9V8.1
#=GS A0A5D2TJQ5_GOSMU/17-112     AC A0A5D2TJQ5.1
#=GS A0A6J0P0A3_RAPSA/22-112     AC A0A6J0P0A3.1
#=GS A0A022RSL9_ERYGU/154-241    AC A0A022RSL9.1
#=GS A0A1U8AM89_NELNU/21-111     AC A0A1U8AM89.1
#=GS A0A139AQU1_GONPJ/25-120     AC A0A139AQU1.1
#=GS A0A409XQT6_PSICY/19-107     AC A0A409XQT6.1
#=GS A0A1F7ZU57_9EURO/229-312    AC A0A1F7ZU57.1
#=GS A0A2N3NHA0_9PEZI/17-109     AC A0A2N3NHA0.1
#=GS A0A1D6LEZ8_MAIZE/126-209    AC A0A1D6LEZ8.1
#=GS A3GHH7_PICST/17-109         AC A3GHH7.1
#=GS M7UXI7_BOTF1/38-126         AC M7UXI7.1
#=GS A0A6P6SUU4_COFAR/17-115     AC A0A6P6SUU4.1
#=GS A0A5B2VBH1_9PSEU/55-126     AC A0A5B2VBH1.1
#=GS A0A0D2FI72_9EURO/21-112     AC A0A0D2FI72.1
#=GS R1DDL6_EMIHU/36-131         AC R1DDL6.1
#=GS T0S7C6_SAPDV/17-106         AC T0S7C6.1
#=GS W6YZ41_COCCA/229-313        AC W6YZ41.1
#=GS A0A1Y1IT36_KLENI/21-111     AC A0A1Y1IT36.1
#=GS A0A446K2Y5_TRITD/17-112     AC A0A446K2Y5.1
#=GS A0A5J5F2G4_9PEZI/21-111     AC A0A5J5F2G4.1
#=GS A0A4C1ZRA2_EUMVA/231-316    AC A0A4C1ZRA2.1
#=GS A0A4U5NFY7_STECR/232-313    AC A0A4U5NFY7.1
#=GS Q6FYB0_CANGA/17-108         AC Q6FYB0.1
#=GS A0A2R8ZPM6_PANPA/22-113     AC A0A2R8ZPM6.1
#=GS M4EZX0_BRARP/17-112         AC M4EZX0.1
#=GS C0NGD9_AJECG/21-109         AC C0NGD9.1
#=GS A0A662YX37_ACIRT/24-96      AC A0A662YX37.1
#=GS A0A093YJ89_9PEZI/54-141     AC A0A093YJ89.1
#=GS A0A2K5JRF0_COLAP/198-280    AC A0A2K5JRF0.1
#=GS A0A671PVX8_9TELE/17-113     AC A0A671PVX8.1
#=GS A0A2K3PS84_TRIPR/234-320    AC A0A2K3PS84.1
#=GS E9DTT9_METAQ/229-312        AC E9DTT9.1
#=GS A0A3S2NGL3_CHISP/22-110     AC A0A3S2NGL3.1
#=GS A0A498SQ16_ACAVI/17-116     AC A0A498SQ16.1
#=GS M1CWA9_SOLTU/194-278        AC M1CWA9.1
#=GS A0A068RSE0_9FUNG/228-306    AC A0A068RSE0.1
#=GS RLA0L_HUMAN/231-316         AC Q8NHW5.1
#=GS A0A3N2Q416_9PEZI/21-108     AC A0A3N2Q416.1
#=GS A0A4Q4WLS7_9PEZI/17-111     AC A0A4Q4WLS7.1
#=GS A0A2G5EUE2_AQUCA/234-319    AC A0A2G5EUE2.1
#=GS A0A2Y9KF57_ENHLU/22-113     AC A0A2Y9KF57.1
#=GS A0A1Z5JP38_FISSO/231-316    AC A0A1Z5JP38.1
#=GS W4KC26_HETIT/21-109         AC W4KC26.1
#=GS W6LEY0_9TRYP/19-106         AC W6LEY0.1
#=GS A0A5A7SNJ3_CUCME/235-320    AC A0A5A7SNJ3.1
#=GS A0A3A6PQE2_9EURY/16-118     AC A0A3A6PQE2.1
#=GS A0A0L8GF80_OCTBM/203-291    AC A0A0L8GF80.1
#=GS A0A3P7DHN6_WUCBA/169-265    AC A0A3P7DHN6.1
#=GS A0A2J8A229_9CHLO/21-104     AC A0A2J8A229.1
#=GS A0A1S3ZEB9_TOBAC/234-320    AC A0A1S3ZEB9.1
#=GS A0A2Z7CQG5_9LAMI/7-122      AC A0A2Z7CQG5.1
#=GS J3JU33_DENPD/231-314        AC J3JU33.1
#=GS A0A167FL90_9ASCO/229-311    AC A0A167FL90.1
#=GS A0A1E4SZI0_9ASCO/17-109     AC A0A1E4SZI0.1
#=GS A0A3N2PM58_9PEZI/17-109     AC A0A3N2PM58.1
#=GS A0A1X2GNF4_9FUNG/17-104     AC A0A1X2GNF4.1
#=GS A0A5B8MQ71_9CHLO/233-312    AC A0A5B8MQ71.1
#=GS S2EB45_9ARCH/16-97          AC S2EB45.1
#=GS A0A091KU98_9GRUI/17-92      AC A0A091KU98.1
#=GS A0A5P1E604_ASPOF/17-113     AC A0A5P1E604.1
#=GS A0A6A5NCE1_LUPAL/17-114     AC A0A6A5NCE1.1
#=GS A0A1J7FMU4_LUPAN/24-117     AC A0A1J7FMU4.1
#=GS A0A6G0XPR7_9STRA/16-107     AC A0A6G0XPR7.1
#=GS A0A179UL05_BLAGS/17-111     AC A0A179UL05.1
#=GS A0A504YXI0_FASGI/231-319    AC A0A504YXI0.1
#=GS A0A5N5FTU7_9ROSA/17-121     AC A0A5N5FTU7.1
#=GS A0A1R1X2Z8_9FUNG/17-108     AC A0A1R1X2Z8.1
#=GS A0A158NC71_ATTCE/17-113     AC A0A158NC71.1
#=GS J3KKX6_COCIM/17-110         AC J3KKX6.2
#=GS A0A154PNH0_DUFNO/342-439    AC A0A154PNH0.1
#=GS I2JXV1_DEKBR/229-312        AC I2JXV1.1
#=GS G1Q5B0_MYOLU/20-104         AC G1Q5B0.1
#=GS A0A2K6QGC7_RHIRO/227-292    AC A0A2K6QGC7.1
#=GS V4ZKD7_9ARCH/16-110         AC V4ZKD7.1
#=GS A0A6A4PAY2_LUPAL/234-321    AC A0A6A4PAY2.1
#=GS C5L4D5_PERM5/234-317        AC C5L4D5.1
#=GS T1J5D9_STRMM/21-104         AC T1J5D9.1
#=GS A0A507DZQ2_9FUNG/3947-4038  AC A0A507DZQ2.1
#=GS A0A1M8AB95_MALS4/21-109     AC A0A1M8AB95.1
#=GS N1QLX2_SPHMS/17-111         AC N1QLX2.1
#=GS A0A136J450_9PEZI/17-110     AC A0A136J450.1
#=GS A0A3P6SYI5_LITSI/10-108     AC A0A3P6SYI5.1
#=GS A0A5N5PYN0_PANHP/121-218    AC A0A5N5PYN0.1
#=GS A0A6P7Z7W0_9AMPH/22-112     AC A0A6P7Z7W0.1
#=GS F0TCS7_METLA/16-99          AC F0TCS7.1
#=GS Q4N920_THEPA/240-320        AC Q4N920.1
#=GS F7VKW3_SORMK/229-311        AC F7VKW3.1
#=GS A0A1Y2GK74_9FUNG/19-105     AC A0A1Y2GK74.1
#=GS A0A2R6PQM3_ACTCC/22-120     AC A0A2R6PQM3.1
#=GS A0A2K1QYQ2_9PEZI/229-312    AC A0A2K1QYQ2.1
#=GS A0A3M2TA44_9EURO/24-110     AC A0A3M2TA44.1
#=GS A0A4Y7LAK7_PAPSO/36-129     AC A0A4Y7LAK7.1
#=GS A0A2P7ZY77_9PEZI/21-110     AC A0A2P7ZY77.1
#=GS A0A445FIQ8_GLYSO/17-112     AC A0A445FIQ8.1
#=GS A0A091E3U1_FUKDA/22-113     AC A0A091E3U1.1
#=GS A0A178F7K0_TRIRU/21-109     AC A0A178F7K0.1
#=GS B5XDP1_SALSA/231-314        AC B5XDP1.1
#=GS A0A0D2JGV7_9CHLO/17-106     AC A0A0D2JGV7.1
#=GS A0A103Y048_CYNCS/49-145     AC A0A103Y048.1
#=GS A0A6P4IPY0_DROKI/231-316    AC A0A6P4IPY0.1
#=GS A0A446YHZ7_TRITD/234-318    AC A0A446YHZ7.1
#=GS A0A6J2XIH6_SITOR/231-313    AC A0A6J2XIH6.1
#=GS H3B2A6_LATCH/22-111         AC H3B2A6.1
#=GS RLA24_ARATH/17-110          AC Q9LXM8.1
#=GS A0A398ATA6_BRACM/233-320    AC A0A398ATA6.1
#=GS A0A4D9APY7_SALSN/30-118     AC A0A4D9APY7.1
#=GS A0A340WMJ5_LIPVE/169-257    AC A0A340WMJ5.1
#=GS A0A4D8ZJX1_SALSN/17-112     AC A0A4D8ZJX1.1
#=GS L0AWH6_THEEQ/19-109         AC L0AWH6.1
#=GS A2DHM5_TRIVA/200-283        AC A2DHM5.1
#=GS L8H6U1_ACACA/17-116         AC L8H6U1.1
#=GS S9VTD5_SCHCR/83-168         AC S9VTD5.1
#=GS A0A4Y7K6Q2_PAPSO/17-114     AC A0A4Y7K6Q2.1
#=GS A0A3Q2G9M8_CYPVA/231-313    AC A0A3Q2G9M8.1
#=GS B4FI88_MAIZE/17-111         AC B4FI88.1
#=GS A0A0E0IXV6_ORYNI/327-412    AC A0A0E0IXV6.1
#=GS RLA2_SCHPO/17-109           AC P08094.1
#=GS A0A0N0PCL6_PAPMA/67-161     AC A0A0N0PCL6.1
#=GS H3BGD3_LATCH/231-311        AC H3BGD3.1
#=GS W6UYY1_ECHGR/64-168         AC W6UYY1.1
#=GS X6MXC2_RETFI/29-114         AC X6MXC2.1
#=GS G3IA30_CRIGR/22-113         AC G3IA30.1
#=GS R0GL02_9BRAS/77-173         AC R0GL02.1
#=GS A0A0D9X433_9ORYZ/234-319    AC A0A0D9X433.1
#=GS A0A1B8E1V6_9PEZI/21-108     AC A0A1B8E1V6.1
#=GS I1GWP5_BRADI/66-119         AC I1GWP5.1
#=GS A0A6J2VWY5_CHACN/22-112     AC A0A6J2VWY5.1
#=GS G3BEH3_CANTC/265-349        AC G3BEH3.1
#=GS W1NDZ0_AMBTC/21-111         AC W1NDZ0.1
#=GS A0A2K6B6R6_MACNE/201-287    AC A0A2K6B6R6.1
#=GS A0A384AZD7_BALAS/22-113     AC A0A384AZD7.1
#=GS A0A1V6TGX7_9EURO/21-106     AC A0A1V6TGX7.1
#=GS A0A0L9TJZ6_PHAAN/31-118     AC A0A0L9TJZ6.1
#=GS F6YB50_ORNAN/231-318        AC F6YB50.2
#=GS A0A1S3W2Q3_ERIEU/22-109     AC A0A1S3W2Q3.1
#=GS A0A1E4SLM7_9ASCO/17-106     AC A0A1E4SLM7.1
#=GS A0A061GYX7_THECC/7-79       AC A0A061GYX7.1
#=GS A0A1L9SJX0_9EURO/21-107     AC A0A1L9SJX0.1
#=GS A0A074X240_9PEZI/17-109     AC A0A074X240.1
#=GS A0A1B8GQN4_9PEZI/17-109     AC A0A1B8GQN4.1
#=GS A0A250XP39_9CHLO/233-313    AC A0A250XP39.1
#=GS A0A1X2GPR2_9FUNG/20-107     AC A0A1X2GPR2.1
#=GS A0A653D269_CALMS/231-312    AC A0A653D269.1
#=GS A5DAS4_PICGU/229-309        AC A5DAS4.1
#=GS L8HCT7_ACACA/27-121         AC L8HCT7.1
#=GS E3MRJ2_CAERE/17-106         AC E3MRJ2.1
#=GS A0A1L9WXS0_ASPA1/229-311    AC A0A1L9WXS0.1
#=GS V5FLF3_BYSSN/17-107         AC V5FLF3.1
#=GS A0A0U1M965_TALIS/17-110     AC A0A0U1M965.1
#=GS A0A2K6PH72_RHIRO/8-101      AC A0A2K6PH72.1
#=GS A0A4U5PBA0_STECR/22-110     AC A0A4U5PBA0.1
#=GS A0A669PJE9_PHACC/231-315    AC A0A669PJE9.1
#=GS A0A6J1PG17_9HYME/1-75       AC A0A6J1PG17.1
#=GS A0A3M2RYU2_9HYPO/17-109     AC A0A3M2RYU2.1
#=GS A0A6P6B0C3_DURZI/22-113     AC A0A6P6B0C3.1
#=GS A0A0L0NDZ0_TOLOC/17-109     AC A0A0L0NDZ0.1
#=GS A0A5F8GS87_MONDO/21-74      AC A0A5F8GS87.1
#=GS A0A5C3QUI6_9AGAR/229-310    AC A0A5C3QUI6.1
#=GS A0A066XRG7_COLSU/21-109     AC A0A066XRG7.1
#=GS A0A1R3J2Q2_9ROSI/17-112     AC A0A1R3J2Q2.1
#=GS A0A1J7IM32_LUPAN/21-109     AC A0A1J7IM32.1
#=GS A0A0N4W4T8_HAEPC/17-111     AC A0A0N4W4T8.1
#=GS A0A4D8Y226_SALSN/31-119     AC A0A4D8Y226.1
#=GS I1IXG5_BRADI/17-112         AC I1IXG5.1
#=GS A0A6G1PIK3_9TELE/17-114     AC A0A6G1PIK3.1
#=GS A0A158PCV1_ANGCA/231-312    AC A0A158PCV1.1
#=GS A0A026WSS2_OOCBI/17-112     AC A0A026WSS2.1
#=GS A0A367JX18_RHIAZ/17-107     AC A0A367JX18.1
#=GS A0A2P5BFE5_TREOI/17-114     AC A0A2P5BFE5.1
#=GS A0A0D0CNL4_9AGAR/17-111     AC A0A0D0CNL4.1
#=GS A0A2G3AJI4_CAPAN/17-111     AC A0A2G3AJI4.1
#=GS A0A4S4MS59_9APHY/21-110     AC A0A4S4MS59.1
#=GS A0A6G1CJ48_9ORYZ/234-318    AC A0A6G1CJ48.1
#=GS A0A1D6LEZ6_MAIZE/132-215    AC A0A1D6LEZ6.1
#=GS K1QWX2_CRAGI/231-313        AC K1QWX2.1
#=GS A0A366MB19_9EURY/16-102     AC A0A366MB19.1
#=GS A0A6J3H865_SAPAP/17-114     AC A0A6J3H865.1
#=GS A0A6J0BC72_NEOLC/17-110     AC A0A6J0BC72.1
#=GS A0A3R7LEE0_9TRYP/21-108     AC A0A3R7LEE0.1
#=GS A0A367XWY0_9ASCO/17-109     AC A0A367XWY0.1
#=GS A0A4U0VRC1_9BASI/153-236    AC A0A4U0VRC1.1
#=GS A0A7E4UY30_PANRE/17-110     AC A0A7E4UY30.1
#=GS A0A2P5YBH8_GOSBA/17-91      AC A0A2P5YBH8.1
#=GS A0A1A6HUS9_NEOLE/43-80      AC A0A1A6HUS9.1
#=GS A0A2R9C2A4_PANPA/18-88      AC A0A2R9C2A4.1
#=GS A0A1V6NP66_9EURO/21-106     AC A0A1V6NP66.1
#=GS A0A2P6QSS9_ROSCH/28-119     AC A0A2P6QSS9.1
#=GS A0A2S7QC48_9HELO/17-57      AC A0A2S7QC48.1
#=GS A0A3L6TAA1_PANMI/17-69      AC A0A3L6TAA1.1
#=GS A0A0L0FZJ3_9EUKA/21-106     AC A0A0L0FZJ3.1
#=GS A9PDS2_POPTR/21-108         AC A9PDS2.1
#=GS C4Y8D5_CLAL4/20-105         AC C4Y8D5.1
#=GS G5B782_HETGA/231-316        AC G5B782.1
#=GS A0A341DA25_NEOAA/18-88      AC A0A341DA25.1
#=GS M5G0B2_DACPD/21-112         AC M5G0B2.1
#=GS B7FV43_PHATC/27-113         AC B7FV43.1
#=GS A0A2I0B5P2_9ASPA/234-322    AC A0A2I0B5P2.1
#=GS A0A2P8ZAJ4_BLAGE/172-257    AC A0A2P8ZAJ4.1
#=GS K1VVK3_TRIAC/17-110         AC K1VVK3.1
#=GS T2DPD1_PHAVU/21-111         AC T2DPD1.1
#=GS Q0TZB5_PHANO/229-315        AC Q0TZB5.1
#=GS M2W1D9_GALSU/18-114         AC M2W1D9.1
#=GS A0A367LL89_9HYPO/229-311    AC A0A367LL89.1
#=GS H0XI84_OTOGA/17-114         AC H0XI84.1
#=GS A4HRV4_LEIIN/21-110         AC A4HRV4.1
#=GS A0A0D9S5Q0_CHLSB/223-306    AC A0A0D9S5Q0.1
#=GS A0A4X2LQE4_VOMUR/21-108     AC A0A4X2LQE4.1
#=GS A0A075AD76_9TREM/519-589    AC A0A075AD76.1
#=GS A0A2I3MMC5_PAPAN/231-316    AC A0A2I3MMC5.1
#=GS V7CTV4_PHAVU/21-113         AC V7CTV4.1
#=GS A0A6D2I4R4_9BRAS/21-110     AC A0A6D2I4R4.1
#=GS A0A6J2QL88_COTGO/22-114     AC A0A6J2QL88.1
#=GS A0A5N4DRS8_CAMDR/140-228    AC A0A5N4DRS8.1
#=GS A0A2Z7CFJ9_9LAMI/21-112     AC A0A2Z7CFJ9.1
#=GS B2WCC3_PYRTR/229-314        AC B2WCC3.1
#=GS K5X6P0_AGABU/229-311        AC K5X6P0.1
#=GS RLA1_CHICK/22-113           AC P18660.1
#=GS A0A3Q7JP71_SOLLC/17-112     AC A0A3Q7JP71.1
#=GS J3KEF3_COCIM/229-311        AC J3KEF3.2
#=GS A0A1R0GLY5_9FUNG/21-107     AC A0A1R0GLY5.1
#=GS A0A3M2T6P4_9EURO/17-106     AC A0A3M2T6P4.1
#=GS A0A3B6SE71_WHEAT/227-311    AC A0A3B6SE71.1
#=GS A0A0D7BIE2_9AGAR/17-110     AC A0A0D7BIE2.1
#=GS A0A0L0S0X3_ALLM3/17-106     AC A0A0L0S0X3.1
#=GS A0A383ZIR8_BALAS/22-113     AC A0A383ZIR8.1
#=GS A0A175WEH6_9PEZI/21-108     AC A0A175WEH6.1
#=GS A0A5E4AXC5_MARMO/17-114     AC A0A5E4AXC5.1
#=GS A0A1S9D6K4_ASPOZ/21-108     AC A0A1S9D6K4.1
#=GS G0NE77_CAEBE/1-62           AC G0NE77.1
#=GS A0A1V6PXR3_9EURO/17-108     AC A0A1V6PXR3.1
#=GS C1EI19_MICCC/20-105         AC C1EI19.1
#=GS A0A2K1JIQ7_PHYPA/22-104     AC A0A2K1JIQ7.1
#=GS A5DM65_PICGU/17-110         AC A5DM65.1
#=GS W9Y6L2_9EURO/17-113         AC W9Y6L2.1
#=GS A0A447G3X5_9ARCH/16-99      AC A0A447G3X5.1
#=GS A0A1I7VB74_LOALO/21-116     AC A0A1I7VB74.1
#=GS A0A1A8WEG8_9APIC/32-118     AC A0A1A8WEG8.1
#=GS A0A0D3GVS4_9ORYZ/53-103     AC A0A0D3GVS4.1
#=GS A0A1R0GNF7_9FUNG/17-110     AC A0A1R0GNF7.1
#=GS A0A7M7R037_NASVI/17-112     AC A0A7M7R037.1
#=GS A0A2K5KEW8_COLAP/177-263    AC A0A2K5KEW8.1
#=GS A0A5N6N3D4_9ASTR/17-112     AC A0A5N6N3D4.1
#=GS A0A151TVN8_CAJCA/17-109     AC A0A151TVN8.1
#=GS A0A341CIH2_NEOAA/22-113     AC A0A341CIH2.1
#=GS A0A3B1IV59_ASTMX/22-113     AC A0A3B1IV59.1
#=GS A0A395T773_9HYPO/21-108     AC A0A395T773.1
#=GS A0A1J4KUV5_9EUKA/21-105     AC A0A1J4KUV5.1
#=GS A0A2G9GDV3_9LAMI/17-115     AC A0A2G9GDV3.1
#=GS V6ARN0_9ARCH/16-99          AC V6ARN0.1
#=GS RLA0_SOYBN/234-319          AC P50346.1
#=GS A0A0D2XZ60_FUSO4/17-109     AC A0A0D2XZ60.1
#=GS A0A1R0GV46_9FUNG/228-315    AC A0A1R0GV46.1
#=GS I1I0P9_BRADI/234-319        AC I1I0P9.1
#=GS A0A1Y1YA31_9FUNG/20-105     AC A0A1Y1YA31.1
#=GS A0A3M7LWR6_9PLEO/241-326    AC A0A3M7LWR6.1
#=GS A0A5J5DQJ2_9PERO/17-91      AC A0A5J5DQJ2.1
#=GS A0A556UFH2_BAGYA/22-113     AC A0A556UFH2.1
#=GS V5FQX7_BYSSN/229-310        AC V5FQX7.1
#=GS A0A7E6D9E2_9CHIR/111-201    AC A0A7E6D9E2.1
#=GS A0A0R3W2W3_TAEAS/231-322    AC A0A0R3W2W3.1
#=GS A0A1X7QYP9_9SACH/17-109     AC A0A1X7QYP9.1
#=GS M7YVD5_TRIUA/17-112         AC M7YVD5.1
#=GS G3AUW9_SPAPN/20-106         AC G3AUW9.1
#=GS A0A087XBN6_POEFO/22-112     AC A0A087XBN6.2
#=GS M7BYB3_CHEMY/57-88          AC M7BYB3.1
#=GS S8C6W4_9LAMI/1-52           AC S8C6W4.1
#=GS F7VKL3_SORMK/17-109         AC F7VKL3.1
#=GS A0A1Z5JYT7_FISSO/18-110     AC A0A1Z5JYT7.1
#=GS RL12_SACS2/16-105           AC P96040.1
#=GS A0A430QKH2_SCHBO/258-342    AC A0A430QKH2.1
#=GS A0A162WYM5_PHYB8/17-106     AC A0A162WYM5.1
#=GS A0A1A8X2V0_PLAMA/231-315    AC A0A1A8X2V0.1
#=GS G0NE76_CAEBE/17-103         AC G0NE76.1
#=GS E4ZVF4_LEPMJ/17-112         AC E4ZVF4.1
#=GS B8NNH5_ASPFN/21-110         AC B8NNH5.1
#=GS A0A168KSL2_MUCCL/20-104     AC A0A168KSL2.1
#=GS A0A369SD07_9METZ/17-111     AC A0A369SD07.1
#=GS A0A0E0LSW6_ORYPU/9-104      AC A0A0E0LSW6.1
#=GS A0A0D3BAF4_BRAOL/233-320    AC A0A0D3BAF4.1
#=GS A0A067MW77_9AGAM/17-111     AC A0A067MW77.1
#=GS A0A177B6U9_9BILA/226-318    AC A0A177B6U9.1
#=GS A0A397ZLJ7_BRACM/17-112     AC A0A397ZLJ7.1
#=GS A0A4P1R5C8_LUPAN/234-320    AC A0A4P1R5C8.1
#=GS A0A2I3TBE8_PANTR/190-275    AC A0A2I3TBE8.1
#=GS A0A6P8W8L6_GYMAC/231-314    AC A0A6P8W8L6.1
#=GS A0A0K0DT67_STRER/17-108     AC A0A0K0DT67.1
#=GS C4R7T6_KOMPG/20-105         AC C4R7T6.1
#=GS A0A2S5B0A8_9BASI/21-106     AC A0A2S5B0A8.1
#=GS A0A0N4UHU0_DRAME/17-113     AC A0A0N4UHU0.1
#=GS A0A0S3RZ43_PHAAN/17-112     AC A0A0S3RZ43.1
#=GS A0A341B3B7_NEOAA/231-317    AC A0A341B3B7.1
#=GS A0A654HGY6_9CEST/14-110     AC A0A654HGY6.1
#=GS A0A0S3RKS6_PHAAN/234-319    AC A0A0S3RKS6.1
#=GS A0A6P3FEW1_OCTDE/231-316    AC A0A6P3FEW1.1
#=GS A0A2R8ZDF2_PANPA/177-260    AC A0A2R8ZDF2.1
#=GS A0A3P9DPA1_9CICH/231-298    AC A0A3P9DPA1.1
#=GS A0A6I9RHJ3_ELAGV/17-114     AC A0A6I9RHJ3.1
#=GS K7M324_SOYBN/52-148         AC K7M324.1
#=GS A0A0B0PNW5_GOSAR/22-113     AC A0A0B0PNW5.1
#=GS A0A6D2HEF7_9BRAS/22-113     AC A0A6D2HEF7.1
#=GS M0SVS7_MUSAM/39-121         AC M0SVS7.1
#=GS A0A443S6U8_9ACAR/22-70      AC A0A443S6U8.1
#=GS U6MA64_EIMMA/19-113         AC U6MA64.1
#=GS A0A1Y2VIM1_9PEZI/21-109     AC A0A1Y2VIM1.1
#=GS A0A6J3LNY0_9HYME/22-110     AC A0A6J3LNY0.1
#=GS A0A167DYL5_CORFA/229-312    AC A0A167DYL5.1
#=GS A0A0H1BEP8_9EURO/16-83      AC A0A0H1BEP8.1
#=GS L1JHF0_GUITC/24-116         AC L1JHF0.1
#=GS A0A1U8N2M9_GOSHI/17-112     AC A0A1U8N2M9.1
#=GS A0A1L9TGS5_9EURO/17-107     AC A0A1L9TGS5.1
#=GS A0A2P5VNI9_GOSBA/17-73      AC A0A2P5VNI9.1
#=GS A0A2K6SN35_SAIBB/17-98      AC A0A2K6SN35.1
#=GS A0A5M6C8K8_9TREE/20-109     AC A0A5M6C8K8.1
#=GS A0A4D9BWV4_SALSN/17-113     AC A0A4D9BWV4.1
#=GS T1HS79_RHOPR/17-113         AC T1HS79.1
#=GS A0A177EDM2_9MICR/21-99      AC A0A177EDM2.1
#=GS A0A4S2M1V3_OPIFE/17-118     AC A0A4S2M1V3.1
#=GS A0A0B0N7U2_GOSAR/17-113     AC A0A0B0N7U2.1
#=GS E1ZAY3_CHLVA/17-105         AC E1ZAY3.1
#=GS A0A0D2H405_9EURO/221-305    AC A0A0D2H405.1
#=GS M3B3K3_PSEFD/21-112         AC M3B3K3.1
#=GS H2LZD6_ORYLA/169-252        AC H2LZD6.2
#=GS A0A663M8D7_ATHCN/29-126     AC A0A663M8D7.1
#=GS S7P5H6_MYOBR/24-114         AC S7P5H6.1
#=GS A0A1Y2HW77_9FUNG/94-187     AC A0A1Y2HW77.1
#=GS A0A1V8SDK7_9PEZI/229-312    AC A0A1V8SDK7.1
#=GS G0SGP3_CHATD/229-311        AC G0SGP3.1
#=GS A0A0B0NQF7_GOSAR/17-113     AC A0A0B0NQF7.1
#=GS A0A0U5GTE5_9EURO/21-108     AC A0A0U5GTE5.1
#=GS D7L7S7_ARALL/233-319        AC D7L7S7.1
#=GS A0A2I0I6H9_PUNGR/233-318    AC A0A2I0I6H9.1
#=GS A0A5N4BZP9_CAMDR/83-162     AC A0A5N4BZP9.1
#=GS A0A498K8Z8_MALDO/72-170     AC A0A498K8Z8.1
#=GS W3XPA0_PESFW/17-109         AC W3XPA0.1
#=GS A0A1X2IK02_9FUNG/17-108     AC A0A1X2IK02.1
#=GS A0A0F7IFH2_9EURY/231-337    AC A0A0F7IFH2.1
#=GS A0A319CPV7_9EURO/17-106     AC A0A319CPV7.1
#=GS A0A0M8P144_9EURO/93-178     AC A0A0M8P144.1
#=GS A0A5N3XNY9_MUNRE/22-113     AC A0A5N3XNY9.1
#=GS A0A0N1H3J0_9EURO/17-114     AC A0A0N1H3J0.1
#=GS A0A1Y3BPC6_EURMA/21-115     AC A0A1Y3BPC6.1
#=GS A0A2I3MQ41_PAPAN/186-268    AC A0A2I3MQ41.1
#=GS G3NNI3_GASAC/17-111         AC G3NNI3.1
#=GS A0A232M3T5_9EURO/229-312    AC A0A232M3T5.1
#=GS A0A091GFX3_9AVES/22-113     AC A0A091GFX3.1
#=GS A0A226MQU1_CALSU/22-113     AC A0A226MQU1.1
#=GS A0A087QVR9_APTFO/17-114     AC A0A087QVR9.1
#=GS A0A087RI00_APTFO/231-311    AC A0A087RI00.1
#=GS A0A183EK89_9BILA/18-77      AC A0A183EK89.1
#=GS A0A5C3LI00_9AGAR/229-312    AC A0A5C3LI00.1
#=GS A0A4P9ZGK3_9ASCO/229-309    AC A0A4P9ZGK3.1
#=GS A0A1A6HPF2_NEOLE/22-65      AC A0A1A6HPF2.1
#=GS A0A4Z2ELD9_9TELE/22-114     AC A0A4Z2ELD9.1
#=GS A0A428NM95_9HYPO/21-108     AC A0A428NM95.1
#=GS A0A653BE38_CALMS/231-315    AC A0A653BE38.1
#=GS F2KSR0_ARCVS/16-105         AC F2KSR0.1
#=GS A0A0S4JJB8_BODSA/18-108     AC A0A0S4JJB8.1
#=GS A0A498SI47_ACAVI/231-319    AC A0A498SI47.1
#=GS A0A341C8N6_NEOAA/142-231    AC A0A341C8N6.1
#=GS Q5KFD2_CRYNJ/17-110         AC Q5KFD2.1
#=GS A0A168MT39_ABSGL/20-105     AC A0A168MT39.1
#=GS A0A1E4RFZ7_9ASCO/17-108     AC A0A1E4RFZ7.1
#=GS A0A672FSG7_SALFA/17-113     AC A0A672FSG7.1
#=GS M3Z7F1_MUSPF/23-113         AC M3Z7F1.1
#=GS A0A059DC76_EUCGR/17-115     AC A0A059DC76.1
#=GS R9SK09_9EURY/16-99          AC R9SK09.1
#=GS A0A0B7NLC3_9FUNG/17-106     AC A0A0B7NLC3.1
#=GS C1BXA4_ESOLU/17-112         AC C1BXA4.1
#=GS A0A0V1MLG1_9BILA/231-318    AC A0A0V1MLG1.1
#=GS A0A4Y7LH94_PAPSO/523-618    AC A0A4Y7LH94.1
#=GS A0A2J6M1U2_LACSA/17-114     AC A0A2J6M1U2.1
#=GS A0A6P6A4F5_DURZI/22-113     AC A0A6P6A4F5.1
#=GS A0A1C7MBI5_GRIFR/17-111     AC A0A1C7MBI5.1
#=GS A0A0N0RTB3_9HYPO/16-109     AC A0A0N0RTB3.1
#=GS R9T7V4_METII/230-331        AC R9T7V4.1
#=GS A0A2K5VKK8_MACFA/169-255    AC A0A2K5VKK8.1
#=GS A0A310S4J9_9HYME/17-113     AC A0A310S4J9.1
#=GS A0A5J5AR29_9ASTE/47-137     AC A0A5J5AR29.1
#=GS A0A3P8V986_CYNSE/231-314    AC A0A3P8V986.1
#=GS A0A0U5H3Y4_9EURY/16-111     AC A0A0U5H3Y4.1
#=GS A0A1Q9CL35_SYMMI/1529-1629  AC A0A1Q9CL35.1
#=GS A0A0L1IWP2_ASPNO/229-312    AC A0A0L1IWP2.1
#=GS D7TEZ4_VITVI/17-112         AC D7TEZ4.1
#=GS A0A023EES4_AEDAL/23-111     AC A0A023EES4.1
#=GS H9GZL8_HORSE/17-114         AC H9GZL8.2
#=GS A0A0F0IBH1_ASPPU/229-312    AC A0A0F0IBH1.1
#=GS A0A318ZJ90_9EURO/17-109     AC A0A318ZJ90.1
#=GS A0A498I8L6_MALDO/21-68      AC A0A498I8L6.1
#=GS A0A218UXS9_9PASE/17-114     AC A0A218UXS9.1
#=GS I4DID8_PAPXU/231-315        AC I4DID8.1
#=GS A0A3Q7H439_SOLLC/234-317    AC A0A3Q7H439.1
#=GS A0A0A0LTV1_CUCSA/21-107     AC A0A0A0LTV1.1
#=GS A0A166GMZ0_9AGAM/229-312    AC A0A166GMZ0.1
#=GS M4C8H3_BRARP/17-113         AC M4C8H3.1
#=GS A0A094B8R9_9PEZI/66-153     AC A0A094B8R9.1
#=GS A0A068S1M3_9FUNG/17-106     AC A0A068S1M3.1
#=GS A0A1U8M3A5_GOSHI/17-113     AC A0A1U8M3A5.1
#=GS C5YMX6_SORBI/234-317        AC C5YMX6.1
#=GS A0A1C7MTT8_9FUNG/17-106     AC A0A1C7MTT8.1
#=GS A0A2S5BBV0_9BASI/17-108     AC A0A2S5BBV0.1
#=GS B4MCB2_DROVI/17-77          AC B4MCB2.1
#=GS H2B281_KAZAF/19-105         AC H2B281.1
#=GS A0A1F7ZQN5_9EURO/21-107     AC A0A1F7ZQN5.1
#=GS G8B7X7_CANPC/20-109         AC G8B7X7.1
#=GS A0A2B7WI23_9EURO/17-110     AC A0A2B7WI23.1
#=GS S9YM06_CAMFR/48-139         AC S9YM06.1
#=GS A0A084QBY4_STAC4/228-312    AC A0A084QBY4.1
#=GS A0A1S4DKA2_TOBAC/163-251    AC A0A1S4DKA2.1
#=GS A0A6P6B987_DURZI/21-112     AC A0A6P6B987.1
#=GS A0A4Q9LGF3_9MICR/8-100      AC A0A4Q9LGF3.1
#=GS A0A0P1B526_PLAHL/27-115     AC A0A0P1B526.1
#=GS E3QN91_COLGM/21-109         AC E3QN91.1
#=GS M0ZUF8_SOLTU/232-320        AC M0ZUF8.1
#=GS A0A423VU30_9PEZI/21-107     AC A0A423VU30.1
#=GS A0A6J1DCV2_MOMCH/234-322    AC A0A6J1DCV2.1
#=GS A0A6P5YQC0_DURZI/17-113     AC A0A6P5YQC0.1
#=GS A0A2S6C951_9PEZI/229-313    AC A0A2S6C951.1
#=GS A4HFR5_LEIBR/238-323        AC A4HFR5.1
#=GS A0A2K5QKD5_CEBIM/179-262    AC A0A2K5QKD5.1
#=GS A0A3M7PHH5_BRAPC/23-109     AC A0A3M7PHH5.1
#=GS A0A063C8M0_USTVR/17-111     AC A0A063C8M0.1
#=GS A0CGM9_PARTE/34-120         AC A0CGM9.1
#=GS A0A067BYJ2_SAPPC/29-111     AC A0A067BYJ2.1
#=GS A0A0J0XH20_9TREE/17-109     AC A0A0J0XH20.1
#=GS A0A6F9BTQ6_9TELE/17-112     AC A0A6F9BTQ6.1
#=GS B9SSU4_RICCO/17-112         AC B9SSU4.1
#=GS A0A1R1XIP6_9FUNG/21-106     AC A0A1R1XIP6.1
#=GS A0A2K6BPM8_MACNE/231-317    AC A0A2K6BPM8.1
#=GS A0A2H3J8C6_WOLCO/21-109     AC A0A2H3J8C6.1
#=GS A0A341BQ02_NEOAA/17-114     AC A0A341BQ02.1
#=GS A0A0A2LC88_PENIT/21-106     AC A0A0A2LC88.1
#=GS A0A340WMC2_LIPVE/231-319    AC A0A340WMC2.1
#=GS A0A3Q1AVS8_AMPOC/21-110     AC A0A3Q1AVS8.1
#=GS A0A2I1CAE1_ASPN1/21-109     AC A0A2I1CAE1.1
#=GS C6A1F6_THESM/16-103         AC C6A1F6.1
#=GS A0A1R3HD62_9ROSI/17-113     AC A0A1R3HD62.1
#=GS A0A2K5HSB2_COLAP/22-107     AC A0A2K5HSB2.1
#=GS W9VNP8_9EURO/17-114         AC W9VNP8.1
#=GS A0A1L9UJI5_ASPBC/17-108     AC A0A1L9UJI5.1
#=GS A0A0L1J396_ASPNO/17-108     AC A0A0L1J396.1
#=GS A0A3P7HX04_STRVU/17-88      AC A0A3P7HX04.1
#=GS A0A2K5U8U4_MACFA/159-241    AC A0A2K5U8U4.2
#=GS A0A0L7QXQ2_9HYME/22-110     AC A0A0L7QXQ2.1
#=GS A2EMI1_TRIVA/20-104         AC A2EMI1.1
#=GS A0A1Q3B9C9_CEPFO/17-116     AC A0A1Q3B9C9.1
#=GS A0A5D6XUU0_9STRA/231-314    AC A0A5D6XUU0.1
#=GS Q2HFM8_CHAGB/229-310        AC Q2HFM8.1
#=GS A0A6H0XTY9_9PEZI/21-110     AC A0A6H0XTY9.1
#=GS A0A6I9LEQ8_PERMB/231-316    AC A0A6I9LEQ8.1
#=GS A0A0J7KN60_LASNI/231-315    AC A0A0J7KN60.1
#=GS A0A066WLY2_TILAU/21-109     AC A0A066WLY2.1
#=GS A0A2Y9EU66_PHYMC/17-114     AC A0A2Y9EU66.1
#=GS M0SJD2_MUSAM/17-111         AC M0SJD2.1
#=GS A0A1X2IW59_9FUNG/17-108     AC A0A1X2IW59.1
#=GS A0A1B8EQP0_9PEZI/21-108     AC A0A1B8EQP0.1
#=GS A0A0D1YWP7_9PEZI/21-111     AC A0A0D1YWP7.1
#=GS A0A0G4IGJ5_PLABS/28-112     AC A0A0G4IGJ5.1
#=GS A0A6P8UB89_GYMAC/17-112     AC A0A6P8UB89.1
#=GS A0A6J1YRD9_ACIJB/17-113     AC A0A6J1YRD9.1
#=GS A0A151N4M1_ALLMI/284-366    AC A0A151N4M1.1
#=GS A0A2G5BIM5_COERN/21-106     AC A0A2G5BIM5.1
#=GS A0A2P5FHE7_TREOI/21-112     AC A0A2P5FHE7.1
#=GS A0A7F8RJY1_LEPWE/19-86      AC A0A7F8RJY1.1
#=GS A0A5B6UC83_9ROSI/21-111     AC A0A5B6UC83.1
#=GS A0A4P6XK65_9ASCO/17-108     AC A0A4P6XK65.1
#=GS A0A1U8FJI2_CAPAN/234-319    AC A0A1U8FJI2.1
#=GS A0A1U8NC49_GOSHI/22-112     AC A0A1U8NC49.1
#=GS A0A0R3X2T4_HYDTA/17-123     AC A0A0R3X2T4.1
#=GS A0A4X2K9Q3_VOMUR/23-97      AC A0A4X2K9Q3.1
#=GS A0A1S2Y105_CICAR/17-112     AC A0A1S2Y105.1
#=GS A0A2I4ER37_JUGRE/234-320    AC A0A2I4ER37.1
#=GS A0A1J1IKQ9_9DIPT/23-111     AC A0A1J1IKQ9.1
#=GS A0A068Y9A4_ECHMU/231-322    AC A0A068Y9A4.1
#=GS A0A368GXA2_ANCCA/17-109     AC A0A368GXA2.1
#=GS H2ATS5_KAZAF/16-104         AC H2ATS5.1
#=GS K5VZJ7_PHACS/21-111         AC K5VZJ7.1
#=GS A0A4Y7PDY2_9AGAM/25-117     AC A0A4Y7PDY2.1
#=GS G3UJ51_LOXAF/3-76           AC G3UJ51.1
#=GS C5LCQ4_PERM5/19-108         AC C5LCQ4.1
#=GS A0A395MFM5_9HYPO/228-310    AC A0A395MFM5.1
#=GS A0A1D3CUA7_9EIME/32-119     AC A0A1D3CUA7.1
#=GS A0A2C9V1S4_MANES/17-113     AC A0A2C9V1S4.1
#=GS A0A0G4EZT9_VITBC/17-115     AC A0A0G4EZT9.1
#=GS A0A4Z2E329_9TELE/55-141     AC A0A4Z2E329.1
#=GS A0A5J5AUJ0_9ASTE/21-111     AC A0A5J5AUJ0.1
#=GS W2YYU4_PHYPR/17-105         AC W2YYU4.1
#=GS A7F9K2_SCLS1/229-311        AC A7F9K2.1
#=GS A0A7N9ICU2_MACFA/231-317    AC A0A7N9ICU2.1
#=GS A0A1X2HTK5_SYNRA/20-104     AC A0A1X2HTK5.1
#=GS A0A6J0M190_RAPSA/233-320    AC A0A6J0M190.1
#=GS E4V023_ARTGP/229-310        AC E4V023.1
#=GS A0A2R6QTN6_ACTCC/20-120     AC A0A2R6QTN6.1
#=GS K8ERW0_9CHLO/1-66           AC K8ERW0.1
#=GS S9VPW5_9TRYP/22-107         AC S9VPW5.1
#=GS B1N3L3_ENTHI/1-61           AC B1N3L3.1
#=GS F4R8Y9_MELLP/19-107         AC F4R8Y9.1
#=GS RLA2_HUMAN/17-114           AC P05387.1
#=GS RLA2_HUMAN/17-114           DR PDB; 2JDL C; 2-10;
#=GS RLA2_HUMAN/17-114           DR PDB; 1S4J A; 1-12;
#=GS RLA2_HUMAN/17-114           DR PDB; 2W1O B; 17-69;
#=GS RLA2_HUMAN/17-114           DR PDB; 4BEH B; 217-314;
#=GS RLA2_HUMAN/17-114           DR PDB; 5DDZ B; 110-114;
#=GS RLA2_HUMAN/17-114           DR PDB; 5GU4 D; 2-6;
#=GS RLA2_HUMAN/17-114           DR PDB; 2JDL D; 3-10;
#=GS RLA2_HUMAN/17-114           DR PDB; 2LBF B; 117-169;
#=GS RLA2_HUMAN/17-114           DR PDB; 5GU4 C; 2-6;
#=GS RLA2_HUMAN/17-114           DR PDB; 2W1O A; 17-69;
#=GS L5M193_MYODS/17-114         AC L5M193.1
#=GS A0A2T2NCA2_CORCC/17-110     AC A0A2T2NCA2.1
#=GS C5DNK6_LACTC/229-310        AC C5DNK6.1
#=GS A0A175VXJ7_9PEZI/229-310    AC A0A175VXJ7.1
#=GS A0A194RK20_PAPMA/22-109     AC A0A194RK20.1
#=GS A0A3P8S252_AMPPE/22-112     AC A0A3P8S252.1
#=GS A0A1E3PBW4_WICAA/17-108     AC A0A1E3PBW4.1
#=GS A0A0A7UZ22_9ARCH/16-102     AC A0A0A7UZ22.1
#=GS M4BIK3_HYAAE/36-126         AC M4BIK3.1
#=GS A0A167R313_CALVF/229-314    AC A0A167R313.1
#=GS A0A099P0R0_PICKU/17-106     AC A0A099P0R0.1
#=GS A0A2J6RT47_9HELO/17-112     AC A0A2J6RT47.1
#=GS A0A196SJ41_BLAHN/224-308    AC A0A196SJ41.1
#=GS A0A316W4S2_9BASI/21-112     AC A0A316W4S2.1
#=GS A0A5E4QJT7_9NEOP/22-90      AC A0A5E4QJT7.1
#=GS A0A2K0WHK9_GIBNY/17-109     AC A0A2K0WHK9.1
#=GS A0A0D2MR80_GOSRA/22-113     AC A0A0D2MR80.1
#=GS A0A401GWH6_9APHY/17-111     AC A0A401GWH6.1
#=GS RLA1_BOVIN/22-113           AC Q56K14.1
#=GS A0A4P9WA41_9FUNG/233-315    AC A0A4P9WA41.1
#=GS A0A284REV0_ARMOS/229-311    AC A0A284REV0.1
#=GS A0A1Y1KWK2_PHOPY/22-113     AC A0A1Y1KWK2.1
#=GS W5P694_SHEEP/17-110         AC W5P694.1
#=GS RLA1_ASPFU/21-110           AC Q9HGV0.1
#=GS A0A4D9BIU5_SALSN/473-561    AC A0A4D9BIU5.1
#=GS C1EFE4_MICCC/233-312        AC C1EFE4.1
#=GS Q6CM91_KLULA/20-105         AC Q6CM91.1
#=GS A0A044S0E9_ONCVO/32-126     AC A0A044S0E9.1
#=GS A0A0L7KK61_PLAFX/19-111     AC A0A0L7KK61.1
#=GS RL12_AERPE/21-109           AC Q9Y9W9.1
#=GS RL12_AERPE/21-109           DR PDB; 6JI2 X; 103-109;
#=GS RL12_AERPE/21-109           DR PDB; 5YT0 B; 101-109;
#=GS A0A0V1PJV8_9BILA/22-112     AC A0A0V1PJV8.1
#=GS A0A6J2L470_9CHIR/22-113     AC A0A6J2L470.1
#=GS A0A2H5MYW2_CITUN/17-112     AC A0A2H5MYW2.1
#=GS D7MMU1_ARALL/34-119         AC D7MMU1.1
#=GS A0A428NCK2_9HYPO/17-109     AC A0A428NCK2.1
#=GS A0A3P4NK77_GULGU/1-79       AC A0A3P4NK77.1
#=GS A0A5B0M724_PUCGR/19-107     AC A0A5B0M724.1
#=GS A0A158NKQ4_ATTCE/231-317    AC A0A158NKQ4.1
#=GS A0A388JXN1_CHABU/65-143     AC A0A388JXN1.1
#=GS A0A6H5KQL7_9PHAE/16-101     AC A0A6H5KQL7.1
#=GS A0A1Q8RQ35_9PEZI/21-108     AC A0A1Q8RQ35.1
#=GS H2SJI9_TAKRU/22-111         AC H2SJI9.1
#=GS A0A0L1KYR0_9EUGL/16-107     AC A0A0L1KYR0.1
#=GS A0A662XMM2_9STRA/54-143     AC A0A662XMM2.1
#=GS A0A1L8HDX6_XENLA/41-134     AC A0A1L8HDX6.1
#=GS A0A167E2S7_METRR/229-312    AC A0A167E2S7.1
#=GS A0A194S3U1_RHOGW/229-308    AC A0A194S3U1.1
#=GS K7N0E2_SOYBN/21-98          AC K7N0E2.1
#=GS A0A2Y9EW64_PHYMC/22-113     AC A0A2Y9EW64.1
#=GS A0A6J1HYA3_CUCMA/33-119     AC A0A6J1HYA3.1
#=GS A0A512UF95_9ASCO/229-310    AC A0A512UF95.1
#=GS RLA2_LEIBR/16-104           AC O44010.1
#=GS RLA2_LEIBR/16-104           DR PDB; 1S4H A; 1-12;
#=GS A0A2P6NP71_9EUKA/100-182    AC A0A2P6NP71.1
#=GS A0A238WQE6_HALVU/16-107     AC A0A238WQE6.1
#=GS A0A367K2G8_RHIAZ/17-107     AC A0A367K2G8.1
#=GS A0A2P6Q2A9_ROSCH/17-107     AC A0A2P6Q2A9.1
#=GS A0A067NYD7_PLEOS/21-109     AC A0A067NYD7.1
#=GS A0A2B7XPB6_9EURO/17-109     AC A0A2B7XPB6.1
#=GS A0A671TH05_SPAAU/169-253    AC A0A671TH05.1
#=GS A0A445C6G7_ARAHY/33-116     AC A0A445C6G7.1
#=GS A0A151TC76_CAJCA/234-319    AC A0A151TC76.1
#=GS A0A4P9XRR5_9FUNG/231-310    AC A0A4P9XRR5.1
#=GS T0KKK8_COLGC/17-109         AC T0KKK8.1
#=GS A0A670YJB6_PSETE/16-99      AC A0A670YJB6.1
#=GS A0A2I3SLL3_PANTR/171-257    AC A0A2I3SLL3.1
#=GS A0A6G1FEJ7_9ORYZ/17-112     AC A0A6G1FEJ7.1
#=GS A0A1Q3D2M0_CEPFO/22-114     AC A0A1Q3D2M0.1
#=GS A0A1S3TD73_VIGRR/21-111     AC A0A1S3TD73.1
#=GS D8Q384_SCHCM/17-110         AC D8Q384.1
#=GS A0A6J1J9Z4_CUCMA/17-114     AC A0A6J1J9Z4.1
#=GS A0A2H2JEP8_CAEJA/207-287    AC A0A2H2JEP8.1
#=GS A0A0K8LMJ4_9EURO/21-109     AC A0A0K8LMJ4.1
#=GS A0A421GQM5_9STRA/231-311    AC A0A421GQM5.1
#=GS A0A4Q4Y2T9_9PEZI/17-111     AC A0A4Q4Y2T9.1
#=GS A0A6I9SJ73_ELAGV/17-111     AC A0A6I9SJ73.1
#=GS K1Q358_CRAGI/17-111         AC K1Q358.1
#=GS A0A2K5PCA9_CEBIM/4-92       AC A0A2K5PCA9.1
#=GS B5IAH5_ACIB4/16-104         AC B5IAH5.1
#=GS A0A1E3PCK3_WICAA/229-312    AC A0A1E3PCK3.1
#=GS A0A6P7MMZ6_BETSP/17-115     AC A0A6P7MMZ6.1
#=GS A0A067DRV3_CITSI/20-102     AC A0A067DRV3.1
#=GS A0A445FLQ4_GLYSO/21-98      AC A0A445FLQ4.1
#=GS A0A6H5GQH1_9HEMI/21-83      AC A0A6H5GQH1.1
#=GS A7TS21_VANPO/229-310        AC A7TS21.1
#=GS A0A672ZSS8_9TELE/17-113     AC A0A672ZSS8.1
#=GS B6K5P4_SCHJY/21-107         AC B6K5P4.1
#=GS A0A445CEM0_ARAHY/23-117     AC A0A445CEM0.1
#=GS A0A061HKV8_BLUGR/230-313    AC A0A061HKV8.1
#=GS G1K8D7_ANOCA/22-112         AC G1K8D7.1
#=GS A0A0E0MSH6_ORYRU/17-113     AC A0A0E0MSH6.1
#=GS A0A444CXG8_ENSVE/20-106     AC A0A444CXG8.1
#=GS A7ANQ3_BABBO/19-111         AC A7ANQ3.1
#=GS A0A0C9MX48_9FUNG/497-581    AC A0A0C9MX48.1
#=GS A0A0L9TWH9_PHAAN/17-109     AC A0A0L9TWH9.1
#=GS Q5SNH7_ORYSJ/17-113         AC Q5SNH7.1
#=GS A0A445H231_GLYSO/234-318    AC A0A445H231.1
#=GS A0A319D297_9EURO/1-86       AC A0A319D297.1
#=GS A0A5M3MER7_CONPW/18-108     AC A0A5M3MER7.1
#=GS A0A068RI68_9FUNG/41-120     AC A0A068RI68.1
#=GS A0A238F5R5_9BASI/20-108     AC A0A238F5R5.1
#=GS A0A1W0XCG1_HYPDU/261-349    AC A0A1W0XCG1.1
#=GS A0A1U7VI59_NICSY/21-111     AC A0A1U7VI59.1
#=GS A0A2J7ZPV9_9CHLO/17-107     AC A0A2J7ZPV9.1
#=GS A0A4V5N872_9PEZI/21-113     AC A0A4V5N872.1
#=GS E0VFT8_PEDHC/22-117         AC E0VFT8.1
#=GS C4M660_ENTHI/23-106         AC C4M660.1
#=GS A0A1D6FKX3_MAIZE/95-186     AC A0A1D6FKX3.1
#=GS A0A195DHA1_9HYME/231-316    AC A0A195DHA1.1
#=GS A0A1J9QEC2_9EURO/17-110     AC A0A1J9QEC2.1
#=GS A0A176VV37_MARPO/17-112     AC A0A176VV37.1
#=GS A0A6P4ZLJ7_BRABE/22-111     AC A0A6P4ZLJ7.1
#=GS A0A139HNZ1_9PEZI/21-111     AC A0A139HNZ1.1
#=GS F9WD62_TRYCI/16-107         AC F9WD62.1
#=GS A0A6J3ERQ4_SAPAP/231-316    AC A0A6J3ERQ4.1
#=GS A0A5D3CBJ1_CUCME/17-109     AC A0A5D3CBJ1.1
#=GS RLA0_ORYSJ/234-318          AC P41095.3
#=GS A0A0E0QGC3_ORYRU/17-114     AC A0A0E0QGC3.1
#=GS A0A6P6W745_COFAR/21-112     AC A0A6P6W745.1
#=GS A0A3N4I0E7_ASCIM/21-109     AC A0A3N4I0E7.1
#=GS A0A315VI69_GAMAF/17-114     AC A0A315VI69.1
#=GS A0A1S3XAP7_TOBAC/22-109     AC A0A1S3XAP7.1
#=GS A0A0D9RDT9_CHLSB/17-114     AC A0A0D9RDT9.1
#=GS A0A6P3WTS1_DINQU/22-112     AC A0A6P3WTS1.1
#=GS A0A6J0WEI7_ODOVR/22-113     AC A0A6J0WEI7.1
#=GS A0A084FUJ3_PSEDA/21-108     AC A0A084FUJ3.1
#=GS A0A1V6P8Q5_PENDC/229-311    AC A0A1V6P8Q5.1
#=GS A0A2G5DPY8_AQUCA/34-117     AC A0A2G5DPY8.1
#=GS A9RZU5_PHYPA/234-318        AC A9RZU5.1
#=GS A0A2Y9DIC4_TRIMA/22-113     AC A0A2Y9DIC4.1
#=GS A0A1S3XQG2_TOBAC/21-113     AC A0A1S3XQG2.1
#=GS A0A103YHN3_CYNCS/17-113     AC A0A103YHN3.1
#=GS L0ACA9_NATGS/16-114         AC L0ACA9.1
#=GS A0A0V1BWY7_TRISP/158-247    AC A0A0V1BWY7.1
#=GS A0A0V0XIZ4_TRIPS/158-245    AC A0A0V0XIZ4.1
#=GS A0A4S4L690_9AGAM/17-110     AC A0A4S4L690.1
#=GS A9UZK8_MONBE/17-107         AC A9UZK8.1
#=GS D8M1G3_BLAHO/7-100          AC D8M1G3.1
#=GS A0A316UEG0_9BASI/21-111     AC A0A316UEG0.1
#=GS A0A6I9SCH5_ELAGV/21-112     AC A0A6I9SCH5.1
#=GS A0A0F4GDI8_9PEZI/229-312    AC A0A0F4GDI8.1
#=GS V4VNI2_CITCL/49-136         AC V4VNI2.1
#=GS C7DHU6_MICA2/9-100          AC C7DHU6.1
#=GS A0A1X0P504_9TRYP/238-323    AC A0A1X0P504.1
#=GS A0A0E0L349_ORYPU/17-111     AC A0A0E0L349.1
#=GS A0A2C5YAF6_9HYPO/23-110     AC A0A2C5YAF6.1
#=GS A0A6A3P4A0_9STRA/29-112     AC A0A6A3P4A0.1
#=GS A0A4W5PWD8_9TELE/22-110     AC A0A4W5PWD8.1
#=GS A0A151R6V4_CAJCA/17-112     AC A0A151R6V4.1
#=GS A0A1S8BIN0_9PEZI/229-312    AC A0A1S8BIN0.1
#=GS A0A7M7QVV3_NASVI/231-315    AC A0A7M7QVV3.1
#=GS N1RNK1_FUSC4/229-312        AC N1RNK1.1
#=GS A0A067LE12_JATCU/17-113     AC A0A067LE12.1
#=GS W4GH51_9STRA/29-111         AC W4GH51.1
#=GS A0A4U5PF10_STECR/231-310    AC A0A4U5PF10.1
#=GS A0A2U1K8V3_ARTAN/21-84      AC A0A2U1K8V3.1
#=GS A0A4X2LM97_VOMUR/22-115     AC A0A4X2LM97.1
#=GS C5DVD1_ZYGRC/16-103         AC C5DVD1.1
#=GS A0A163JWZ5_ABSGL/17-122     AC A0A163JWZ5.1
#=GS A0A4D9A3U3_SALSN/18-101     AC A0A4D9A3U3.1
#=GS A0A540KRL2_MALBA/17-102     AC A0A540KRL2.1
#=GS A0A0B0NHP0_GOSAR/21-111     AC A0A0B0NHP0.1
#=GS E9EHH9_METAQ/17-109         AC E9EHH9.1
#=GS L1IM87_GUITC/74-183         AC L1IM87.1
#=GS E4NR76_HALBP/16-109         AC E4NR76.1
#=GS W5NQ99_SHEEP/24-114         AC W5NQ99.1
#=GS A0A2Y9NWR3_DELLE/22-113     AC A0A2Y9NWR3.1
#=GS A4HWD9_LEIIN/20-107         AC A4HWD9.1
#=GS A0A0D2P4V1_GOSRA/85-181     AC A0A0D2P4V1.1
#=GS A0A1J5WQL2_9MICR/24-102     AC A0A1J5WQL2.1
#=GS U1PNM8_9EURY/16-112         AC U1PNM8.1
#=GS A0A6P5ZTA1_DURZI/17-114     AC A0A6P5ZTA1.1
#=GS A0A094CSS7_9PEZI/229-311    AC A0A094CSS7.1
#=GS A0A2P7YPU3_9ASCO/6-117      AC A0A2P7YPU3.1
#=GS A0A6I8TRY0_AEDAE/15-84      AC A0A6I8TRY0.1
#=GS S7NCJ9_MYOBR/1-92           AC S7NCJ9.1
#=GS A0A1X7T695_AMPQE/18-114     AC A0A1X7T695.1
#=GS A0A6G1G9D1_9PEZI/21-109     AC A0A6G1G9D1.1
#=GS A0A2I2F703_9EURO/21-105     AC A0A2I2F703.1
#=GS A0A2H2IP51_CAEJA/17-107     AC A0A2H2IP51.1
#=GS A0A341BNH3_NEOAA/22-113     AC A0A341BNH3.1
#=GS B9PKQ4_TOXGV/93-178         AC B9PKQ4.1
#=GS A0A4X2KBN9_VOMUR/17-115     AC A0A4X2KBN9.1
#=GS Q1HRM9_AEDAE/17-111         AC Q1HRM9.1
#=GS A0A4P6XLH1_9ASCO/20-105     AC A0A4P6XLH1.1
#=GS W2T6C0_NECAM/17-108         AC W2T6C0.1
#=GS A0A0E0CLG2_9ORYZ/30-125     AC A0A0E0CLG2.1
#=GS W5P2A1_SHEEP/22-113         AC W5P2A1.1
#=GS A0A2V1D8P6_9PLEO/17-111     AC A0A2V1D8P6.1
#=GS A0A2I4CN72_9TELE/17-115     AC A0A2I4CN72.1
#=GS L9KRS6_TUPCH/17-99          AC L9KRS6.1
#=GS A0A6A2Z4K9_HIBSY/225-311    AC A0A6A2Z4K9.1
#=GS H1VI18_COLHI/21-109         AC H1VI18.1
#=GS C4LZ75_ENTHI/25-106         AC C4LZ75.1
#=GS K9G228_PEND2/17-107         AC K9G228.1
#=GS W1QFD0_OGAPD/19-104         AC W1QFD0.1
#=GS W9CAE8_SCLBF/17-111         AC W9CAE8.1
#=GS A0A2K3LE12_TRIPR/24-111     AC A0A2K3LE12.1
#=GS A0A6J2W2K4_CHACN/22-115     AC A0A6J2W2K4.1
#=GS A0A5E4G401_PRUDU/17-107     AC A0A5E4G401.1
#=GS A0A4V4H6V3_MUSBA/63-152     AC A0A4V4H6V3.1
#=GS A0A124GSP2_9EURO/93-178     AC A0A124GSP2.1
#=GS B2AY94_PODAN/229-313        AC B2AY94.1
#=GS A0A3Q3AWQ1_KRYMA/17-114     AC A0A3Q3AWQ1.1
#=GS A0A1D2MYY4_ORCCI/17-110     AC A0A1D2MYY4.1
#=GS A0A199UGY2_ANACO/71-169     AC A0A199UGY2.1
#=GS A0A5B2VIF7_9PSEU/22-68      AC A0A5B2VIF7.1
#=GS A0A673WTT0_SALTR/169-252    AC A0A673WTT0.1
#=GS A0A2C9V405_MANES/234-319    AC A0A2C9V405.1
#=GS Q6FR55_CANGA/20-106         AC Q6FR55.1
#=GS A0A5F8AFC7_MACMU/17-114     AC A0A5F8AFC7.1
#=GS A0A2G9UJQ7_TELCI/1-75       AC A0A2G9UJQ7.1
#=GS A0A5C3N3F2_9AGAM/17-111     AC A0A5C3N3F2.1
#=GS A0A498N7B5_LABRO/40-136     AC A0A498N7B5.1
#=GS A0A6P3RQ17_PTEVA/35-106     AC A0A6P3RQ17.1
#=GS A0A423SWS8_PENVA/22-67      AC A0A423SWS8.1
#=GS A0A067TH43_GALM3/21-110     AC A0A067TH43.1
#=GS A0A1U8KSV6_GOSHI/234-320    AC A0A1U8KSV6.1
#=GS A0A498JKB8_MALDO/260-329    AC A0A498JKB8.1
#=GS A0A5N6YZY1_9EURO/21-107     AC A0A5N6YZY1.1
#=GS A0A673TLC9_SURSU/22-113     AC A0A673TLC9.1
#=GS A0A0D2PU07_GOSRA/103-194    AC A0A0D2PU07.1
#=GS A0A2K6MMG6_RHIBE/17-114     AC A0A2K6MMG6.1
#=GS I1KSX0_SOYBN/23-119         AC I1KSX0.1
#=GS A0A059DF41_EUCGR/21-110     AC A0A059DF41.1
#=GS A0A1S3Y5V8_TOBAC/234-319    AC A0A1S3Y5V8.1
#=GS A0A437CX40_ORYJA/73-144     AC A0A437CX40.1
#=GS A0A287XH08_HORVV/61-142     AC A0A287XH08.1
#=GS A0A1W0WGP9_HYPDU/22-114     AC A0A1W0WGP9.1
#=GS I1H2D7_BRADI/17-113         AC I1H2D7.1
#=GS M7NQP3_PNEMU/20-104         AC M7NQP3.2
#=GS A0A1Y1WRK7_9FUNG/23-108     AC A0A1Y1WRK7.1
#=GS A0A0C2GB46_9BILA/17-109     AC A0A0C2GB46.1
#=GS K3X7H3_GLOUD/17-106         AC K3X7H3.1
#=GS A0A2G8KUX1_STIJA/56-132     AC A0A2G8KUX1.1
#=GS A8X663_CAEBR/17-109         AC A8X663.1
#=GS A0A0A0LJB2_CUCSA/36-120     AC A0A0A0LJB2.1
#=GS E6N4F0_CALS0/16-102         AC E6N4F0.1
#=GS A0A6J0JX83_RAPSA/233-320    AC A0A6J0JX83.1
#=GS A0A0D2X0Q0_CAPO3/21-108     AC A0A0D2X0Q0.1
#=GS A0A3M7RPJ5_BRAPC/224-307    AC A0A3M7RPJ5.1
#=GS A0A444CAL5_ENSVE/17-114     AC A0A444CAL5.1
#=GS B8PAM8_POSPM/21-109         AC B8PAM8.1
#=GS A0A2U3WEE0_ODORO/17-86      AC A0A2U3WEE0.1
#=GS A0A504Z0E8_FASGI/17-115     AC A0A504Z0E8.1
#=GS A0A2G3A612_CAPAN/9-80       AC A0A2G3A612.1
#=GS A0A165J3I5_XYLHT/21-108     AC A0A165J3I5.1
#=GS A0A1U7Z1B9_NICSY/17-111     AC A0A1U7Z1B9.1
#=GS A0A2G2ZDK5_CAPAN/75-169     AC A0A2G2ZDK5.1
#=GS A0A2G9HUM2_9LAMI/17-120     AC A0A2G9HUM2.1
#=GS A0A5A9PM08_9TELE/17-113     AC A0A5A9PM08.1
#=GS A0A6J5Y0Z9_PRUAR/17-112     AC A0A6J5Y0Z9.1
#=GS A0A0V1LID2_9BILA/251-339    AC A0A0V1LID2.1
#=GS A0A316W5W8_9BASI/229-312    AC A0A316W5W8.1
#=GS I3S066_MEDTR/17-111         AC I3S066.1
#=GS B7Q4L8_IXOSC/17-81          AC B7Q4L8.1
#=GS A0A0S3REJ6_PHAAN/24-112     AC A0A0S3REJ6.1
#=GS A0A5J5BIU2_9ASTE/75-165     AC A0A5J5BIU2.1
#=GS M1XL72_NATM8/16-111         AC M1XL72.1
#=GS A0A1U7WAL8_NICSY/17-111     AC A0A1U7WAL8.1
#=GS A0A194PLG0_PAPXU/22-109     AC A0A194PLG0.1
#=GS A0A6J3S9X9_TURTR/22-99      AC A0A6J3S9X9.1
#=GS A0A4W2CAC5_BOBOX/21-107     AC A0A4W2CAC5.1
#=GS A0A672Y2G2_9TELE/231-314    AC A0A672Y2G2.1
#=GS G1Q2C2_MYOLU/1-87           AC G1Q2C2.1
#=GS A0A0N4V724_ENTVE/21-113     AC A0A0N4V724.1
#=GS A0A6G0UUU1_9BILA/17-79      AC A0A6G0UUU1.1
#=GS K2SI17_MACPH/17-110         AC K2SI17.1
#=GS A0A2G5CVH6_AQUCA/22-113     AC A0A2G5CVH6.1
#=GS A0A420XY36_9PEZI/229-314    AC A0A420XY36.1
#=GS A0A075AJ78_9TREM/17-118     AC A0A075AJ78.1
#=GS A0A6A4M2H0_9ERIC/132-214    AC A0A6A4M2H0.1
#=GS A0A117NM83_9EURO/51-141     AC A0A117NM83.1
#=GS W3XKR0_PESFW/226-311        AC W3XKR0.1
#=GS A0A444E0J7_ENSVE/135-220    AC A0A444E0J7.1
#=GS A0A178E0X2_9PLEO/21-109     AC A0A178E0X2.1
#=GS A0A6B9T7A8_9ARCH/230-334    AC A0A6B9T7A8.1
#=GS L8WJN6_THACA/415-488        AC L8WJN6.1
#=GS G1N9Q6_MELGA/190-275        AC G1N9Q6.2
#=GS A0A1R2CS50_9CILI/246-329    AC A0A1R2CS50.1
#=GS A0A0D2TDA1_GOSRA/21-84      AC A0A0D2TDA1.1
#=GS A0A078B613_STYLE/17-104     AC A0A078B613.1
#=GS A0A1S2XJI4_CICAR/17-113     AC A0A1S2XJI4.1
#=GS A0A6P7I2S7_9TELE/22-113     AC A0A6P7I2S7.1
#=GS A0A2J6K8S2_LACSA/21-83      AC A0A2J6K8S2.1
#=GS A0A2I0VZ94_9ASPA/23-114     AC A0A2I0VZ94.1
#=GS A0A1D6HWQ4_MAIZE/52-136     AC A0A1D6HWQ4.1
#=GS A0A6P7GHU9_DIAVI/22-111     AC A0A6P7GHU9.1
#=GS A0A0A0KRE0_CUCSA/17-113     AC A0A0A0KRE0.1
#=GS V4YCW4_9ARCH/16-111         AC V4YCW4.1
#=GS A0A316ULT9_9BASI/17-109     AC A0A316ULT9.1
#=GS A0A4V4NF30_9ASCO/19-102     AC A0A4V4NF30.1
#=GS M1AFX9_SOLTU/31-117         AC M1AFX9.1
#=GS A0A2K6MFY0_RHIBE/20-106     AC A0A2K6MFY0.1
#=GS A0A4T0X0Y9_9ASCO/17-106     AC A0A4T0X0Y9.1
#=GS A0A135L8L5_PENPA/21-107     AC A0A135L8L5.1
#=GS A0A673UJI0_SURSU/22-113     AC A0A673UJI0.1
#=GS F4Q1U7_CAVFA/17-104         AC F4Q1U7.1
#=GS A0A428SG52_9HYPO/21-108     AC A0A428SG52.1
#=GS A0A5N5F4I5_9ROSA/21-110     AC A0A5N5F4I5.1
#=GS A0A4X2LQF6_VOMUR/17-89      AC A0A4X2LQF6.1
#=GS A8BNT0_GIAIC/233-312        AC A8BNT0.1
#=GS A0A1F2P8V6_9EURY/16-107     AC A0A1F2P8V6.1
#=GS D6WKQ5_TRICA/22-110         AC D6WKQ5.1
#=GS A0A2A9NVY2_9AGAR/17-112     AC A0A2A9NVY2.1
#=GS A0A6P6XLU8_DERPT/25-108     AC A0A6P6XLU8.1
#=GS A0A317XAV9_9EURO/229-311    AC A0A317XAV9.1
#=GS RLA13_ARATH/22-112          AC Q8LEQ0.2
#=GS A0A5D2VCA6_GOSMU/234-319    AC A0A5D2VCA6.1
#=GS A0A5D2WCI0_GOSMU/234-320    AC A0A5D2WCI0.1
#=GS A0A078H4X7_BRANA/22-112     AC A0A078H4X7.1
#=GS A0A6D2J5I9_9BRAS/233-319    AC A0A6D2J5I9.1
#=GS RLA1_CANAL/20-105           AC Q9HFQ7.1
#=GS A0A2G5DK60_AQUCA/16-111     AC A0A2G5DK60.1
#=GS G1QAP5_MYOLU/231-316        AC G1QAP5.1
#=GS A0A2I1GGA4_9GLOM/24-112     AC A0A2I1GGA4.1
#=GS V7CXG5_PHAVU/88-176         AC V7CXG5.1
#=GS A0A388M4B2_CHABU/17-117     AC A0A388M4B2.1
#=GS Q0UU36_PHANO/17-111         AC Q0UU36.1
#=GS A0A699ZL16_HAELA/17-75      AC A0A699ZL16.1
#=GS A0A7E6DQ19_9CHIR/59-149     AC A0A7E6DQ19.1
#=GS A0A1Q9DG39_SYMMI/101-191    AC A0A1Q9DG39.1
#=GS A0A545A2I8_9PEZI/17-109     AC A0A545A2I8.1
#=GS A0A662XIM5_9STRA/29-123     AC A0A662XIM5.1
#=GS RLA31_ARATH/40-118          AC Q9SVZ6.1
#=GS A0A4U0X3D8_9PEZI/221-307    AC A0A4U0X3D8.1
#=GS L0AZ63_THEEQ/231-312        AC L0AZ63.1
#=GS A0A1Q3BTJ9_CEPFO/21-111     AC A0A1Q3BTJ9.1
#=GS A0A0J8UTC6_COCIT/177-259    AC A0A0J8UTC6.1
#=GS A0A074RN19_9AGAM/229-311    AC A0A074RN19.1
#=GS A0A341CPU7_NEOAA/14-88      AC A0A341CPU7.1
#=GS F1MDN4_BOVIN/231-317        AC F1MDN4.2
#=GS A0A383V251_BLUGH/21-109     AC A0A383V251.1
#=GS A0A6A6L7Q6_HEVBR/61-158     AC A0A6A6L7Q6.1
#=GS A0A6P6FP98_ZIZJJ/17-114     AC A0A6P6FP98.1
#=GS RLA0_MAIZE/234-317          AC O24573.3
#=GS A0A2T3YVG7_9HYPO/17-109     AC A0A2T3YVG7.1
#=GS A0A6S7Q1P7_LACSI/21-110     AC A0A6S7Q1P7.1
#=GS A0A068UY16_COFCA/17-105     AC A0A068UY16.1
#=GS A0A1E4SN09_9ASCO/20-103     AC A0A1E4SN09.1
#=GS A0A2G5U690_9PELO/17-109     AC A0A2G5U690.1
#=GS A0A0D9PDT7_METAN/229-312    AC A0A0D9PDT7.1
#=GS H2AR05_KAZAF/20-106         AC H2AR05.1
#=GS A0A1L9W0B4_ASPGL/78-163     AC A0A1L9W0B4.1
#=GS A0A5N6FLJ0_PETAA/21-107     AC A0A5N6FLJ0.1
#=GS I4Y5Z0_WALMC/17-106         AC I4Y5Z0.1
#=GS H2NNM2_PONAB/22-113         AC H2NNM2.1
#=GS A0A0G2GH52_9PEZI/21-108     AC A0A0G2GH52.1
#=GS M1AAF5_SOLTU/17-112         AC M1AAF5.1
#=GS M4CEV9_BRARP/35-120         AC M4CEV9.1
#=GS A0A0S7DNV1_9EURO/17-109     AC A0A0S7DNV1.1
#=GS A0A094HW34_9PEZI/69-156     AC A0A094HW34.1
#=GS A0A2H3IYV3_9EURO/21-109     AC A0A2H3IYV3.1
#=GS A0A168LE71_MUCCL/17-106     AC A0A168LE71.1
#=GS A0A2T0FFH1_9ASCO/229-310    AC A0A2T0FFH1.1
#=GS A0A1X6NWW0_PORUM/228-314    AC A0A1X6NWW0.1
#=GS A0A0L1IAK2_PLAFA/210-294    AC A0A0L1IAK2.1
#=GS A0A0P0XBD7_ORYSJ/14-98      AC A0A0P0XBD7.1
#=GS A0A5F8HGS1_MONDO/41-126     AC A0A5F8HGS1.1
#=GS A0A5N5TEQ0_9CRUS/26-125     AC A0A5N5TEQ0.1
#=GS A0A319E660_ASPSB/229-312    AC A0A319E660.1
#=GS A0A087V1L7_STEMI/12-78      AC A0A087V1L7.1
#=GS A0A2R9BTM9_PANPA/22-113     AC A0A2R9BTM9.1
#=GS A0A7N5P0N7_AILME/214-297    AC A0A7N5P0N7.1
#=GS A0A6P5ZMI6_DURZI/60-124     AC A0A6P5ZMI6.1
#=GS A0A439DAM1_9PEZI/229-311    AC A0A439DAM1.1
#=GS A0A1U7XYU9_NICSY/234-320    AC A0A1U7XYU9.1
#=GS A0A5F4D213_CANLF/173-258    AC A0A5F4D213.1
#=GS A8JCC6_CHLRE/21-106         AC A8JCC6.1
#=GS A0A0C3QMV7_9AGAM/21-112     AC A0A0C3QMV7.1
#=GS A0A1D1W672_RAMVA/231-324    AC A0A1D1W672.1
#=GS A0A2B7YBS5_9EURO/17-110     AC A0A2B7YBS5.1
#=GS A1D4B8_NEOFI/229-312        AC A1D4B8.1
#=GS A0A1A6GDX9_NEOLE/38-106     AC A0A1A6GDX9.1
#=GS A0A2P5BKX6_TREOI/234-323    AC A0A2P5BKX6.1
#=GS A0A2H3JXB2_WOLCO/229-313    AC A0A2H3JXB2.1
#=GS A0A2K5SBF3_CEBIM/9-101      AC A0A2K5SBF3.1
#=GS A0A0D2GVF2_9EURO/21-111     AC A0A0D2GVF2.1
#=GS A0A0E9NGR6_SAICN/21-72      AC A0A0E9NGR6.1
#=GS A0A5A7RAC9_STRAF/234-317    AC A0A5A7RAC9.1
#=GS A0A179HAK1_PURLI/17-109     AC A0A179HAK1.1
#=GS RLA12_ARATH/22-112          AC O23095.2
#=GS A0A1Q3C7G1_CEPFO/55-120     AC A0A1Q3C7G1.1
#=GS J4C932_THEOR/32-115         AC J4C932.1
#=GS A0A2H9TGN6_9FUNG/17-108     AC A0A2H9TGN6.1
#=GS A0A364N7H9_9PLEO/17-110     AC A0A364N7H9.1
#=GS A0A2I3HXL5_NOMLE/22-113     AC A0A2I3HXL5.1
#=GS A0A059AAE4_EUCGR/17-113     AC A0A059AAE4.1
#=GS A0A421JN34_9ASCO/19-110     AC A0A421JN34.1
#=GS I0Z1Z3_COCSC/21-112         AC I0Z1Z3.1
#=GS A0A3Q7W798_URSAR/17-114     AC A0A3Q7W798.1
#=GS A0A5J4YWE1_PORPP/17-109     AC A0A5J4YWE1.1
#=GS A0A1L9UU18_ASPBC/229-311    AC A0A1L9UU18.1
#=GS A0A1B6P8W9_SORBI/50-144     AC A0A1B6P8W9.1
#=GS A0A024GBI1_9STRA/17-108     AC A0A024GBI1.1
#=GS F4P184_BATDJ/23-110         AC F4P184.1
#=GS A0A540L619_MALBA/147-232    AC A0A540L619.1
#=GS A0A5N6P1Q8_9ASTR/201-283    AC A0A5N6P1Q8.1
#=GS E5R1A0_ARTGP/21-109         AC E5R1A0.1
#=GS G0SZG6_RHOT2/229-298        AC G0SZG6.1
#=GS C1BET7_ONCMY/17-112         AC C1BET7.1
#=GS A0A2C5W9I5_9PEZI/229-311    AC A0A2C5W9I5.1
#=GS A0A2G9HH45_9LAMI/17-113     AC A0A2G9HH45.1
#=GS A0A2P7YV00_9ASCO/20-106     AC A0A2P7YV00.1
#=GS A0A094KMP1_9PEZI/229-311    AC A0A094KMP1.1
#=GS A0A314UFQ9_PRUYE/56-151     AC A0A314UFQ9.1
#=GS A0A2K3L706_TRIPR/21-109     AC A0A2K3L706.1
#=GS N0BIB8_9EURY/16-104         AC N0BIB8.1
#=GS A0A3N4L895_9PEZI/17-111     AC A0A3N4L895.1
#=GS G8BKD9_CANPC/17-110         AC G8BKD9.1
#=GS A0A1E3BSV5_9EURO/229-310    AC A0A1E3BSV5.1
#=GS M0TT39_MUSAM/50-122         AC M0TT39.1
#=GS A0A2G9RDD2_LITCT/22-112     AC A0A2G9RDD2.1
#=GS I0Z4G6_COCSC/235-318        AC I0Z4G6.1
#=GS W6KKL3_9TRYP/16-110         AC W6KKL3.1
#=GS A0A316YWL8_9BASI/229-312    AC A0A316YWL8.1
#=GS Q4WJR3_ASPFU/229-312        AC Q4WJR3.1
#=GS A0A2P4T1R7_BAMTH/22-67      AC A0A2P4T1R7.1
#=GS W6MWH3_9ASCO/229-309        AC W6MWH3.1
#=GS A0A2I3T3Q7_PANTR/189-273    AC A0A2I3T3Q7.1
#=GS A0A1J1IDB7_9DIPT/30-123     AC A0A1J1IDB7.1
#=GS A0A1V6PB33_PENDC/17-107     AC A0A1V6PB33.1
#=GS A0A1N6Y0A0_9EURY/16-115     AC A0A1N6Y0A0.1
#=GS RLA1_CAEEL/22-110           AC P91913.2
#=GS A0A2J6JIU3_LACSA/17-112     AC A0A2J6JIU3.1
#=GS A0A1J7IQV0_9PEZI/21-97      AC A0A1J7IQV0.1
#=GS A0A1X2I0F6_9FUNG/17-108     AC A0A1X2I0F6.1
#=GS A0A6A5DJD4_SCHHA/320-406    AC A0A6A5DJD4.1
#=GS A0A0L1KKR2_9EUGL/22-103     AC A0A0L1KKR2.1
#=GS A0A1Y1YRD3_9FUNG/17-108     AC A0A1Y1YRD3.1
#=GS A0A1R3RRC2_ASPC5/21-107     AC A0A1R3RRC2.1
#=GS A0A4Z1NPF0_9PEZI/230-314    AC A0A4Z1NPF0.1
#=GS A0A0D3HR35_9ORYZ/795-880    AC A0A0D3HR35.1
#=GS A0A1Q3CQL1_CEPFO/13-103     AC A0A1Q3CQL1.1
#=GS A0A667XN22_9TELE/231-314    AC A0A667XN22.1
#=GS A0A4U0X4B7_9PEZI/17-115     AC A0A4U0X4B7.1
#=GS A0A3M6XWR0_HORWE/17-111     AC A0A3M6XWR0.1
#=GS A0A0E0R3U5_ORYRU/714-799    AC A0A0E0R3U5.1
#=GS L8WWA9_THACA/86-173         AC L8WWA9.1
#=GS A0A0V0V610_9BILA/231-319    AC A0A0V0V610.1
#=GS A0A2I0XH68_9ASPA/234-320    AC A0A2I0XH68.1
#=GS A0A4U0VJA2_9PEZI/45-131     AC A0A4U0VJA2.1
#=GS A0A4Z1L5Y5_9HELO/21-109     AC A0A4Z1L5Y5.1
#=GS A9P8B5_POPTR/21-123         AC A9P8B5.1
#=GS A0A0B1P6V1_UNCNE/17-111     AC A0A0B1P6V1.1
#=GS A0A133U8H9_9EURY/16-106     AC A0A133U8H9.1
#=GS Q759M0_ASHGO/20-103         AC Q759M0.2
#=GS A0A0E0BNJ6_9ORYZ/326-401    AC A0A0E0BNJ6.1
#=GS V4K537_EUTSA/17-112         AC V4K537.1
#=GS A0A0D1DPN9_USTMA/230-312    AC A0A0D1DPN9.1
#=GS A0A0F7FJ85_9CREN/16-105     AC A0A0F7FJ85.1
#=GS A0A6P6SGX2_COFAR/16-123     AC A0A6P6SGX2.1
#=GS A0BPU8_PARTE/17-112         AC A0BPU8.1
#=GS A0A0D7A014_9AGAR/27-101     AC A0A0D7A014.1
#=GS S0ARE0_FERAC/16-100         AC S0ARE0.1
#=GS A0A427YV69_9TREE/54-135     AC A0A427YV69.1
#=GS A0A1Q5SV16_9EURO/17-110     AC A0A1Q5SV16.1
#=GS A0A1S8W1T3_9FUNG/23-111     AC A0A1S8W1T3.1
#=GS H3GIY1_PHYRM/29-112         AC H3GIY1.1
#=GS A0A3A5WSI8_9ARCH/231-336    AC A0A3A5WSI8.1
#=GS A0A2G9RHT6_LITCT/35-111     AC A0A2G9RHT6.1
#=GS A0A062VDB3_9EURY/16-103     AC A0A062VDB3.1
#=GS A0A078IKY3_BRANA/22-112     AC A0A078IKY3.1
#=GS D3B7S8_POLPP/20-104         AC D3B7S8.1
#=GS A0A4W3J9A1_CALMI/1-84       AC A0A4W3J9A1.1
#=GS A0A423WAM1_9PEZI/17-110     AC A0A423WAM1.1
#=GS A0A2B7Z926_9EURO/21-110     AC A0A2B7Z926.1
#=GS A0A1R2CMQ2_9CILI/17-109     AC A0A1R2CMQ2.1
#=GS A0A2T7EL62_9POAL/17-111     AC A0A2T7EL62.1
#=GS A0A420QZ54_FUSOX/229-312    AC A0A420QZ54.1
#=GS A0A4D9B955_SALSN/17-121     AC A0A4D9B955.1
#=GS C4Y7U5_CLAL4/229-310        AC C4Y7U5.1
#=GS A0A267E1A5_9PLAT/24-112     AC A0A267E1A5.1
#=GS A0A6G0XK03_9STRA/17-109     AC A0A6G0XK03.1
#=GS A0A5N5QL94_9AGAM/17-110     AC A0A5N5QL94.1
#=GS A0A5Q4BY71_9PEZI/17-109     AC A0A5Q4BY71.1
#=GS A0A452Z7Y6_AEGTS/17-112     AC A0A452Z7Y6.1
#=GS D7LSI5_ARALL/21-112         AC D7LSI5.1
#=GS A0A0C3Q7J1_9AGAM/17-111     AC A0A0C3Q7J1.1
#=GS H9JUE4_BOMMO/17-111         AC H9JUE4.1
#=GS A0A2Y9FWJ6_TRIMA/66-134     AC A0A2Y9FWJ6.1
#=GS W6PWQ9_PENRF/229-312        AC W6PWQ9.1
#=GS A0A0M8MUS4_9BASI/21-109     AC A0A0M8MUS4.1
#=GS A0A6I9IUK5_VICPA/22-114     AC A0A6I9IUK5.1
#=GS A0A251SQV9_HELAN/34-130     AC A0A251SQV9.1
#=GS B7G981_PHATC/18-108         AC B7G981.1
#=GS A0A166HZC7_9AGAM/17-114     AC A0A166HZC7.1
#=GS A0A5D2Y3C6_GOSMU/72-166     AC A0A5D2Y3C6.1
#=GS A0A2P6SIU3_ROSCH/21-109     AC A0A2P6SIU3.1
#=GS D8QQI4_SELML/234-319        AC D8QQI4.1
#=GS A0A452GLU3_9SAUR/231-316    AC A0A452GLU3.1
#=GS A0A4Q4VQI4_9PEZI/229-311    AC A0A4Q4VQI4.1
#=GS M1D8Y8_SOLTU/17-117         AC M1D8Y8.1
#=GS R9P0T0_PSEHS/17-111         AC R9P0T0.1
#=GS D3ZPJ2_RAT/17-113           AC D3ZPJ2.2
#=GS A0A383ZL71_BALAS/18-88      AC A0A383ZL71.1
#=GS I3S0D9_MEDTR/21-107         AC I3S0D9.1
#=GS A0A402EGA1_9SAUR/272-355    AC A0A402EGA1.1
#=GS A0A0F7TF09_PENBI/21-108     AC A0A0F7TF09.1
#=GS A0A397ZWN3_BRACM/234-318    AC A0A397ZWN3.1
#=GS A0A2C9VP78_MANES/35-122     AC A0A2C9VP78.1
#=GS S7MP27_MYOBR/22-113         AC S7MP27.1
#=GS A0A0K0CT82_ANGCA/108-199    AC A0A0K0CT82.1
#=GS A0A6D2I1E9_9BRAS/397-493    AC A0A6D2I1E9.1
#=GS W2ZMJ1_PHYPR/17-107         AC W2ZMJ1.1
#=GS A0A3Q7WCJ8_URSAR/231-316    AC A0A3Q7WCJ8.1
#=GS A0A5B8MRJ1_9CHLO/21-105     AC A0A5B8MRJ1.1
#=GS Q2H653_CHAGB/17-110         AC Q2H653.1
#=GS A0A5C3DRK6_9BASI/21-108     AC A0A5C3DRK6.1
#=GS A0A4Y9YER1_9AGAM/229-310    AC A0A4Y9YER1.1
#=GS G0PKT9_CAEBE/17-106         AC G0PKT9.1
#=GS S9UIU7_9TRYP/21-107         AC S9UIU7.1
#=GS A0A1S3GIX3_DIPOR/17-114     AC A0A1S3GIX3.1
#=GS F4C0T2_METSG/16-103         AC F4C0T2.1
#=GS G7J8Y6_MEDTR/21-109         AC G7J8Y6.1
#=GS A0A1U7YL79_NICSY/234-318    AC A0A1U7YL79.1
#=GS A0A4S4EBQ0_CAMSI/9-65       AC A0A4S4EBQ0.1
#=GS A0A287WWA8_HORVV/234-305    AC A0A287WWA8.1
#=GS A0A2K5XGV9_MANLE/22-113     AC A0A2K5XGV9.1
#=GS A0A5D2RWD5_GOSMU/234-320    AC A0A5D2RWD5.1
#=GS A0A2N1JBJ8_9BASI/16-108     AC A0A2N1JBJ8.1
#=GS A0A0E0IXV1_ORYNI/736-821    AC A0A0E0IXV1.1
#=GS A0A6A4ISF6_APOLU/231-314    AC A0A6A4ISF6.1
#=GS I3KBJ9_ORENI/17-109         AC I3KBJ9.2
#=GS A0A1X7S8G3_ZYMTR/21-109     AC A0A1X7S8G3.1
#=GS E3MRJ1_CAERE/17-106         AC E3MRJ1.1
#=GS A0A072PK09_9EURO/17-112     AC A0A072PK09.1
#=GS A0A0R3WA46_TAEAS/17-111     AC A0A0R3WA46.1
#=GS A0A1Q2YM07_9ASCO/19-105     AC A0A1Q2YM07.1
#=GS A0A1U7RT81_ALLSI/231-313    AC A0A1U7RT81.1
#=GS A0A2G3AHQ2_CAPAN/21-93      AC A0A2G3AHQ2.1
#=GS A0A6A1QAE7_BALPH/22-80      AC A0A6A1QAE7.1
#=GS A0A1R2CB96_9CILI/32-117     AC A0A1R2CB96.1
#=GS A0A453S1T6_AEGTS/21-109     AC A0A453S1T6.1
#=GS C5FCM0_ARTOC/21-109         AC C5FCM0.1
#=GS A0A086TF39_ACRC1/228-309    AC A0A086TF39.1
#=GS R9AK78_WALI9/17-105         AC R9AK78.1
#=GS A0A662XP77_9STRA/231-312    AC A0A662XP77.1
#=GS A0A261XXJ8_9FUNG/17-111     AC A0A261XXJ8.1
#=GS A0A1X7R2K7_9SACH/19-105     AC A0A1X7R2K7.1
#=GS A0A087S9K0_AUXPR/18-109     AC A0A087S9K0.1
#=GS A0A183LNU8_9TREM/17-112     AC A0A183LNU8.1
#=GS A0A2Y9M730_DELLE/14-88      AC A0A2Y9M730.1
#=GS A0A3M7A3I9_HORWE/21-97      AC A0A3M7A3I9.1
#=GS G1PZB1_MYOLU/24-114         AC G1PZB1.1
#=GS A0A3R7NGJ3_TRYRA/16-107     AC A0A3R7NGJ3.1
#=GS A0A669DJX6_ORENI/17-113     AC A0A669DJX6.1
#=GS F7PN44_9EURY/16-112         AC F7PN44.1
#=GS G3AJG5_SPAPN/17-107         AC G3AJG5.1
#=GS H3AXH9_LATCH/22-111         AC H3AXH9.1
#=GS A0A1Q3DUU2_LENED/21-108     AC A0A1Q3DUU2.1
#=GS A0A4Z0Z5M7_9PEZI/229-311    AC A0A4Z0Z5M7.1
#=GS A0A2J8AGT3_9CHLO/239-319    AC A0A2J8AGT3.1
#=GS A0A3A3A854_9EURO/229-309    AC A0A3A3A854.1
#=GS A0A4Y7L4H8_PAPSO/148-231    AC A0A4Y7L4H8.1
#=GS A0A1E1K9C5_9HELO/229-313    AC A0A1E1K9C5.1
#=GS A0A1V6Q4Y7_9EURO/229-312    AC A0A1V6Q4Y7.1
#=GS G8BAY4_CANPC/17-111         AC G8BAY4.1
#=GS A0A6J2LV90_9CHIR/17-114     AC A0A6J2LV90.1
#=GS A0A2K5JW45_COLAP/169-255    AC A0A2K5JW45.1
#=GS A0A0G2FSV1_9PEZI/17-110     AC A0A0G2FSV1.1
#=GS A0A4C1T107_EUMVA/17-113     AC A0A4C1T107.1
#=GS A0A5J5C896_9ASTE/17-115     AC A0A5J5C896.1
#=GS T0N9U3_9ARCH/16-103         AC T0N9U3.1
#=GS A0A0M9VTJ6_9HYPO/229-314    AC A0A0M9VTJ6.1
#=GS C4PZS5_SCHMA/231-317        AC C4PZS5.1
#=GS A0A178EAV5_9PLEO/24-96      AC A0A178EAV5.1
#=GS M1H500_ELAGV/17-111         AC M1H500.1
#=GS A0A4S4LE28_9AGAM/17-109     AC A0A4S4LE28.1
#=GS A0A6J2K7W7_BOMMA/22-111     AC A0A6J2K7W7.1
#=GS L0JPD7_NATP1/16-116         AC L0JPD7.1
#=GS A0A7H9AX03_ZYGMR/229-310    AC A0A7H9AX03.1
#=GS A0A2U3WEC5_ODORO/22-113     AC A0A2U3WEC5.1
#=GS A0A3Q3SM37_9TELE/169-252    AC A0A3Q3SM37.1
#=GS A0A251SKA1_HELAN/59-154     AC A0A251SKA1.1
#=GS Q386V3_TRYB2/238-324        AC Q386V3.1
#=GS J8PZ09_SACAR/229-311        AC J8PZ09.1
#=GS A0A2R6PZW0_ACTCC/17-115     AC A0A2R6PZW0.1
#=GS A0A401SFL1_CHIPU/45-136     AC A0A401SFL1.1
#=GS A0A5N5K8N2_9PEZI/21-110     AC A0A5N5K8N2.1
#=GS A0A167W097_9EURO/229-312    AC A0A167W097.1
#=GS A0A1H3GIP2_9EURY/16-113     AC A0A1H3GIP2.1
#=GS A0A5C3MD20_9AGAR/29-117     AC A0A5C3MD20.1
#=GS F6U1E6_XENTR/44-137         AC F6U1E6.1
#=GS A0A0C3GG90_9PEZI/21-109     AC A0A0C3GG90.1
#=GS A0A4U5PD83_STECR/17-109     AC A0A4U5PD83.1
#=GS E3M689_CAERE/66-159         AC E3M689.1
#=GS A0A3P8V994_CYNSE/169-252    AC A0A3P8V994.1
#=GS B9EQJ1_SALSA/17-118         AC B9EQJ1.1
#=GS A0A1E5VH99_9POAL/144-246    AC A0A1E5VH99.1
#=GS A0A6G8TA79_9EURY/16-112     AC A0A6G8TA79.1
#=GS A0A6D2L6T1_9BRAS/17-119     AC A0A6D2L6T1.1
#=GS A0A3Q2XGG8_HAPBU/231-314    AC A0A3Q2XGG8.1
#=GS A0A6J1ICK4_CUCMA/21-110     AC A0A6J1ICK4.1
#=GS A0A6A5MLV8_LUPAL/21-110     AC A0A6A5MLV8.1
#=GS A0A445IJ59_GLYSO/152-248    AC A0A445IJ59.1
#=GS A0A0G4PAP3_PENCA/229-311    AC A0A0G4PAP3.1
#=GS I4YFS6_WALMC/20-105         AC I4YFS6.1
#=GS A0A0A1P1Q7_RHIZD/17-107     AC A0A0A1P1Q7.1
#=GS B2WCX9_PYRTR/17-111         AC B2WCX9.1
#=GS A0A1E3BR99_9EURO/21-106     AC A0A1E3BR99.1
#=GS A0A1Y2LHR4_EPING/21-110     AC A0A1Y2LHR4.1
#=GS A0A4W5PL48_9TELE/231-314    AC A0A4W5PL48.1
#=GS A0A1S3A375_ERIEU/180-265    AC A0A1S3A375.1
#=GS M7AHJ0_CHEMY/231-311        AC M7AHJ0.1
#=GS A0A5N5H6F5_9ROSA/23-101     AC A0A5N5H6F5.1
#=GS A0A1Y3NVP0_PIRSE/17-105     AC A0A1Y3NVP0.1
#=GS D7U827_VITVI/21-110         AC D7U827.1
#=GS A0A6D2KQE6_9BRAS/17-113     AC A0A6D2KQE6.1
#=GS A0A195EAQ4_9HYME/17-113     AC A0A195EAQ4.1
#=GS A0A5D2ZTC1_GOSMU/194-280    AC A0A5D2ZTC1.1
#=GS C5GU38_AJEDR/17-111         AC C5GU38.1
#=GS M0XWV5_HORVV/21-108         AC M0XWV5.1
#=GS A0A4Y7LGM8_PAPSO/234-320    AC A0A4Y7LGM8.1
#=GS A0A662YKK5_9STRA/1-77       AC A0A662YKK5.1
#=GS A0A3Q2DN55_CYPVA/169-251    AC A0A3Q2DN55.1
#=GS A0A0J8URJ2_COCIT/17-110     AC A0A0J8URJ2.1
#=GS B6QMA1_TALMQ/17-110         AC B6QMA1.1
#=GS A0A0D3HHV9_9ORYZ/658-743    AC A0A0D3HHV9.1
#=GS A0A6P9D5M9_PANGU/22-111     AC A0A6P9D5M9.1
#=GS A0A6I9L1J6_PERMB/22-113     AC A0A6I9L1J6.1
#=GS B8GIY5_METPE/16-101         AC B8GIY5.1
#=GS A0A6L2Q1V6_COPFO/36-124     AC A0A6L2Q1V6.1
#=GS A0A078IVX8_BRANA/233-320    AC A0A078IVX8.1
#=GS D7MJC6_ARALL/17-113         AC D7MJC6.1
#=GS A0A1E3NN13_9ASCO/17-107     AC A0A1E3NN13.1
#=GS A0A1E5RDL2_9ASCO/229-312    AC A0A1E5RDL2.1
#=GS G4YPM2_PHYSP/29-111         AC G4YPM2.1
#=GS A2G448_TRIVA/20-102         AC A2G448.1
#=GS A0A077Z0E6_TRITR/23-111     AC A0A077Z0E6.1
#=GS A0A1U7Z5Q6_NELNU/234-319    AC A0A1U7Z5Q6.1
#=GS A0A2G2WC56_CAPBA/31-117     AC A0A2G2WC56.1
#=GS A0A4T0PSQ3_9BASI/17-106     AC A0A4T0PSQ3.1
#=GS J3NQY2_GAET3/229-312        AC J3NQY2.1
#=GS A0A2A9N7I8_9AGAR/22-109     AC A0A2A9N7I8.1
#=GS A0A5A7PUE0_STRAF/16-119     AC A0A5A7PUE0.1
#=GS A0A3N0Z5T3_ANAGA/231-315    AC A0A3N0Z5T3.1
#=GS A0A6J1HYH2_CUCMA/21-109     AC A0A6J1HYH2.1
#=GS A0A6P4A578_ZIZJJ/13-102     AC A0A6P4A578.1
#=GS Q5CPN9_CRYPI/19-111         AC Q5CPN9.1
#=GS A0A540N5G4_MALBA/1-64       AC A0A540N5G4.1
#=GS W7JIT2_PLAFA/19-111         AC W7JIT2.1
#=GS A0A2G2WNS6_CAPBA/234-317    AC A0A2G2WNS6.1
#=GS D7MP19_ARALL/22-110         AC D7MP19.1
#=GS A0A229WZE6_9EURO/21-110     AC A0A229WZE6.1
#=GS A0A6J2VKM4_CHACN/17-114     AC A0A6J2VKM4.1
#=GS A0A0S3RIA3_PHAAN/21-111     AC A0A0S3RIA3.1
#=GS A0A6J0PAA7_RAPSA/233-320    AC A0A6J0PAA7.1
#=GS A0A6P5JUF2_PHACI/17-108     AC A0A6P5JUF2.1
#=GS A0A2G3C0B0_CAPCH/22-75      AC A0A2G3C0B0.1
#=GS A0A6G1PHW2_9TELE/231-315    AC A0A6G1PHW2.1
#=GS D8R8W3_SELML/17-69          AC D8R8W3.1
#=GS A0A091NBH8_9PASS/207-300    AC A0A091NBH8.1
#=GS V4TRV2_CITCL/20-107         AC V4TRV2.1
#=GS T0KZS3_9MICR/17-104         AC T0KZS3.1
#=GS U3A402_9EURY/16-114         AC U3A402.1
#=GS A0A212F273_DANPL/17-111     AC A0A212F273.1
#=GS A0A6I9LDI5_PERMB/17-113     AC A0A6I9LDI5.1
#=GS A0A087GTG4_ARAAL/17-114     AC A0A087GTG4.1
#=GS A0A2U4BWY3_TURTR/17-100     AC A0A2U4BWY3.1
#=GS A0A4U0UU79_9PEZI/259-343    AC A0A4U0UU79.1
#=GS A0A6J5TE15_PRUAR/16-118     AC A0A6J5TE15.1
#=GS A0A1D3TI39_9APIC/231-313    AC A0A1D3TI39.1
#=GS A0A0D9Y4F0_9ORYZ/17-113     AC A0A0D9Y4F0.1
#=GS A0A176VJ96_MARPO/234-305    AC A0A176VJ96.1
#=GS A0A0D3GVS2_9ORYZ/53-141     AC A0A0D3GVS2.1
#=GS D7SN28_VITVI/49-144         AC D7SN28.1
#=GS A6R5E8_AJECN/229-311        AC A6R5E8.1
#=GS L0JXF6_9EURY/16-113         AC L0JXF6.1
#=GS A0A2G2VYE9_CAPBA/19-97      AC A0A2G2VYE9.1
#=GS A0A2R8MSP2_CALJA/22-113     AC A0A2R8MSP2.2
#=GS A2EES5_TRIVA/233-316        AC A2EES5.1
#=GS A0A448ZRL0_9STRA/17-105     AC A0A448ZRL0.1
#=GS A0A443N9M4_9MAGN/39-123     AC A0A443N9M4.1
#=GS A0A5N5PMW6_9PEZI/17-111     AC A0A5N5PMW6.1
#=GS A0A2H1A7B1_CANAR/20-106     AC A0A2H1A7B1.1
#=GS A0A1B7P029_9EURO/229-312    AC A0A1B7P029.1
#=GS G3NIT1_GASAC/22-112         AC G3NIT1.1
#=GS W6MQD8_9ASCO/22-108         AC W6MQD8.1
#=GS S0DU22_GIBF5/229-312        AC S0DU22.1
#=GS A0A0G4EYJ3_VITBC/32-123     AC A0A0G4EYJ3.1
#=GS A0A2T3A3A9_9PEZI/229-312    AC A0A2T3A3A9.1
#=GS F1SIT7_PIG/22-113           AC F1SIT7.1
#=GS A0A0D8XIM3_DICVI/22-114     AC A0A0D8XIM3.1
#=GS A0A1Q1FLW4_9EURY/16-116     AC A0A1Q1FLW4.1
#=GS A0A1C3KYR9_PLAMA/19-111     AC A0A1C3KYR9.1
#=GS A0A067KSE6_JATCU/17-113     AC A0A067KSE6.1
#=GS A0A6J0ZTB8_9ROSI/21-110     AC A0A6J0ZTB8.1
#=GS H1Z400_9EURY/16-100         AC H1Z400.1
#=GS A0A444FLX0_ENSVE/95-150     AC A0A444FLX0.1
#=GS A0A671E9Q1_RHIFE/17-94      AC A0A671E9Q1.1
#=GS A0A6P5JS16_PHACI/17-115     AC A0A6P5JS16.1
#=GS A0A0C2X5B9_AMAMU/17-111     AC A0A0C2X5B9.1
#=GS A0A444FLP8_ENSVE/342-426    AC A0A444FLP8.1
#=GS A0A0V1MX23_9BILA/22-112     AC A0A0V1MX23.1
#=GS A0A446XRS3_TRITD/36-119     AC A0A446XRS3.1
#=GS A0A1B7TDA5_9ASCO/16-104     AC A0A1B7TDA5.1
#=GS A0A4S2LAR3_9HYME/231-317    AC A0A4S2LAR3.1
#=GS E9ACI8_LEIMA/21-110         AC E9ACI8.1
#=GS Q54JK3_DICDI/17-99          AC Q54JK3.1
#=GS A0A0D3E1F6_BRAOL/22-56      AC A0A0D3E1F6.1
#=GS A0A0E0IXV2_ORYNI/745-830    AC A0A0E0IXV2.1
#=GS A0A0D2RL99_GOSRA/234-320    AC A0A0D2RL99.1
#=GS A0A5D3BPB6_CUCME/198-282    AC A0A5D3BPB6.1
#=GS A0A556VAL9_BAGYA/11-74      AC A0A556VAL9.1
#=GS A0A2S5B5X6_9BASI/16-95      AC A0A2S5B5X6.1
#=GS A0A251K3W2_MANES/17-115     AC A0A251K3W2.1
#=GS A0A1V4JNG3_PATFA/32-129     AC A0A1V4JNG3.1
#=GS A0A0H5BZH5_CYBJN/19-104     AC A0A0H5BZH5.1
#=GS A0A4U0XBH3_9PEZI/21-113     AC A0A4U0XBH3.1
#=GS R0HM53_9BRAS/17-115         AC R0HM53.1
#=GS A0A507R2P5_MONPU/229-310    AC A0A507R2P5.1
#=GS A0A152AAB4_9MYCE/21-112     AC A0A152AAB4.1
#=GS A0A072VLF0_MEDTR/17-112     AC A0A072VLF0.1
#=GS C7YSC3_FUSV7/21-108         AC C7YSC3.1
#=GS A0A4W5LUJ3_9TELE/17-65      AC A0A4W5LUJ3.1
#=GS A0A6P4A9C1_ZIZJJ/17-114     AC A0A6P4A9C1.1
#=GS A0A1J4JHM5_9EUKA/17-104     AC A0A1J4JHM5.1
#=GS A0A4P9Z8K8_9ASCO/17-108     AC A0A4P9Z8K8.1
#=GS A0A3M7P5V4_BRAPC/23-111     AC A0A3M7P5V4.1
#=GS G0EDK8_PYRF1/16-109         AC G0EDK8.1
#=GS A0A2R6X4P2_MARPO/17-112     AC A0A2R6X4P2.1
#=GS A0A1J9RX35_9PEZI/17-108     AC A0A1J9RX35.1
#=GS B7G9J9_PHATC/172-255        AC B7G9J9.1
#=GS A0A369GNL6_9HYPO/17-110     AC A0A369GNL6.1
#=GS A0A0E0I6V6_ORYNI/234-318    AC A0A0E0I6V6.1
#=GS G0PMZ4_CAEBE/22-127         AC G0PMZ4.1
#=GS A0A445D7M3_ARAHY/17-112     AC A0A445D7M3.1
#=GS A0A2G4SWV8_RHIZD/20-106     AC A0A2G4SWV8.1
#=GS A0A4X2LSB4_VOMUR/17-115     AC A0A4X2LSB4.1
#=GS A0A671DIT1_RHIFE/146-231    AC A0A671DIT1.1
#=GS A0A0M8MNC0_9BASI/229-311    AC A0A0M8MNC0.1
#=GS A0A133URW2_9EURY/1-79       AC A0A133URW2.1
#=GS A0A6I9QZJ3_ELAGV/21-112     AC A0A6I9QZJ3.1
#=GS A0A493T2W0_ANAPP/22-113     AC A0A493T2W0.1
#=GS A0A4P9ZBK6_9ASCO/33-121     AC A0A4P9ZBK6.1
#=GS A0A2K5HB77_COLAP/186-268    AC A0A2K5HB77.1
#=GS A0A6P6W8B9_COFAR/234-319    AC A0A6P6W8B9.1
#=GS A0A4Q4W8R3_9PEZI/21-110     AC A0A4Q4W8R3.1
#=GS A0A1B9HUE7_9TREE/20-108     AC A0A1B9HUE7.1
#=GS A0A6J2U5L0_DROLE/22-112     AC A0A6J2U5L0.1
#=GS A0A7D8YPN5_9HELO/17-111     AC A0A7D8YPN5.1
#=GS C4WTD6_ACYPI/16-111         AC C4WTD6.1
#=GS H6BRF5_EXODN/17-114         AC H6BRF5.1
#=GS W1PIE2_AMBTC/234-321        AC W1PIE2.1
#=GS A0A6J1ARA8_9ROSI/17-112     AC A0A6J1ARA8.1
#=GS W6MSY1_9ASCO/17-108         AC W6MSY1.1
#=GS A0A5C3N851_9AGAM/229-311    AC A0A5C3N851.1
#=GS A8J5Z0_CHLRE/239-319        AC A8J5Z0.1
#=GS A0A2P6SL27_ROSCH/233-319    AC A0A2P6SL27.1
#=GS A0A3Q7N8G1_CALUR/17-114     AC A0A3Q7N8G1.1
#=GS A0A4Q2D7X5_9AGAR/21-109     AC A0A4Q2D7X5.1
#=GS A0A6I8W9E4_DROPS/17-113     AC A0A6I8W9E4.1
#=GS RL10_META3/237-338          AC A6UTF8.1
#=GS A0A0E0HUY8_ORYNI/57-118     AC A0A0E0HUY8.1
#=GS A0A0D2KIL7_9EURO/17-114     AC A0A0D2KIL7.1
#=GS A0A4Y8DFZ8_9HELO/17-110     AC A0A4Y8DFZ8.1
#=GS A0A2K5ASW9_9ARCH/18-104     AC A0A2K5ASW9.1
#=GS RLA11_ARATH/22-111          AC Q8LCW9.2
#=GS A0A087V5F6_BALRE/17-114     AC A0A087V5F6.1
#=GS M7TM82_EUTLA/21-108         AC M7TM82.1
#=GS C3Z0M5_BRAFL/231-313        AC C3Z0M5.1
#=GS A0A4Z1P290_9PEZI/21-109     AC A0A4Z1P290.1
#=GS A0A1J1IYU8_9DIPT/231-315    AC A0A1J1IYU8.1
#=GS A0A3Q3WAQ4_MOLML/17-109     AC A0A3Q3WAQ4.1
#=GS A0A5N3XG47_MUNRE/22-98      AC A0A5N3XG47.1
#=GS A0A238BQW4_9BILA/21-61      AC A0A238BQW4.1
#=GS A0A6P4BMP3_ARADU/21-111     AC A0A6P4BMP3.1
#=GS B4HCG5_DROPE/17-113         AC B4HCG5.1
#=GS A0A7N5K3Q3_AILME/22-113     AC A0A7N5K3Q3.1
#=GS A0A7D5E1N9_9EURY/16-112     AC A0A7D5E1N9.1
#=GS B3S1V3_TRIAD/17-111         AC B3S1V3.1
#=GS A0A2J8JVL5_PANTR/17-114     AC A0A2J8JVL5.1
#=GS A0A6P5N9Q4_ARADU/17-112     AC A0A6P5N9Q4.1
#=GS Q5KEJ6_CRYNJ/229-311        AC Q5KEJ6.1
#=GS A0A1Y2E2E5_9PEZI/21-109     AC A0A1Y2E2E5.1
#=GS A0A3S3S4N2_9ACAR/231-313    AC A0A3S3S4N2.1
#=GS A0A2V0NVX4_9CHLO/233-312    AC A0A2V0NVX4.1
#=GS A0A061AUN1_CYBFA/229-311    AC A0A061AUN1.1
#=GS I7GJL8_MACFA/231-317        AC I7GJL8.1
#=GS A0A6D2KJ72_9BRAS/17-113     AC A0A6D2KJ72.1
#=GS A0A103YMP1_CYNCS/268-355    AC A0A103YMP1.1
#=GS A0A3Q2X7J0_HAPBU/17-113     AC A0A3Q2X7J0.1
#=GS A0A094BZI5_9PEZI/229-310    AC A0A094BZI5.1
#=GS U6GUC9_EIMAC/32-122         AC U6GUC9.1
#=GS A0A0V0QJ89_PSEPJ/32-115     AC A0A0V0QJ89.1
#=GS L1JIG4_GUITC/17-109         AC L1JIG4.1
#=GS T5AAB3_OPHSC/229-312        AC T5AAB3.1
#=GS A0A317VTH1_9EURO/21-107     AC A0A317VTH1.1
#=GS A0A3M0KNZ3_HIRRU/22-113     AC A0A3M0KNZ3.1
#=GS A0A0E0KG87_ORYPU/1241-1321  AC A0A0E0KG87.1
#=GS A0A1C3YJQ9_GIBZE/32-123     AC A0A1C3YJQ9.1
#=GS A0A2T7ENM8_9POAL/17-111     AC A0A2T7ENM8.1
#=GS A0A4S4N0B1_9APHY/229-313    AC A0A4S4N0B1.1
#=GS A0A4U0V9M4_9PEZI/17-116     AC A0A4U0V9M4.1
#=GS A0A075ASU5_ROZAC/231-308    AC A0A075ASU5.1
#=GS A0A6A2X883_HIBSY/22-113     AC A0A6A2X883.1
#=GS A0A199VDV9_ANACO/234-319    AC A0A199VDV9.1
#=GS D2V2C3_NAEGR/29-113         AC D2V2C3.1
#=GS A0A4U5MYZ6_POPAL/234-319    AC A0A4U5MYZ6.1
#=GS A0A6J3MDL5_9PEZI/17-112     AC A0A6J3MDL5.1
#=GS B9HHM2_POPTR/234-321        AC B9HHM2.1
#=GS A0A316YZN0_9BASI/17-112     AC A0A316YZN0.1
#=GS A0A0V0J1I4_SCHSO/231-317    AC A0A0V0J1I4.1
#=GS A0A1H3VY94_9EURY/16-114     AC A0A1H3VY94.1
#=GS A0A3Q8IDC2_LEIDO/238-323    AC A0A3Q8IDC2.1
#=GS A0A2T4GKZ5_FUSCU/17-108     AC A0A2T4GKZ5.1
#=GS A0A3P4RU16_GULGU/11-103     AC A0A3P4RU16.1
#=GS A0A0B0PL55_GOSAR/234-319    AC A0A0B0PL55.1
#=GS J9P5J5_CANLF/22-113         AC J9P5J5.1
#=GS A0A5N6K933_9HELO/229-311    AC A0A5N6K933.1
#=GS A0A665T2V3_ECHNA/17-115     AC A0A665T2V3.1
#=GS A0A5E4C2E9_MARMO/231-319    AC A0A5E4C2E9.1
#=GS A0A3G1T1L2_GALME/17-111     AC A0A3G1T1L2.1
#=GS A0A2T4AC59_TRIHA/21-107     AC A0A2T4AC59.1
#=GS A0A1E1JSS7_9HELO/17-111     AC A0A1E1JSS7.1
#=GS A0A565BSH9_9BRAS/17-114     AC A0A565BSH9.1
#=GS B1L761_KORCO/26-110         AC B1L761.1
#=GS A0A4W2CQ84_BOBOX/22-113     AC A0A4W2CQ84.1
#=GS A0A2R6X0V7_MARPO/234-321    AC A0A2R6X0V7.1
#=GS A0A6J1BBN0_9ROSI/17-113     AC A0A6J1BBN0.1
#=GS A0A0F7ZTX5_9HYPO/21-108     AC A0A0F7ZTX5.1
#=GS A0A0Q3LWE1_AMAAE/22-114     AC A0A0Q3LWE1.1
#=GS F5HKA3_ANOGA/17-111         AC F5HKA3.1
#=GS R8BER4_TOGMI/17-110         AC R8BER4.1
#=GS A0A6A5LSW6_LUPAL/5-73       AC A0A6A5LSW6.1
#=GS A0A484E4D4_BRELC/231-311    AC A0A484E4D4.1
#=GS A0A0U1M605_TALIS/229-311    AC A0A0U1M605.1
#=GS A0A671YV01_SPAAU/17-114     AC A0A671YV01.1
#=GS F0VMM1_NEOCL/19-110         AC F0VMM1.1
#=GS K6UJU1_PLACD/19-110         AC K6UJU1.1
#=GS A0A2K5CV41_AOTNA/22-93      AC A0A2K5CV41.1
#=GS H2Q703_PANTR/229-314        AC H2Q703.2
#=GS G1TIS9_RABIT/18-105         AC G1TIS9.2
#=GS A0A1U7RWY4_ALLSI/17-110     AC A0A1U7RWY4.1
#=GS A0A397TET4_9GLOM/231-313    AC A0A397TET4.1
#=GS C5YM25_SORBI/21-108         AC C5YM25.1
#=GS A0A0V1J7C5_TRIPS/22-112     AC A0A0V1J7C5.1
#=GS G2ML77_9EURY/16-117         AC G2ML77.1
#=GS Q6P5K3_DANRE/231-315        AC Q6P5K3.1
#=GS A0A0K0EK08_STRER/22-112     AC A0A0K0EK08.1
#=GS A8XSD1_CAEBR/17-109         AC A8XSD1.1
#=GS A0A6A5LDE7_LUPAL/171-266    AC A0A6A5LDE7.1
#=GS A0A1V1SWN4_9FUNG/21-108     AC A0A1V1SWN4.1
#=GS A0A177DS57_ALTAL/229-313    AC A0A177DS57.1
#=GS H0ECZ5_GLAL7/229-312        AC H0ECZ5.1
#=GS A0A094H2W4_9PEZI/229-311    AC A0A094H2W4.1
#=GS M0TAL6_MUSAM/21-67          AC M0TAL6.1
#=GS A0A087Y7H1_POEFO/17-115     AC A0A087Y7H1.2
#=GS A0A5C7HMM6_9ROSI/17-110     AC A0A5C7HMM6.1
#=GS A0A6I9ZQ55_ACIJB/231-316    AC A0A6I9ZQ55.1
#=GS A0A4Y7TSF3_9AGAR/17-110     AC A0A4Y7TSF3.1
#=GS Q6BI47_DEBHA/17-109         AC Q6BI47.1
#=GS A0A0L0RVY2_ALLM3/17-106     AC A0A0L0RVY2.1
#=GS A0A2K5KWB9_CERAT/220-302    AC A0A2K5KWB9.1
#=GS A0A133VAL2_9EURY/16-100     AC A0A133VAL2.1
#=GS A0A341CG43_NEOAA/18-88      AC A0A341CG43.1
#=GS A0A544ZYP2_9PEZI/17-109     AC A0A544ZYP2.1
#=GS G4ZU26_PHYSP/17-105         AC G4ZU26.1
#=GS M5EC80_MALS4/17-110         AC M5EC80.1
#=GS A0A3Q1AIV2_AMPOC/169-252    AC A0A3Q1AIV2.1
#=GS A3LWF9_PICST/229-311        AC A3LWF9.1
#=GS A0A0L0FQ07_9EUKA/230-317    AC A0A0L0FQ07.1
#=GS A0A024G4P5_9STRA/231-312    AC A0A024G4P5.1
#=GS W1QDM2_OGAPD/20-107         AC W1QDM2.1
#=GS A0A6J1CPQ6_MOMCH/17-118     AC A0A6J1CPQ6.1
#=GS A0A024US91_9STRA/16-107     AC A0A024US91.1
#=GS A0A0F0I5P4_ASPPU/17-108     AC A0A0F0I5P4.1
#=GS A0A423VJW9_9PEZI/229-313    AC A0A423VJW9.1
#=GS A0A1R3HIN8_COCAP/17-112     AC A0A1R3HIN8.1
#=GS A0A078GVP7_BRANA/17-112     AC A0A078GVP7.1
#=GS A0A3P7NN30_DIBLA/1-48       AC A0A3P7NN30.1
#=GS A0A671RYF3_9TELE/22-89      AC A0A671RYF3.1
#=GS A0A2V5GYI8_ASPV1/229-311    AC A0A2V5GYI8.1
#=GS A0A0C2WBR1_AMAMU/229-311    AC A0A0C2WBR1.1
#=GS G0NTG4_CAEBE/17-110         AC G0NTG4.1
#=GS A0A448YTA2_BRENA/229-311    AC A0A448YTA2.1
#=GS A0A4X3PF00_PRIPA/17-108     AC A0A4X3PF00.1
#=GS B4UN30_CANGA/19-105         AC B4UN30.1
#=GS A0A6J3H8U1_SAPAP/17-120     AC A0A6J3H8U1.1
#=GS A0A167AWV8_METRR/21-108     AC A0A167AWV8.1
#=GS A0A6A6N108_HEVBR/255-341    AC A0A6A6N108.1
#=GS A0A2P6N9C4_9EUKA/17-111     AC A0A2P6N9C4.1
#=GS A0A164VXJ4_9AGAM/17-114     AC A0A164VXJ4.1
#=GS Q4D991_TRYCC/21-108         AC Q4D991.1
#=GS A0A4Q2DW22_9AGAR/17-111     AC A0A4Q2DW22.1
#=GS A0A388JUV0_CHABU/43-134     AC A0A388JUV0.1
#=GS U1NK80_9EURY/16-112         AC U1NK80.1
#=GS A0A6P5YVJ1_DURZI/234-319    AC A0A6P5YVJ1.1
#=GS A0A6S7NUD0_LACSI/49-144     AC A0A6S7NUD0.1
#=GS B9T6Y4_RICCO/9-97           AC B9T6Y4.1
#=GS A0A444G697_ENSVE/58-135     AC A0A444G697.1
#=GS A0A397IY36_9GLOM/231-313    AC A0A397IY36.1
#=GS S0E701_GIBF5/21-108         AC S0E701.1
#=GS A0A1R3J6G9_9ROSI/234-321    AC A0A1R3J6G9.1
#=GS A0A329SH80_9STRA/29-111     AC A0A329SH80.1
#=GS A0A507FB07_9FUNG/37-131     AC A0A507FB07.1
#=GS A0A2U3V2F6_TURTR/18-88      AC A0A2U3V2F6.1
#=GS A0A7E4W9G6_PANRE/231-314    AC A0A7E4W9G6.1
#=GS Q0W052_METAR/10-102         AC Q0W052.1
#=GS A0A667X9M4_9TELE/22-112     AC A0A667X9M4.1
#=GS A0A5C6N4C5_9TELE/282-376    AC A0A5C6N4C5.1
#=GS A0A084GAJ0_PSEDA/228-312    AC A0A084GAJ0.1
#=GS H0A9U8_HALSG/16-103         AC H0A9U8.1
#=GS W1QFP7_OGAPD/50-141         AC W1QFP7.1
#=GS A0A553IA82_9PEZI/21-110     AC A0A553IA82.1
#=GS A0A3Q7XX15_CICAR/21-96      AC A0A3Q7XX15.1
#=GS A0A1A8VRR1_9APIC/19-110     AC A0A1A8VRR1.1
#=GS A0A397XPU2_BRACM/22-112     AC A0A397XPU2.1
#=GS A0A6P4A4S6_ZIZJJ/21-111     AC A0A6P4A4S6.1
#=GS A0A341CGD0_NEOAA/17-86      AC A0A341CGD0.1
#=GS A0A5N5N8T5_9PEZI/229-314    AC A0A5N5N8T5.1
#=GS A0A6P7U3W7_OCTVU/17-115     AC A0A6P7U3W7.1
#=GS A0A5N6UJF3_9EURO/17-107     AC A0A5N6UJF3.1
#=GS M7UCK7_BOTF1/229-311        AC M7UCK7.1
#=GS G0P187_CAEBE/17-107         AC G0P187.1
#=GS B8C7F9_THAPS/17-110         AC B8C7F9.1
#=GS D8Q5T1_SCHCM/229-310        AC D8Q5T1.1
#=GS A0A5B6UXK5_9ROSI/22-113     AC A0A5B6UXK5.1
#=GS B0DP12_LACBS/21-115         AC B0DP12.1
#=GS A0A093ZMG2_9PEZI/17-108     AC A0A093ZMG2.1
#=GS A0A2J6QKJ9_9HELO/17-111     AC A0A2J6QKJ9.1
#=GS G3B4H5_CANTC/229-312        AC G3B4H5.1
#=GS A0A1B7TGH6_9ASCO/16-106     AC A0A1B7TGH6.1
#=GS A0A0B2WK83_METAS/21-106     AC A0A0B2WK83.1
#=GS A0A178BD91_9PLEO/229-314    AC A0A178BD91.1
#=GS A0A067MHP0_9AGAM/21-109     AC A0A067MHP0.1
#=GS A0A3R5TRA8_MYTGA/17-109     AC A0A3R5TRA8.1
#=GS A0A0V1NWC4_9BILA/231-319    AC A0A0V1NWC4.1
#=GS A0A093XEK5_9PEZI/229-309    AC A0A093XEK5.1
#=GS A0A482WZY2_LAOST/21-112     AC A0A482WZY2.1
#=GS A0A5P1F1E7_ASPOF/17-111     AC A0A5P1F1E7.1
#=GS A0A267FKT3_9PLAT/27-121     AC A0A267FKT3.1
#=GS A0A096N8E2_PAPAN/17-114     AC A0A096N8E2.1
#=GS A0A1E3PGQ7_9ASCO/20-104     AC A0A1E3PGQ7.1
#=GS A0A2I3FX62_NOMLE/12-102     AC A0A2I3FX62.1
#=GS A0A2U1NIS8_ARTAN/35-118     AC A0A2U1NIS8.1
#=GS RLA2_PIG/17-114             AC Q29315.1
#=GS A0A384L354_PLAKH/19-110     AC A0A384L354.1
#=GS D7DR73_METV3/16-98          AC D7DR73.1
#=GS L8HUF0_9CETA/34-131         AC L8HUF0.1
#=GS D2A6C6_TRICA/17-111         AC D2A6C6.1
#=GS A0A166REW4_9EURY/16-106     AC A0A166REW4.1
#=GS A0A550C7E5_9AGAR/17-110     AC A0A550C7E5.1
#=GS A0A6J2S2Y8_COTGO/17-114     AC A0A6J2S2Y8.1
#=GS A0A5E4R116_9NEOP/16-111     AC A0A5E4R116.1
#=GS A0A1C7LJP6_GRIFR/21-109     AC A0A1C7LJP6.1
#=GS A0A6P8QB17_GEOSA/17-113     AC A0A6P8QB17.1
#=GS B8MDW1_TALSN/17-110         AC B8MDW1.1
#=GS A0A4U1F5Y5_MONMO/22-113     AC A0A4U1F5Y5.1
#=GS A0A0D2V3D2_GOSRA/234-319    AC A0A0D2V3D2.1
#=GS A0A1B9IKQ8_9TREE/17-112     AC A0A1B9IKQ8.1
#=GS A0A061D7L4_BABBI/32-117     AC A0A061D7L4.1
#=GS A0A164TUF4_9AGAM/229-312    AC A0A164TUF4.1
#=GS A0A6P6STN2_COFAR/21-111     AC A0A6P6STN2.1
#=GS A0A2U1KVQ7_ARTAN/22-68      AC A0A2U1KVQ7.1
#=GS A0A2G4SFP1_RHIZD/20-104     AC A0A2G4SFP1.1
#=GS A0A4X2LN76_VOMUR/23-115     AC A0A4X2LN76.1
#=GS A0A421JIH8_9ASCO/20-107     AC A0A421JIH8.1
#=GS A0A4D9A4B2_SALSN/234-319    AC A0A4D9A4B2.1
#=GS M9M6D0_PSEA3/230-312        AC M9M6D0.1
#=GS A0A096MMQ6_PAPAN/22-113     AC A0A096MMQ6.1
#=GS A0A314Y1J8_PRUYE/17-113     AC A0A314Y1J8.1
#=GS A0A5E4FG15_PRUDU/21-109     AC A0A5E4FG15.1
#=GS A0A448YJ44_BRENA/21-109     AC A0A448YJ44.1
#=GS A0A2H3T526_FUSOX/21-108     AC A0A2H3T526.1
#=GS A0A674K878_TERCA/22-111     AC A0A674K878.1
#=GS A0A4Q1BME8_TREME/17-112     AC A0A4Q1BME8.1
#=GS A0A1G4JPD3_9SACH/19-104     AC A0A1G4JPD3.1
#=GS B8NZ89_POSPM/229-314        AC B8NZ89.1
#=GS A0A1S8A5I8_ROSNE/229-312    AC A0A1S8A5I8.1
#=GS A0A6P5S2N3_PRUAV/17-112     AC A0A6P5S2N3.1
#=GS A0A1A6FUT8_NEOLE/221-300    AC A0A1A6FUT8.1
#=GS RLA0_SCHPO/229-311          AC O74864.1
#=GS A0A4U0XMB0_9PEZI/259-343    AC A0A4U0XMB0.1
#=GS A0A2U3WUZ7_ODORO/23-106     AC A0A2U3WUZ7.1
#=GS A0A087U9F3_STEMI/22-115     AC A0A087U9F3.1
#=GS A0A091H039_BUCRH/211-297    AC A0A091H039.1
#=GS A0A1U7LLG9_NEOID/17-110     AC A0A1U7LLG9.1
#=GS A0A485P9R5_LYNPA/23-114     AC A0A485P9R5.1
#=GS A0A4Y7L9P3_PAPSO/48-142     AC A0A4Y7L9P3.1
#=GS A0A317WF27_9EURO/229-311    AC A0A317WF27.1
#=GS A0A4S8JAT4_MUSBA/22-112     AC A0A4S8JAT4.1
#=GS A0A200RBZ7_9MAGN/21-107     AC A0A200RBZ7.1
#=GS RLA1_DICDI/24-112           AC P22684.1
#=GS A0A0C9MGG0_9FUNG/55-134     AC A0A0C9MGG0.1
#=GS A0A540KCR5_MALBA/18-120     AC A0A540KCR5.1
#=GS F1PUX4_CANLF/231-316        AC F1PUX4.1
#=GS A0A5N6PSX6_9ASTR/341-427    AC A0A5N6PSX6.1
#=GS A0A7E4V0B0_PANRE/22-110     AC A0A7E4V0B0.1
#=GS A0A0N0DQX7_9TRYP/21-109     AC A0A0N0DQX7.1
#=GS B4FVI4_MAIZE/17-110         AC B4FVI4.1
#=GS A0A1G9T2L5_9EURY/16-108     AC A0A1G9T2L5.1
#=GS A0CRF6_PARTE/66-150         AC A0CRF6.1
#=GS A0A4V3XF56_9AGAM/229-310    AC A0A4V3XF56.1
#=GS A0A0D2F3Q6_9EURO/229-314    AC A0A0D2F3Q6.1
#=GS A0A4U6U124_SETVI/234-317    AC A0A4U6U124.1
#=GS A0A445L3Z1_GLYSO/21-109     AC A0A445L3Z1.1
#=GS A0A517KXG7_9PEZI/17-110     AC A0A517KXG7.1
#=GS A0A2G3D4G5_CAPCH/257-342    AC A0A2G3D4G5.1
#=GS A0A2K5HIN7_COLAP/22-113     AC A0A2K5HIN7.1
#=GS A0A6I8Q1B8_XENTR/210-292    AC A0A6I8Q1B8.1
#=GS A0A6D2HX02_9BRAS/5-84       AC A0A6D2HX02.1
#=GS A0A3P8UP02_CYNSE/17-114     AC A0A3P8UP02.1
#=GS W7M5R1_GIBM7/17-109         AC W7M5R1.1
#=GS F4WLI8_ACREC/22-111         AC F4WLI8.1
#=GS G8JSD1_ERECY/17-107         AC G8JSD1.1
#=GS A0A6B9T7Z4_9ARCH/16-104     AC A0A6B9T7Z4.1
#=GS A0A445E7A5_ARAHY/17-116     AC A0A445E7A5.1
#=GS A0A3B0JLU0_DROGU/231-315    AC A0A3B0JLU0.1
#=GS A0A6J0MYD2_RAPSA/234-317    AC A0A6J0MYD2.1
#=GS A0A0V1CZ50_TRIBR/204-292    AC A0A0V1CZ50.1
#=GS A0A1Y2G3A1_9BASI/229-311    AC A0A1Y2G3A1.1
#=GS A0A1J4JNM8_9EUKA/21-105     AC A0A1J4JNM8.1
#=GS A0A5D2YMX0_GOSMU/17-113     AC A0A5D2YMX0.1
#=GS V4BY94_LOTGI/22-111         AC V4BY94.1
#=GS A0A395SJC3_FUSSP/17-108     AC A0A395SJC3.1
#=GS A0A5N6NPE2_9ASTR/21-110     AC A0A5N6NPE2.1
#=GS A0A1C7N8Z8_9FUNG/20-105     AC A0A1C7N8Z8.1
#=GS A0A0K9RP60_SPIOL/234-321    AC A0A0K9RP60.1
#=GS A0A0B7N8G9_9FUNG/228-307    AC A0A0B7N8G9.1
#=GS A0A5N5HV90_9ROSA/17-114     AC A0A5N5HV90.1
#=GS A0A0D2DYF4_9EURO/17-112     AC A0A0D2DYF4.1
#=GS A0A0B7MX51_9FUNG/41-126     AC A0A0B7MX51.1
#=GS A0A1E3QWM9_9ASCO/229-313    AC A0A1E3QWM9.1
#=GS RLA2_HORSE/17-114           AC Q6X9Z5.1
#=GS A0A1D8PRG5_CANAL/20-107     AC A0A1D8PRG5.1
#=GS A0A0R3TE92_RODNA/231-320    AC A0A0R3TE92.1
#=GS A0A0C3H9C6_9PEZI/229-311    AC A0A0C3H9C6.1
#=GS A8WQU3_CAEBR/17-109         AC A8WQU3.1
#=GS A0A133VEB7_9EURY/16-103     AC A0A133VEB7.1
#=GS H0YDD8_HUMAN/12-91          AC H0YDD8.1
#=GS A0A6P6PPI9_CARAU/17-113     AC A0A6P6PPI9.1
#=GS A0A674P5K7_TAKRU/17-139     AC A0A674P5K7.1
#=GS A0A0L7LYM1_PLAF4/146-228    AC A0A0L7LYM1.1
#=GS A0A4U5R1W5_POPAL/234-320    AC A0A4U5R1W5.1
#=GS A0A2P7YHQ8_9ASCO/17-109     AC A0A2P7YHQ8.1
#=GS A0A182Y7C3_ANOST/780-863    AC A0A182Y7C3.1
#=GS A0A7D5QAR9_9EURY/16-111     AC A0A7D5QAR9.1
#=GS A0A0D1Z610_EXOME/17-113     AC A0A0D1Z610.1
#=GS S7W9Q8_SPRLO/22-102         AC S7W9Q8.1
#=GS A0A0C2FRR9_9BILA/17-71      AC A0A0C2FRR9.1
#=GS B3TLL9_ELAGV/234-320        AC B3TLL9.1
#=GS A0A2J8XK61_PONAB/231-316    AC A0A2J8XK61.1
#=GS F8D7E1_HALXS/16-109         AC F8D7E1.1
#=GS A0A218XIZ0_PUNGR/6-118      AC A0A218XIZ0.1
#=GS L8FUV3_PSED2/229-311        AC L8FUV3.1
#=GS A0A3Q7EQP0_SOLLC/21-62      AC A0A3Q7EQP0.1
#=GS A0A4W6DRL0_LATCA/22-101     AC A0A4W6DRL0.1
#=GS V4TVA5_CITCL/11-95          AC V4TVA5.1
#=GS A0A4U5NL28_POPAL/17-113     AC A0A4U5NL28.1
#=GS A0A444G101_ENSVE/22-111     AC A0A444G101.1
#=GS A0A3M7N9Y2_9EURO/17-114     AC A0A3M7N9Y2.1
#=GS A0A0D3EKJ1_9ORYZ/17-113     AC A0A0D3EKJ1.1
#=GS A0A061G3F9_THECC/21-112     AC A0A061G3F9.1
#=GS A0A2S4W7T9_9BASI/19-106     AC A0A2S4W7T9.1
#=GS C6TGA6_SOYBN/234-318        AC C6TGA6.1
#=GS A0A212CU61_CEREH/21-110     AC A0A212CU61.1
#=GS H0W149_CAVPO/231-317        AC H0W149.2
#=GS A0A4P1QUF7_LUPAN/21-111     AC A0A4P1QUF7.1
#=GS A0A074VXI6_9PEZI/229-319    AC A0A074VXI6.1
#=GS A0A4W6CCT6_LATCA/17-114     AC A0A4W6CCT6.1
#=GS A0A3P6RD10_9BILA/1-56       AC A0A3P6RD10.1
#=GS A0A453SHV6_AEGTS/17-111     AC A0A453SHV6.1
#=GS A0A2P6QAS4_ROSCH/17-112     AC A0A2P6QAS4.1
#=GS V7C7B8_PHAVU/234-319        AC V7C7B8.1
#=GS A0A0U9HJT9_KLENI/234-319    AC A0A0U9HJT9.1
#=GS A0A060W7L0_ONCMY/231-314    AC A0A060W7L0.1
#=GS A0A4W2DYN4_BOBOX/169-255    AC A0A4W2DYN4.1
#=GS H0EQQ0_GLAL7/21-110         AC H0EQQ0.1
#=GS H2LN04_ORYLA/189-286        AC H2LN04.2
#=GS C5FX42_ARTOC/17-111         AC C5FX42.1
#=GS A0A0G4E965_VITBC/231-319    AC A0A0G4E965.1
#=GS A0A391NW65_9EUKA/17-104     AC A0A391NW65.1
#=GS N1NK96_ARADU/21-112         AC N1NK96.1
#=GS A0A2K6DJR9_MACNE/45-102     AC A0A2K6DJR9.1
#=GS A0A1S2XW64_CICAR/21-111     AC A0A1S2XW64.1
#=GS A0A3Q7QHK0_CALUR/23-106     AC A0A3Q7QHK0.1
#=GS A0A498IVI1_MALDO/21-110     AC A0A498IVI1.1
#=GS M2TDW5_COCSN/229-313        AC M2TDW5.1
#=GS I3T2S0_MEDTR/7-118          AC I3T2S0.1
#=GS B8B8R7_ORYSI/17-115         AC B8B8R7.1
#=GS A0A226NQY4_COLVI/243-330    AC A0A226NQY4.1
#=GS A0A316UZ25_9BASI/229-311    AC A0A316UZ25.1
#=GS A0A452E475_CAPHI/22-113     AC A0A452E475.1
#=GS Q6CKV3_KLULA/16-105         AC Q6CKV3.1
#=GS A0A0E0K0L1_ORYPU/17-112     AC A0A0E0K0L1.1
#=GS A0A369JQV2_HYPMA/34-126     AC A0A369JQV2.1
#=GS A0A643CH04_BALPH/17-110     AC A0A643CH04.1
#=GS A0A0D3HHW1_9ORYZ/658-743    AC A0A0D3HHW1.1
#=GS A9TMJ4_PHYPA/39-118         AC A9TMJ4.1
#=GS F7BM66_MACMU/17-114         AC F7BM66.1
#=GS Q6L1X7_PICTO/16-100         AC Q6L1X7.1
#=GS C5DBU5_LACTC/19-105         AC C5DBU5.1
#=GS A0A1B8AC72_FUSPO/228-310    AC A0A1B8AC72.1
#=GS A0A1Y1YKC9_9FUNG/17-107     AC A0A1Y1YKC9.1
#=GS A0A075ANS7_ROZAC/20-102     AC A0A075ANS7.1
#=GS F9WYC2_ZYMTI/17-110         AC F9WYC2.1
#=GS S9WA15_9TRYP/21-107         AC S9WA15.1
#=GS F2SIX0_TRIRC/17-112         AC F2SIX0.1
#=GS A0A0V0SDH7_9BILA/231-319    AC A0A0V0SDH7.1
#=GS A0A218W8L1_PUNGR/17-114     AC A0A218W8L1.1
#=GS A0A4V5ZZ33_POPAL/17-112     AC A0A4V5ZZ33.1
#=GS A0A2I0WUD8_9ASPA/17-114     AC A0A2I0WUD8.1
#=GS A0A137NWZ4_CONC2/228-307    AC A0A137NWZ4.1
#=GS A0A667XPD8_9TELE/17-112     AC A0A667XPD8.1
#=GS S7ZH75_PENO1/229-311        AC S7ZH75.1
#=GS A0A5N6NCL7_9ASTR/37-120     AC A0A5N6NCL7.1
#=GS I7LL69_METBM/16-104         AC I7LL69.1
#=GS A0A6I9XG80_9SAUR/17-112     AC A0A6I9XG80.1
#=GS A0A044ULC7_ONCVO/119-214    AC A0A044ULC7.1
#=GS A0A2I0S445_9PEZI/229-312    AC A0A2I0S445.1
#=GS A0A343TFS9_9EURY/16-110     AC A0A343TFS9.1
#=GS A0A422NZB2_9TRYP/16-77      AC A0A422NZB2.1
#=GS K7F8D5_PELSI/22-111         AC K7F8D5.1
#=GS A0A178Z3H4_9EURO/21-111     AC A0A178Z3H4.1
#=GS A0A445JE34_GLYSO/23-119     AC A0A445JE34.1
#=GS A0A3Q2FYG6_CYPVA/17-113     AC A0A3Q2FYG6.1
#=GS A0A5C3PT50_9APHY/18-81      AC A0A5C3PT50.1
#=GS M7YAR9_TRIUA/21-109         AC M7YAR9.1
#=GS A5DN89_PICGU/20-105         AC A5DN89.1
#=GS A0A0E0I0E0_ORYNI/17-107     AC A0A0E0I0E0.1
#=GS A0A6P8BLS7_MAGGR/21-108     AC A0A6P8BLS7.1
#=GS M5XF09_PRUPE/234-317        AC M5XF09.1
#=GS A0A0H2RJJ8_9AGAM/21-108     AC A0A0H2RJJ8.1
#=GS A0A6J0LJV6_RAPSA/28-118     AC A0A6J0LJV6.1
#=GS A0A2T3BCJ1_AMORE/21-111     AC A0A2T3BCJ1.1
#=GS A0A1L9RP28_ASPWE/21-108     AC A0A1L9RP28.1
#=GS A0A4Q9NMS2_9APHY/21-110     AC A0A4Q9NMS2.1
#=GS A0A392M8U0_9FABA/1-28       AC A0A392M8U0.1
#=GS A0A4U6U8L1_SETVI/17-111     AC A0A4U6U8L1.1
#=GS V4TGU5_CITCL/234-317        AC V4TGU5.1
#=GS A0A6J0RL84_BACDO/7-79       AC A0A6J0RL84.1
#=GS M5C4H8_THACB/229-311        AC M5C4H8.1
#=GS A0A6P4B324_ARADU/217-297    AC A0A6P4B324.1
#=GS A0A0D2IYS6_9EURO/17-112     AC A0A0D2IYS6.1
#=GS A0A6P4JC74_DROKI/22-110     AC A0A6P4JC74.1
#=GS A0A498JHN2_MALDO/234-319    AC A0A498JHN2.1
#=GS A0A0C9ZBQ9_9AGAM/17-112     AC A0A0C9ZBQ9.1
#=GS A0A167XW61_9HYPO/17-111     AC A0A167XW61.1
#=GS K0SM04_THAOC/27-107         AC K0SM04.1
#=GS K2S4D9_MACPH/21-109         AC K2S4D9.1
#=GS A0A061GVP8_THECC/17-111     AC A0A061GVP8.1
#=GS Q38EY6_TRYB2/18-112         AC Q38EY6.1
#=GS A0A6P5RIH1_PRUAV/234-317    AC A0A6P5RIH1.1
#=GS R7T067_DICSQ/21-110         AC R7T067.1
#=GS RLA2_YEAST/16-105           AC P05319.1
#=GS A0A5A7NYK0_STRAF/17-111     AC A0A5A7NYK0.1
#=GS A0A0H2UHJ3_RAT/22-113       AC A0A0H2UHJ3.1
#=GS A0A4S8MG57_DENBC/35-124     AC A0A4S8MG57.1
#=GS G3NIT7_GASAC/22-114         AC G3NIT7.1
#=GS A0A061B6S7_RHOTO/20-107     AC A0A061B6S7.1
#=GS A0A194S8B0_RHOGW/21-108     AC A0A194S8B0.1
#=GS A0A225X224_9STRA/17-105     AC A0A225X224.1
#=GS A0A2K5HHF5_COLAP/8-103      AC A0A2K5HHF5.1
#=GS A0A067T767_GALM3/229-310    AC A0A067T767.1
#=GS A0A7G2CRE5_9TRYP/18-111     AC A0A7G2CRE5.1
#=GS A0A6J1B8J9_9ROSI/234-319    AC A0A6J1B8J9.1
#=GS A0A1C1CZY2_9EURO/17-114     AC A0A1C1CZY2.1
#=GS A0A6J0BYD1_NEOLC/22-111     AC A0A6J0BYD1.1
#=GS A0A3M7LVB5_9PLEO/86-176     AC A0A3M7LVB5.1
#=GS E1F8R2_GIAIA/21-105         AC E1F8R2.1
#=GS M0TF88_MUSAM/24-116         AC M0TF88.1
#=GS A0A165HH78_9BASI/36-127     AC A0A165HH78.1
#=GS A0A319EEM6_9EURO/21-106     AC A0A319EEM6.1
#=GS A0A0W4ZHM2_PNEJ7/235-313    AC A0A0W4ZHM2.1
#=GS F4X3G3_ACREC/231-317        AC F4X3G3.1
#=GS A0A483CVK9_9EURY/16-102     AC A0A483CVK9.1
#=GS A0A1E3NTQ8_9ASCO/19-105     AC A0A1E3NTQ8.1
#=GS A0A5N5KKG8_PANHP/22-112     AC A0A5N5KKG8.1
#=GS V4NHE6_EUTSA/21-79          AC V4NHE6.1
#=GS S9WWH1_9TRYP/238-324        AC S9WWH1.1
#=GS A0A1J4JQL0_9EUKA/21-102     AC A0A1J4JQL0.1
#=GS A0A6P6HET0_PUMCO/22-113     AC A0A6P6HET0.1
#=GS A0A484GGC1_SOUCH/22-113     AC A0A484GGC1.1
#=GS A0A0H1BP61_9EURO/229-311    AC A0A0H1BP61.1
#=GS A0A2K5XXD2_MANLE/18-115     AC A0A2K5XXD2.1
#=GS G0RRC1_HYPJQ/17-108         AC G0RRC1.1
#=GS A0A1S3BFW0_CUCME/17-113     AC A0A1S3BFW0.1
#=GS A0A4Q4YMZ8_9PEZI/17-111     AC A0A4Q4YMZ8.1
#=GS A0A4T0FGZ1_9BASI/229-311    AC A0A4T0FGZ1.1
#=GS F6TTP1_HORSE/231-316        AC F6TTP1.2
#=GS G8YTA6_PICSO/20-106         AC G8YTA6.1
#=GS A0A2I3GRF4_NOMLE/179-258    AC A0A2I3GRF4.1
#=GS G3AEY9_SPAPN/20-106         AC G3AEY9.1
#=GS E9AGM1_LEIIN/18-110         AC E9AGM1.1
#=GS N1QEP8_SPHMS/229-314        AC N1QEP8.1
#=GS A0A4V6E9X5_9EURY/16-111     AC A0A4V6E9X5.1
#=GS A0A6J2WJZ3_CHACN/22-112     AC A0A6J2WJZ3.1
#=GS A0A6J2WJN8_CHACN/22-110     AC A0A6J2WJN8.1
#=GS A0A2K5UGU8_MACFA/17-114     AC A0A2K5UGU8.2
#=GS A0A251TKT2_HELAN/36-119     AC A0A251TKT2.1
#=GS A0A397ZSA1_BRACM/17-96      AC A0A397ZSA1.1
#=GS A0A183KGV5_9TREM/21-113     AC A0A183KGV5.1
#=GS F0ZBJ8_DICPU/20-101         AC F0ZBJ8.1
#=GS A0A6A5FFA0_PERFL/231-313    AC A0A6A5FFA0.1
#=GS A0A4Z1T1Y7_GIAMU/226-306    AC A0A4Z1T1Y7.1
#=GS A0A498KHG6_MALDO/10-87      AC A0A498KHG6.1
#=GS A0A2P4Y7U5_9STRA/27-113     AC A0A2P4Y7U5.1
#=GS A0A0E0QDY5_ORYRU/234-318    AC A0A0E0QDY5.1
#=GS A0A5D6XVR8_9STRA/29-110     AC A0A5D6XVR8.1
#=GS A0A3Q7X399_CICAR/21-93      AC A0A3Q7X399.1
#=GS A0A430QMA9_SCHBO/17-112     AC A0A430QMA9.1
#=GS A0A5C7I1D5_9ROSI/73-161     AC A0A5C7I1D5.1
#=GS A0A401T428_CHIPU/17-108     AC A0A401T428.1
#=GS A0A2K5C8Q7_AOTNA/10-92      AC A0A2K5C8Q7.1
#=GS RLA0_YEAST/229-311          AC P05317.2
#=GS A0A2C6KUF7_9APIC/232-314    AC A0A2C6KUF7.1
#=GS B4JNV5_DROGR/17-113         AC B4JNV5.1
#=GS A0A1X2IE10_9FUNG/177-269    AC A0A1X2IE10.1
#=GS E2AZT8_CAMFO/231-317        AC E2AZT8.1
#=GS K7G2U8_PELSI/231-314        AC K7G2U8.1
#=GS A0A6P5YTS9_DURZI/37-104     AC A0A6P5YTS9.1
#=GS A2YJY3_ORYSI/17-108         AC A2YJY3.1
#=GS A0A1H6IP30_9EURY/16-112     AC A0A1H6IP30.1
#=GS A0A4P6XEN7_9ASCO/229-309    AC A0A4P6XEN7.1
#=GS G3VF68_SARHA/231-316        AC G3VF68.1
#=GS A0A5A9P6L7_9TELE/231-315    AC A0A5A9P6L7.1
#=GS A0A0V1DG80_TRIBR/22-119     AC A0A0V1DG80.1
#=GS A0A314KXG9_NICAT/234-320    AC A0A314KXG9.1
#=GS A0A2R9AIY0_PANPA/171-257    AC A0A2R9AIY0.1
#=GS D7LJ05_ARALL/17-111         AC D7LJ05.1
#=GS A0A5N5X2D9_9EURO/17-108     AC A0A5N5X2D9.1
#=GS A0A0D2J5A2_9EURO/238-322    AC A0A0D2J5A2.1
#=GS A0A0N4UEJ8_DRAME/172-263    AC A0A0N4UEJ8.1
#=GS M1W189_CLAP2/30-122         AC M1W189.1
#=GS A0A287DVN8_HORVV/18-75      AC A0A287DVN8.1
#=GS A0A5D2VCV5_GOSMU/18-111     AC A0A5D2VCV5.1
#=GS A0A067G0Q0_CITSI/234-317    AC A0A067G0Q0.1
#=GS M2UGS4_COCH5/21-110         AC M2UGS4.1
#=GS C4YB78_CLAL4/19-104         AC C4YB78.1
#=GS H6C837_EXODN/229-313        AC H6C837.1
#=GS A0A1U7YND4_NICSY/17-112     AC A0A1U7YND4.1
#=GS A0A0E0F292_9ORYZ/228-313    AC A0A0E0F292.1
#=GS A0A2G5DK51_AQUCA/16-121     AC A0A2G5DK51.1
#=GS A0A1S4EVV2_AEDAE/25-95      AC A0A1S4EVV2.1
#=GS A0A674IL94_TERCA/231-314    AC A0A674IL94.1
#=GS A0A2V1ECK6_9PLEO/21-109     AC A0A2V1ECK6.1
#=GS A0A2T4ANV9_TRIHA/229-312    AC A0A2T4ANV9.1
#=GS A0A3Q0DP49_CARSF/8-91       AC A0A3Q0DP49.1
#=GS A0A369K201_HYPMA/229-309    AC A0A369K201.1
#=GS W4FS31_9STRA/17-106         AC W4FS31.1
#=GS A0A4Y7QB85_9AGAM/17-111     AC A0A4Y7QB85.1
#=GS A0A6P6BWL1_PTEVA/17-113     AC A0A6P6BWL1.1
#=GS A0A6I9TW57_SESIN/17-114     AC A0A6I9TW57.1
#=GS A0A6J2LU65_9CHIR/17-113     AC A0A6J2LU65.1
#=GS A0A061J7F0_TRYRA/238-326    AC A0A061J7F0.1
#=GS A0A2C5ZI94_9HYPO/229-312    AC A0A2C5ZI94.1
#=GS A0A2B7ZUN6_9EURO/17-110     AC A0A2B7ZUN6.1
#=GS A0A540L1G5_MALBA/22-107     AC A0A540L1G5.1
#=GS B4KV97_DROMO/231-316        AC B4KV97.1
#=GS A0A1E4TXH0_PACTA/229-312    AC A0A1E4TXH0.1
#=GS A0A1Y2AJT3_9FUNG/228-310    AC A0A1Y2AJT3.1
#=GS A0A1G4IUU4_9SACH/229-311    AC A0A1G4IUU4.1
#=GS K0TFL1_THAOC/49-138         AC K0TFL1.1
#=GS A0A1U8KKI1_GOSHI/22-113     AC A0A1U8KKI1.1
#=GS A0A1S3X6F5_TOBAC/21-111     AC A0A1S3X6F5.1
#=GS A0A2G5EI40_AQUCA/35-117     AC A0A2G5EI40.1
#=GS A0A5N5D9H9_9PEZI/229-313    AC A0A5N5D9H9.1
#=GS A0A2K5NWR8_CERAT/17-109     AC A0A2K5NWR8.1
#=GS W5MLY8_LEPOC/22-93          AC W5MLY8.1
#=GS A0A1X2GMU6_9FUNG/17-107     AC A0A1X2GMU6.1
#=GS A0A199VEM0_ANACO/17-115     AC A0A199VEM0.1
#=GS A0A5D3AKY5_GOSMU/17-113     AC A0A5D3AKY5.1
#=GS A0A2Y9G9J7_NEOSC/20-81      AC A0A2Y9G9J7.1
#=GS M4EUY7_BRARP/22-112         AC M4EUY7.1
#=GS A0A0D3HHV8_9ORYZ/624-709    AC A0A0D3HHV8.1
#=GS A0A158PSF6_BRUPA/286-370    AC A0A158PSF6.1
#=GS A0A6I9JBX0_CHRAS/15-81      AC A0A6I9JBX0.1
#=GS A0A2P6Q2K5_ROSCH/17-110     AC A0A2P6Q2K5.1
#=GS A0A5D2WV48_GOSMU/23-103     AC A0A5D2WV48.1
#=GS A0A4R8RAT2_COLTR/17-110     AC A0A4R8RAT2.1
#=GS A0A5N5I7F8_9ROSA/21-110     AC A0A5N5I7F8.1
#=GS A0A1E3QDP6_LIPST/229-313    AC A0A1E3QDP6.1
#=GS A0A1L9R8B4_ASPWE/17-108     AC A0A1L9R8B4.1
#=GS A0A2K6SDI2_SAIBB/22-113     AC A0A2K6SDI2.1
#=GS A0A2K3NWH1_TRIPR/17-112     AC A0A2K3NWH1.1
#=GS A0A6P8VW81_GYMAC/192-275    AC A0A6P8VW81.1
#=GS A8R3I0_BABBI/231-312        AC A8R3I0.1
#=GS A0A1E3P2T7_WICAA/19-105     AC A0A1E3P2T7.1
#=GS A0A6J8B9C4_MYTCO/231-316    AC A0A6J8B9C4.1
#=GS J5PMA5_SACK1/20-105         AC J5PMA5.1
#=GS A0A0D3ELE4_9ORYZ/7-115      AC A0A0D3ELE4.1
#=GS A0A6J2XA94_SITOR/22-111     AC A0A6J2XA94.1
#=GS L9ZQ33_9EURY/16-114         AC L9ZQ33.1
#=GS A0A452RK51_URSAM/19-105     AC A0A452RK51.1
#=GS A0A2P5XW39_GOSBA/12-73      AC A0A2P5XW39.1
#=GS A0A397XNM3_BRACM/22-112     AC A0A397XNM3.1
#=GS M0M5T9_9EURY/16-112         AC M0M5T9.1
#=GS A0A4X2LZ21_VOMUR/21-112     AC A0A4X2LZ21.1
#=GS A0A094H0I7_9PEZI/17-109     AC A0A094H0I7.1
#=GS B0WU22_CULQU/23-112         AC B0WU22.1
#=GS A0A0S6XAD9_9FUNG/229-313    AC A0A0S6XAD9.1
#=GS A0A1E7FR21_9STRA/27-111     AC A0A1E7FR21.1
#=GS F6VQ14_HORSE/22-113         AC F6VQ14.2
#=GS A0A383Z737_BALAS/231-317    AC A0A383Z737.1
#=GS A0A4W5NZ14_9TELE/231-314    AC A0A4W5NZ14.1
#=GS R0GFX7_9BRAS/35-120         AC R0GFX7.1
#=GS I1LMP8_SOYBN/234-319        AC I1LMP8.1
#=GS A0A2T4A435_TRIHA/17-109     AC A0A2T4A435.1
#=GS A0A507BAV2_9PEZI/229-313    AC A0A507BAV2.1
#=GS A0A0R0LXA0_9MICR/16-104     AC A0A0R0LXA0.1
#=GS A0A094CIJ4_9PEZI/77-164     AC A0A094CIJ4.1
#=GS B6Q832_TALMQ/21-109         AC B6Q832.1
#=GS M0DJK2_9EURY/16-112         AC M0DJK2.1
#=GS A0A1R1PUK3_ZANCU/21-106     AC A0A1R1PUK3.1
#=GS A0A498G811_9EURY/16-111     AC A0A498G811.1
#=GS A0A058ZYT0_EUCGR/21-109     AC A0A058ZYT0.1
#=GS K4G4R8_CALMI/231-312        AC K4G4R8.1
#=GS A0A1S3CIR4_CUCME/234-319    AC A0A1S3CIR4.1
#=GS A0A4Y8CXQ6_9HELO/229-311    AC A0A4Y8CXQ6.1
#=GS A0DVJ7_PARTE/17-108         AC A0DVJ7.1
#=GS A0A2J6K6Y0_LACSA/47-137     AC A0A2J6K6Y0.1
#=GS C5GER0_AJEDR/21-109         AC C5GER0.1
#=GS A0A1X7R336_9SACH/17-109     AC A0A1X7R336.1
#=GS A0A656YZP0_9EURY/16-106     AC A0A656YZP0.1
#=GS A0A672PCC7_SINGR/17-113     AC A0A672PCC7.1
#=GS A0A2K6JMB6_RHIBE/162-248    AC A0A2K6JMB6.1
#=GS A0A287B1B8_PIG/18-88        AC A0A287B1B8.2
#=GS Q2NEW3_METST/16-100         AC Q2NEW3.1
#=GS A0A2Y9LAJ6_DELLE/231-317    AC A0A2Y9LAJ6.1
#=GS A0A1X2GNF8_9FUNG/17-107     AC A0A1X2GNF8.1
#=GS A0A0C2M0P3_THEKT/17-108     AC A0A0C2M0P3.1
#=GS A0A3M6VKW9_9STRA/231-312    AC A0A3M6VKW9.1
#=GS A0A1S4AKW7_TOBAC/17-110     AC A0A1S4AKW7.1
#=GS A0A674K882_TERCA/18-86      AC A0A674K882.1
#=GS A0A202DFA6_9ARCH/228-334    AC A0A202DFA6.1
#=GS A0A3M7QFN9_BRAPC/17-110     AC A0A3M7QFN9.1
#=GS A0A0L7KVA4_9NEOP/22-109     AC A0A0L7KVA4.1
#=GS A0A439DG65_9PEZI/17-110     AC A0A439DG65.1
#=GS A0A316VBM6_9BASI/17-111     AC A0A316VBM6.1
#=GS Q2PES6_TRIPR/234-319        AC Q2PES6.1
#=GS A0A078F3D4_BRANA/233-320    AC A0A078F3D4.1
#=GS A0A1E4T3B0_9ASCO/17-106     AC A0A1E4T3B0.1
#=GS A0A5N6P3I3_9ASTR/201-283    AC A0A5N6P3I3.1
#=GS D5GNA1_TUBMM/45-128         AC D5GNA1.1
#=GS A0A557ST87_9ARCH/41-126     AC A0A557ST87.1
#=GS A0A1R2BHC1_9CILI/32-116     AC A0A1R2BHC1.1
#=GS B7FMX7_MEDTR/17-112         AC B7FMX7.1
#=GS A0A6F9CQP2_9TELE/22-67      AC A0A6F9CQP2.1
#=GS A0A6P5XS39_DURZI/234-319    AC A0A6P5XS39.1
#=GS A0A1X7VE32_AMPQE/192-281    AC A0A1X7VE32.1
#=GS A0A4E0R4T1_FASHE/231-319    AC A0A4E0R4T1.1
#=GS M1VWC1_CLAP2/229-312        AC M1VWC1.1
#=GS A0A4Y9XVW1_9APHY/17-110     AC A0A4Y9XVW1.1
#=GS A0A3P6T9M2_ONCOC/1-45       AC A0A3P6T9M2.1
#=GS A0A0K6GHH3_9AGAM/17-111     AC A0A0K6GHH3.1
#=GS A0A0F7VC17_TOXGV/232-313    AC A0A0F7VC17.1
#=GS A0A498IJY2_MALDO/17-114     AC A0A498IJY2.1
#=GS A0A4W3ISS0_CALMI/169-250    AC A0A4W3ISS0.1
#=GS A0A1Y1Z7A6_9FUNG/17-105     AC A0A1Y1Z7A6.1
#=GS G3HAW3_CRIGR/139-219        AC G3HAW3.1
#=GS L7JTI6_TRAHO/16-100         AC L7JTI6.1
#=GS S3BVM3_OPHP1/17-109         AC S3BVM3.1
#=GS A0A5B0RVI0_PUCGR/17-113     AC A0A5B0RVI0.1
#=GS F9FSZ0_FUSOF/21-108         AC F9FSZ0.1
#=GS E1EWH0_GIAIA/17-108         AC E1EWH0.1
#=GS A0A2U9R522_PICKU/229-309    AC A0A2U9R522.1
#=GS L9JGU4_TUPCH/19-108         AC L9JGU4.1
#=GS D7UBY3_VITVI/17-114         AC D7UBY3.1
#=GS A0A066XTU9_COLSU/229-312    AC A0A066XTU9.1
#=GS A0A178EIN5_9PLEO/229-314    AC A0A178EIN5.1
#=GS E4WRU1_OIKDI/20-106         AC E4WRU1.1
#=GS A0A485NNJ1_LYNPA/231-316    AC A0A485NNJ1.1
#=GS A0A6A4QT24_LUPAL/57-154     AC A0A6A4QT24.1
#=GS A0A445LU40_GLYSO/234-319    AC A0A445LU40.1
#=GS A0A384DFW6_URSMA/231-316    AC A0A384DFW6.1
#=GS V5F309_KALBG/21-109         AC V5F309.1
#=GS A5K457_PLAVS/32-118         AC A5K457.1
#=GS A0A0E0FHF9_ORYNI/17-113     AC A0A0E0FHF9.1
#=GS A0A2I2YLT3_GORGO/20-96      AC A0A2I2YLT3.1
#=GS A0A6P6MS58_CARAU/231-315    AC A0A6P6MS58.1
#=GS A0A369GIQ8_9HYPO/22-110     AC A0A369GIQ8.1
#=GS A0A2K6ANB0_MACNE/18-88      AC A0A2K6ANB0.1
#=GS A0A0V0VGV8_9BILA/22-119     AC A0A0V0VGV8.1
#=GS A0A1Y2GWT0_9FUNG/228-307    AC A0A1Y2GWT0.1
#=GS R4G8I3_RHOPR/21-115         AC R4G8I3.1
#=GS N6WM01_9ARCH/16-103         AC N6WM01.1
#=GS A0A3P9B2P0_9CICH/17-113     AC A0A3P9B2P0.1
#=GS A0A072UZJ1_MEDTR/14-124     AC A0A072UZJ1.1
#=GS A0A6I9VTP9_BACDO/2-57       AC A0A6I9VTP9.1
#=GS A0A135V5K2_9PEZI/17-110     AC A0A135V5K2.1
#=GS A0A177TNM8_9BASI/229-313    AC A0A177TNM8.1
#=GS A0A671KK31_9TELE/28-124     AC A0A671KK31.1
#=GS A0A218Z2G1_9HELO/17-111     AC A0A218Z2G1.1
#=GS A0A4W2D3R2_BOBOX/18-88      AC A0A4W2D3R2.1
#=GS A0A059ABQ2_EUCGR/17-112     AC A0A059ABQ2.1
#=GS A0A2J6SLT8_9HELO/230-314    AC A0A2J6SLT8.1
#=GS J0WYZ6_AURST/706-795        AC J0WYZ6.1
#=GS S2J0M7_MUCC1/20-104         AC S2J0M7.1
#=GS A0A0B7N6X9_9FUNG/158-216    AC A0A0B7N6X9.1
#=GS V3ZK14_LOTGI/17-109         AC V3ZK14.1
#=GS W9W2E2_9EURO/21-113         AC W9W2E2.1
#=GS A0A1L0BAW8_9ASCO/17-108     AC A0A1L0BAW8.1
#=GS A0A0K0JQB1_BRUMA/17-117     AC A0A0K0JQB1.1
#=GS A0A0W1R5P7_9EURY/16-109     AC A0A0W1R5P7.1
#=GS A0A6A4J517_APOLU/21-113     AC A0A6A4J517.1
#=GS A0A6P5ZSE0_DURZI/29-121     AC A0A6P5ZSE0.1
#=GS A0A3Q1GGV1_9TELE/17-114     AC A0A3Q1GGV1.1
#=GS A0A6D2IPD7_9BRAS/234-316    AC A0A6D2IPD7.1
#=GS A0A2I2G230_9EURO/21-106     AC A0A2I2G230.1
#=GS A0A179F7U8_METCM/21-108     AC A0A179F7U8.1
#=GS A0A1Y1XXR8_9FUNG/17-108     AC A0A1Y1XXR8.1
#=GS A0A1A5ZUZ3_9TREE/17-111     AC A0A1A5ZUZ3.1
#=GS A0A443SE21_9ACAR/17-115     AC A0A443SE21.1
#=GS A0A6I9JSG7_CHRAS/231-316    AC A0A6I9JSG7.1
#=GS A0A1U7TF63_CARSF/18-88      AC A0A1U7TF63.1
#=GS A0A0L1I3Y4_PLAFA/19-99      AC A0A0L1I3Y4.1
#=GS A0A5C3N5Y1_9AGAM/42-130     AC A0A5C3N5Y1.1
#=GS S9X613_SCHCR/21-107         AC S9X613.1
#=GS A0A6P6UWL9_COFAR/40-123     AC A0A6P6UWL9.1
#=GS A0A0E0F295_9ORYZ/228-313    AC A0A0E0F295.1
#=GS W9XMM7_9EURO/21-112         AC W9XMM7.1
#=GS A0A383ZIT7_BALAS/18-88      AC A0A383ZIT7.1
#=GS Q6P8D0_XENTR/231-313        AC Q6P8D0.1
#=GS A0A2Z7CJF3_9LAMI/234-320    AC A0A2Z7CJF3.1
#=GS W6PV96_PENRF/17-108         AC W6PV96.1
#=GS A0A6J0ZYB4_9ROSI/234-320    AC A0A6J0ZYB4.1
#=GS A0A6J2N1V6_9CHIR/231-317    AC A0A6J2N1V6.1
#=GS A0A168L2K5_CORDF/229-311    AC A0A168L2K5.1
#=GS C1H261_PARBA/17-112         AC C1H261.1
#=GS B4Q638_DROSI/22-111         AC B4Q638.1
#=GS A0A2A9MM56_9APIC/232-313    AC A0A2A9MM56.1
#=GS A0A545WCD9_9HYPO/17-110     AC A0A545WCD9.1
#=GS A0A5A7QDU0_STRAF/17-111     AC A0A5A7QDU0.1
#=GS A0A6A1QAQ5_BALPH/22-107     AC A0A6A1QAQ5.1
#=GS C5GCV5_AJEDR/229-311        AC C5GCV5.1
#=GS A0A395J3T8_9HELO/192-250    AC A0A395J3T8.1
#=GS A0A1G4JIL8_9SACH/20-106     AC A0A1G4JIL8.1
#=GS A0A1A6HPZ3_NEOLE/55-127     AC A0A1A6HPZ3.1
#=GS E1QQ70_VULDI/16-112         AC E1QQ70.1
#=GS A0A0D9NRF7_METAN/21-108     AC A0A0D9NRF7.1
#=GS G3UM10_LOXAF/1-90           AC G3UM10.1
#=GS L9W1T8_9EURY/16-111         AC L9W1T8.1
#=GS A0A163JE40_ABSGL/17-108     AC A0A163JE40.1
#=GS A0A1B9GCS6_9TREE/17-112     AC A0A1B9GCS6.1
#=GS A0A4E0QQ13_9EURY/16-102     AC A0A4E0QQ13.1
#=GS A0A250X6Z6_9CHLO/17-107     AC A0A250X6Z6.1
#=GS A0A195F9X6_9HYME/17-113     AC A0A195F9X6.1
#=GS A0A1Y3NCR8_PIRSE/21-105     AC A0A1Y3NCR8.1
#=GS Q2UN68_ASPOR/21-108         AC Q2UN68.1
#=GS C4M661_ENTHI/25-111         AC C4M661.1
#=GS A0A2G2XN91_CAPBA/21-112     AC A0A2G2XN91.1
#=GS A0A4Q4UU38_9PEZI/229-312    AC A0A4Q4UU38.1
#=GS A0A5N3UW50_MUNRE/15-90      AC A0A5N3UW50.1
#=GS A0A0M3K9J4_ANISI/17-115     AC A0A0M3K9J4.1
#=GS W9I222_FUSOX/17-109         AC W9I222.1
#=GS A0A226ENU3_FOLCA/22-112     AC A0A226ENU3.1
#=GS H2NWC9_PONAB/207-286        AC H2NWC9.1
#=GS A0A2K6GEI6_PROCO/22-105     AC A0A2K6GEI6.1
#=GS A0A445C5M8_ARAHY/234-321    AC A0A445C5M8.1
#=GS A0A6A1QBH8_BALPH/2-80       AC A0A6A1QBH8.1
#=GS Q74MP7_NANEQ/16-100         AC Q74MP7.1
#=GS A0A5B7DNC5_PORTR/329-386    AC A0A5B7DNC5.1
#=GS K8Z4E8_NANGC/17-111         AC K8Z4E8.1
#=GS A0A1U7UFL5_CARSF/231-316    AC A0A1U7UFL5.1
#=GS A0A1G4MEP8_LACFM/17-109     AC A0A1G4MEP8.1
#=GS M3XVC4_MUSPF/231-316        AC M3XVC4.1
#=GS A0A1Y1IF90_KLENI/17-114     AC A0A1Y1IF90.1
#=GS A8BCP0_GIAIC/17-108         AC A8BCP0.1
#=GS A0A6A3BFK6_HIBSY/54-117     AC A0A6A3BFK6.1
#=GS A0A6P3INX1_BISBI/17-114     AC A0A6P3INX1.1
#=GS A7RLY2_NEMVE/17-112         AC A7RLY2.1
#=GS A0A446XIK8_TRITD/201-285    AC A0A446XIK8.1
#=GS A0A6J1U109_9SAUR/17-112     AC A0A6J1U109.1
#=GS A0A1B9GGC3_9TREE/20-108     AC A0A1B9GGC3.1
#=GS A0A0K9Q2S3_ZOSMR/21-106     AC A0A0K9Q2S3.1
#=GS A0A1S2XD74_CICAR/17-112     AC A0A1S2XD74.1
#=GS A0A5N7AAS7_9EURO/21-107     AC A0A5N7AAS7.1
#=GS A0A1V9YWD7_9STRA/17-107     AC A0A1V9YWD7.1
#=GS A0A6P9ED33_JUGRE/17-113     AC A0A6P9ED33.1
#=GS Q8AVI3_XENLA/231-314        AC Q8AVI3.1
#=GS A0A0E0BEZ8_9ORYZ/234-319    AC A0A0E0BEZ8.1
#=GS A0A1S4CMP3_TOBAC/17-111     AC A0A1S4CMP3.1
#=GS L8FTW4_PSED2/75-162         AC L8FTW4.1
#=GS G7E9A5_MIXOS/229-311        AC G7E9A5.1
#=GS R7QCC6_CHOCR/57-141         AC R7QCC6.1
#=GS A0A0C7N0K4_9SACH/229-310    AC A0A0C7N0K4.1
#=GS A0A0M3QTA0_DROBS/22-111     AC A0A0M3QTA0.1
#=GS A0A2J6QLL6_9HELO/21-108     AC A0A2J6QLL6.1
#=GS A0A0D3G894_9ORYZ/17-112     AC A0A0D3G894.1
#=GS A0A2T9XXE7_9FUNG/17-67      AC A0A2T9XXE7.1
#=GS A0A177VN65_9BASI/17-111     AC A0A177VN65.1
#=GS D8SKL7_SELML/234-321        AC D8SKL7.1
#=GS A0A2T7EL94_9POAL/17-111     AC A0A2T7EL94.1
#=GS A0A0C3C085_PILCF/17-111     AC A0A0C3C085.1
#=GS A0A5C6NI61_9TELE/22-111     AC A0A5C6NI61.1
#=GS A0A6S7L8U1_LACSI/51-146     AC A0A6S7L8U1.1
#=GS A0A139HAW0_9PEZI/229-314    AC A0A139HAW0.1
#=GS RLA1_DROME/22-111           AC P08570.2
#=GS A0A2I0MI96_COLLI/48-145     AC A0A2I0MI96.1
#=GS I2GW86_TETBL/19-104         AC I2GW86.1
#=GS A0A3P6VBF2_ONCOC/1-84       AC A0A3P6VBF2.1
#=GS A0A2T7PG58_POMCA/22-117     AC A0A2T7PG58.1
#=GS W9Y5G9_9EURO/21-111         AC W9Y5G9.1
#=GS M3WIQ1_FELCA/231-316        AC M3WIQ1.1
#=GS A0A177CXC3_9PLEO/33-122     AC A0A177CXC3.1
#=GS A0A168NKM2_ABSGL/20-104     AC A0A168NKM2.1
#=GS A0A445LE83_GLYSO/17-112     AC A0A445LE83.1
#=GS A0A6I9VMQ7_9HYME/231-316    AC A0A6I9VMQ7.1
#=GS A0A2G5B6X2_COERN/18-107     AC A0A2G5B6X2.1
#=GS I2G477_USTH4/21-109         AC I2G477.1
#=GS A0A662YBP6_9STRA/45-135     AC A0A662YBP6.1
#=GS A0A1L9SL36_9EURO/229-311    AC A0A1L9SL36.1
#=GS A0A0P1A9A3_PLAHL/9-81       AC A0A0P1A9A3.1
#=GS A0A059DFA0_EUCGR/8-119      AC A0A059DFA0.1
#=GS A0A182EPR6_ONCOC/21-115     AC A0A182EPR6.1
#=GS A0A420I9U6_9PEZI/21-108     AC A0A420I9U6.1
#=GS A0A4Q4ZY64_9PEZI/21-110     AC A0A4Q4ZY64.1
#=GS V4LTA0_EUTSA/17-112         AC V4LTA0.1
#=GS A0A2V5IQ68_ASPV1/17-108     AC A0A2V5IQ68.1
#=GS A0A060W9L3_ONCMY/21-100     AC A0A060W9L3.1
#=GS M2XBC1_GALSU/24-117         AC M2XBC1.1
#=GS A0A3Q7N140_CALUR/23-85      AC A0A3Q7N140.1
#=GS D5GI14_TUBMM/21-110         AC D5GI14.1
#=GS A0A4P9ZRS8_9FUNG/228-309    AC A0A4P9ZRS8.1
#=GS A0A397Z6Y5_BRACM/17-112     AC A0A397Z6Y5.1
#=GS A0A1E4U2D2_PACTA/22-109     AC A0A1E4U2D2.1
#=GS A0A1Y2XB10_9PEZI/229-312    AC A0A1Y2XB10.1
#=GS A0A5B6W1V7_9ROSI/22-113     AC A0A5B6W1V7.1
#=GS A0A6P5C517_BOSIN/32-129     AC A0A6P5C517.1
#=GS A0A2L2T8T5_9HYPO/21-108     AC A0A2L2T8T5.1
#=GS A0A0N4X6I9_HAEPC/20-80      AC A0A0N4X6I9.1
#=GS D3AX76_POLPP/227-306        AC D3AX76.1
#=GS A0A5B1QHF1_9AGAM/17-109     AC A0A5B1QHF1.1
#=GS A0A397G7H1_9GLOM/22-113     AC A0A397G7H1.1
#=GS A0A0K9PW46_ZOSMR/234-317    AC A0A0K9PW46.1
#=GS RLA0_MOUSE/231-316          AC P14869.3
#=GS A0A2K5D7C9_AOTNA/18-88      AC A0A2K5D7C9.1
#=GS A0A6H5L1M1_9PHAE/27-88      AC A0A6H5L1M1.1
#=GS A0A2H5PBA2_CITUN/31-115     AC A0A2H5PBA2.1
#=GS A0A5C3EKL5_9BASI/17-110     AC A0A5C3EKL5.1
#=GS A0A2K6MFU4_RHIBE/169-255    AC A0A2K6MFU4.1
#=GS L1JF24_GUITC/17-115         AC L1JF24.1
#=GS A0A670KGE2_PODMU/231-314    AC A0A670KGE2.1
#=GS A0A1E5VEP5_9POAL/60-119     AC A0A1E5VEP5.1
#=GS A0A1S7HB89_9SACH/19-105     AC A0A1S7HB89.1
#=GS A0A398A434_BRACM/17-113     AC A0A398A434.1
#=GS A0A4P9XY41_9FUNG/228-307    AC A0A4P9XY41.1
#=GS A0A1S3TPG3_VIGRR/234-318    AC A0A1S3TPG3.1
#=GS A0A4X2KIT3_VOMUR/21-109     AC A0A4X2KIT3.1
#=GS A0A3M6VMM3_9STRA/29-111     AC A0A3M6VMM3.1
#=GS A0A2K6GNX3_PROCO/22-112     AC A0A2K6GNX3.1
#=GS A0A6P7SRH1_OCTVU/22-114     AC A0A6P7SRH1.1
#=GS A0A6P8YF15_THRPL/22-112     AC A0A6P8YF15.1
#=GS A0A2K5Y6F2_MANLE/182-265    AC A0A2K5Y6F2.1
#=GS A0A177CK25_9PLEO/21-109     AC A0A177CK25.1
#=GS A0A0E9NCI1_SAICN/17-85      AC A0A0E9NCI1.1
#=GS A0A0J0XUV6_9TREE/35-121     AC A0A0J0XUV6.1
#=GS M4B8F7_HYAAE/28-116         AC M4B8F7.1
#=GS A0A1E7FVD7_9STRA/17-105     AC A0A1E7FVD7.1
#=GS F0UHQ1_AJEC8/229-310        AC F0UHQ1.1
#=GS A0A2K3QJ24_9HYPO/21-108     AC A0A2K3QJ24.1
#=GS A0A0C7MVK1_9SACH/17-107     AC A0A0C7MVK1.1
#=GS A0A2T2ND35_CORCC/229-313    AC A0A2T2ND35.1
#=GS A0A017SGB0_9EURO/17-103     AC A0A017SGB0.1
#=GS Q4U8Y0_THEAN/32-115         AC Q4U8Y0.1
#=GS A9S0Q1_PHYPA/234-317        AC A9S0Q1.1
#=GS A0A0D1Y8T5_9EURO/21-113     AC A0A0D1Y8T5.1
#=GS A0A1U7X7K6_NICSY/135-212    AC A0A1U7X7K6.1
#=GS A0A6A5LJR9_LUPAL/17-114     AC A0A6A5LJR9.1
#=GS A0A1S9DDW1_ASPOZ/17-108     AC A0A1S9DDW1.1
#=GS A0A1Y2IPS3_PYCCO/17-111     AC A0A1Y2IPS3.1
#=GS A0A4Q7K6F3_METCM/229-312    AC A0A4Q7K6F3.1
#=GS A0A061EH68_THECC/54-138     AC A0A061EH68.1
#=GS K3WAY4_GLOUD/231-313        AC K3WAY4.1
#=GS A0A4D9A4X5_SALSN/234-321    AC A0A4D9A4X5.1
#=GS A0A445K986_GLYSO/21-109     AC A0A445K986.1
#=GS J7RX09_KAZNA/17-109         AC J7RX09.1
#=GS A0A6J0L754_RAPSA/22-110     AC A0A6J0L754.1
#=GS A0A409YU39_9AGAR/29-118     AC A0A409YU39.1
#=GS A0A3N0YF75_ANAGA/24-123     AC A0A3N0YF75.1
#=GS A0A0K9PQU4_ZOSMR/18-118     AC A0A0K9PQU4.1
#=GS A0A0E0I9A7_ORYNI/81-178     AC A0A0E0I9A7.1
#=GS A0A087XNW5_POEFO/231-313    AC A0A087XNW5.1
#=GS A0A067D2A1_SAPPC/26-111     AC A0A067D2A1.1
#=GS A0A0D2P7A3_GOSRA/22-113     AC A0A0D2P7A3.1
#=GS A0A1J1H567_PLARL/19-111     AC A0A1J1H567.1
#=GS A0A669E7K5_ORENI/17-113     AC A0A669E7K5.1
#=GS A0A4D9E1N9_9SAUR/231-314    AC A0A4D9E1N9.1
#=GS A0A2G2WB13_CAPBA/17-113     AC A0A2G2WB13.1
#=GS A0A397YKV0_BRACM/22-114     AC A0A397YKV0.1
#=GS J3NN59_GAET3/21-108         AC J3NN59.1
#=GS A0A6A2YT00_HIBSY/17-113     AC A0A6A2YT00.1
#=GS A0A2K5TXZ9_MACFA/171-258    AC A0A2K5TXZ9.2
#=GS A0A1B7TDG3_9ASCO/20-105     AC A0A1B7TDG3.1
#=GS A0A2I3RVV0_PANTR/20-101     AC A0A2I3RVV0.1
#=GS A4I600_LEIIN/16-104         AC A4I600.1
#=GS A0A0E0IXV7_ORYNI/327-412    AC A0A0E0IXV7.1
#=GS A0A0G4LSW0_9PEZI/21-108     AC A0A0G4LSW0.1
#=GS G4UBW2_NEUT9/229-312        AC G4UBW2.1
#=GS A0A1L9NCS2_ASPTC/229-311    AC A0A1L9NCS2.1
#=GS A0A1L9TIX9_9EURO/21-108     AC A0A1L9TIX9.1
#=GS A0A2P6Q2I5_ROSCH/17-113     AC A0A2P6Q2I5.1
#=GS A0A0L0CK74_LUCCU/231-314    AC A0A0L0CK74.1
#=GS A0A0D3ALH8_BRAOL/34-119     AC A0A0D3ALH8.1
#=GS G1XQL0_ARTOA/229-311        AC G1XQL0.1
#=GS RLA3_ORYSJ/57-118           AC P56724.3
#=GS A0A1V6Q418_9EURO/21-106     AC A0A1V6Q418.1
#=GS C5MFP2_CANTT/229-312        AC C5MFP2.1
#=GS A0A5N3X4Z4_MUNRE/198-265    AC A0A5N3X4Z4.1
#=GS A0A6A3U9U9_9STRA/59-147     AC A0A6A3U9U9.1
#=GS A0A4Y7STR6_9AGAR/229-310    AC A0A4Y7STR6.1
#=GS A0A2C6A8K6_9HYPO/21-108     AC A0A2C6A8K6.1
#=GS A0A1X6PIJ4_PORUM/21-105     AC A0A1X6PIJ4.1
#=GS R0GMM5_9BRAS/22-112         AC R0GMM5.1
#=GS A0A0K6GBI9_9AGAM/229-310    AC A0A0K6GBI9.1
#=GS A0A0P7TND6_SCLFO/17-114     AC A0A0P7TND6.1
#=GS A0A6P6F2K0_OCTDE/17-114     AC A0A6P6F2K0.1
#=GS A0A0H5C780_CYBJN/21-106     AC A0A0H5C780.1
#=GS Q6BTV6_DEBHA/17-105         AC Q6BTV6.1
#=GS A0A0D9S4H7_CHLSB/192-278    AC A0A0D9S4H7.1
#=GS A0A6P3Z977_ZIZJJ/224-309    AC A0A6P3Z977.1
#=GS A0A5N5L8D2_9ROSI/17-104     AC A0A5N5L8D2.1
#=GS A0A485KP81_9STRA/17-108     AC A0A485KP81.1
#=GS A0A067R8K2_ZOONE/231-315    AC A0A067R8K2.1
#=GS A0A422NR90_TRYRA/18-110     AC A0A422NR90.1
#=GS A0A2T9ZEQ3_9FUNG/17-63      AC A0A2T9ZEQ3.1
#=GS A0A093ZJN5_9PEZI/44-121     AC A0A093ZJN5.1
#=GS A0A2I0ULC7_LIMLA/56-149     AC A0A2I0ULC7.1
#=GS A0A5N6M3A4_9ASTR/234-318    AC A0A5N6M3A4.1
#=GS W9XZP7_9EURO/224-308        AC W9XZP7.1
#=GS A0A2H3GYS0_FUSOX/17-80      AC A0A2H3GYS0.1
#=GS U3JJL0_FICAL/22-114         AC U3JJL0.1
#=GS A0A3L6QS93_PANMI/27-117     AC A0A3L6QS93.1
#=GS A0A4U1FK31_MONMO/22-99      AC A0A4U1FK31.1
#=GS A0A0P9AUI5_9ARCH/16-101     AC A0A0P9AUI5.1
#=GS A0A3Q7SAI2_VULVU/17-114     AC A0A3Q7SAI2.1
#=GS A0A5D2ZLP1_GOSMU/25-108     AC A0A5D2ZLP1.1
#=GS A0A0E0LFA5_ORYPU/59-118     AC A0A0E0LFA5.1
#=GS W2Q1X9_PHYPN/17-105         AC W2Q1X9.1
#=GS A0A5Q4C7X6_9PEZI/229-312    AC A0A5Q4C7X6.1
#=GS A0A6A5C029_NAEFO/250-330    AC A0A6A5C029.1
#=GS A0A2K5UDU7_MACFA/17-114     AC A0A2K5UDU7.2
#=GS A0A2K1ITT4_PHYPA/98-184     AC A0A2K1ITT4.1
#=GS G1NWS2_MYOLU/231-316        AC G1NWS2.1
#=GS A0A022RU39_ERYGU/233-320    AC A0A022RU39.1
#=GS A0A2Y9EVQ6_PHYMC/16-88      AC A0A2Y9EVQ6.1
#=GS H2KQZ8_CLOSI/21-112         AC H2KQZ8.1
#=GS A0A2J6KW92_LACSA/21-110     AC A0A2J6KW92.1
#=GS A0A427Y9H6_9TREE/20-107     AC A0A427Y9H6.1
#=GS A0A4T0WCT3_9PEZI/229-312    AC A0A4T0WCT3.1
#=GS A0A2G8RTY4_9APHY/17-110     AC A0A2G8RTY4.1
#=GS A0A1S7HJ50_9SACH/229-311    AC A0A1S7HJ50.1
#=GS A0A671QQ58_9TELE/17-115     AC A0A671QQ58.1
#=GS A0A067F116_CITSI/17-112     AC A0A067F116.1
#=GS A0A2Y9FDN6_PHYMC/22-113     AC A0A2Y9FDN6.1
#=GS A0A3Q0DYD9_CARSF/52-147     AC A0A3Q0DYD9.1
#=GS A0A0L0BXI3_LUCCU/5-60       AC A0A0L0BXI3.1
#=GS A0A3R7MAI9_TRYRA/16-107     AC A0A3R7MAI9.1
#=GS A0A063BWC6_USTVR/229-315    AC A0A063BWC6.1
#=GS A0A1X6NBE7_9APHY/21-109     AC A0A1X6NBE7.1
#=GS A0A1V6UUG5_9EURO/17-108     AC A0A1V6UUG5.1
#=GS A0A1L9VCL0_ASPGL/17-107     AC A0A1L9VCL0.1
#=GS A0A1J4KKP6_9EUKA/232-314    AC A0A1J4KKP6.1
#=GS A0A6J1T7K4_FRAOC/17-110     AC A0A6J1T7K4.1
#=GS A0A364NEG1_9PLEO/229-313    AC A0A364NEG1.1
#=GS E2BWC5_HARSA/231-315        AC E2BWC5.1
#=GS A0A2X0LIC9_9BASI/20-106     AC A0A2X0LIC9.1
#=GS A0A2A9PK64_9HYPO/82-174     AC A0A2A9PK64.1
#=GS K4CF45_SOLLC/22-111         AC K4CF45.1
#=GS G1SPK4_RABIT/231-317        AC G1SPK4.3
#=GS S9VM59_9TRYP/220-308        AC S9VM59.1
#=GS A0A5N3V9U7_MUNRE/31-126     AC A0A5N3V9U7.1
#=GS A0A0G4IPZ6_PLABS/234-311    AC A0A0G4IPZ6.1
#=GS E2M4E2_MONPE/46-139         AC E2M4E2.1
#=GS A0A4C1TQI8_EUMVA/22-110     AC A0A4C1TQI8.1
#=GS A0A2R6PPQ7_ACTCC/234-319    AC A0A2R6PPQ7.1
#=GS A0A482SWD7_9ARCH/17-106     AC A0A482SWD7.1
#=GS A0A0K9PWV9_ZOSMR/44-130     AC A0A0K9PWV9.1
#=GS A0A0F9Y671_TRIHA/229-313    AC A0A0F9Y671.1
#=GS A0A3N6PF00_9EURY/16-113     AC A0A3N6PF00.1
#=GS F7HNN5_MACMU/22-113         AC F7HNN5.1
#=GS A0A5D2Z353_GOSMU/17-113     AC A0A5D2Z353.1
#=GS A0A1Y2HZP0_9FUNG/17-109     AC A0A1Y2HZP0.1
#=GS L8H393_ACACA/1461-1531      AC L8H393.1
#=GS A0A6A4M608_9ERIC/75-133     AC A0A6A4M608.1
#=GS A0A337S8W9_FELCA/22-109     AC A0A337S8W9.2
#=GS A0A2G2W1T7_CAPBA/187-274    AC A0A2G2W1T7.1
#=GS A0A2Z6Q612_9GLOM/231-313    AC A0A2Z6Q612.1
#=GS Q75CU7_ASHGO/229-308        AC Q75CU7.2
#=GS I2GZZ8_TETBL/20-104         AC I2GZZ8.1
#=GS A0A1U7W5D9_NICSY/33-120     AC A0A1U7W5D9.1
#=GS A0A0P0WMX1_ORYSJ/1-74       AC A0A0P0WMX1.1
#=GS A0A0C7N185_9SACH/17-110     AC A0A0C7N185.1
#=GS A0A445H443_GLYSO/55-174     AC A0A445H443.1
#=GS A0A671RYE6_9TELE/22-113     AC A0A671RYE6.1
#=GS R1G7Z8_BOTPV/21-109         AC R1G7Z8.1
#=GS RLA3_SCHPO/21-109           AC P17477.1
#=GS A0A4Y7L8W2_PAPSO/17-110     AC A0A4Y7L8W2.1
#=GS A0A665TSP8_ECHNA/22-112     AC A0A665TSP8.1
#=GS A0A0A1U4I2_ENTIV/36-123     AC A0A0A1U4I2.1
#=GS A0A0D9WXB0_9ORYZ/27-86      AC A0A0D9WXB0.1
#=GS A0A0D9X3U7_9ORYZ/65-115     AC A0A0D9X3U7.1
#=GS A0A484GK99_SOUCH/231-317    AC A0A484GK99.1
#=GS F8PYH4_SERL3/229-310        AC F8PYH4.1
#=GS A0A175YBF6_DAUCS/17-114     AC A0A175YBF6.1
#=GS A0A1Q2YE93_9ASCO/229-311    AC A0A1Q2YE93.1
#=GS A0A0E0IXY6_ORYNI/652-736    AC A0A0E0IXY6.1
#=GS A0A6J2PSP4_COTGO/231-315    AC A0A6J2PSP4.1
#=GS C5KGG1_PERM5/234-317        AC C5KGG1.1
#=GS A0A1E5RJW4_HANUV/20-104     AC A0A1E5RJW4.1
#=GS A0A0L6W8Y5_9AGAR/64-152     AC A0A0L6W8Y5.1
#=GS A0A218UML4_9PASE/22-113     AC A0A218UML4.1
#=GS A0A6P4CHK1_ARADU/17-116     AC A0A6P4CHK1.1
#=GS A0A6J3A9L1_VICPA/125-222    AC A0A6J3A9L1.1
#=GS A0A5E3WRX0_9AGAM/17-111     AC A0A5E3WRX0.1
#=GS A0A5B9DAD7_9ARCH/16-99      AC A0A5B9DAD7.1
#=GS A0A3Q3CDP3_HAPBU/169-252    AC A0A3Q3CDP3.1
#=GS A0A667XVD3_9TELE/169-252    AC A0A667XVD3.1
#=GS A0A0R3UEI3_9CEST/231-318    AC A0A0R3UEI3.2
#=GS E2BUQ0_HARSA/17-110         AC E2BUQ0.1
#=GS A0A2H5QKW6_CITUN/20-76      AC A0A2H5QKW6.1
#=GS A0A0V1LRZ9_9BILA/22-119     AC A0A0V1LRZ9.1
#=GS A0A0F0I7D7_ASPPU/21-107     AC A0A0F0I7D7.1
#=GS A0A395MMH5_9HYPO/21-108     AC A0A395MMH5.1
#=GS J9I3W2_9SPIT/17-105         AC J9I3W2.1
#=GS A0A0C4EXG3_PUCT1/5-65       AC A0A0C4EXG3.1
#=GS A0A2I3RA27_PANTR/20-96      AC A0A2I3RA27.1
#=GS A0A5C3PWY3_9APHY/229-309    AC A0A5C3PWY3.1
#=GS A0A4U6XA90_9PEZI/21-109     AC A0A4U6XA90.1
#=GS B8B251_ORYSI/410-466        AC B8B251.1
#=GS A0A0G4MST5_9PEZI/229-311    AC A0A0G4MST5.1
#=GS A0A0K9RSB2_SPIOL/234-319    AC A0A0K9RSB2.1
#=GS A0A663EG70_AQUCH/231-317    AC A0A663EG70.1
#=GS V4GP54_9EURY/16-119         AC V4GP54.1
#=GS F0XRQ9_GROCL/17-110         AC F0XRQ9.1
#=GS A0A643CCF3_BALPH/184-264    AC A0A643CCF3.1
#=GS A0A1X7R0S5_9SACH/22-107     AC A0A1X7R0S5.1
#=GS M1AAF6_SOLTU/34-122         AC M1AAF6.1
#=GS A0A4S8JQ78_MUSBA/28-118     AC A0A4S8JQ78.1
#=GS A0A507QNC8_MONPU/17-110     AC A0A507QNC8.1
#=GS A0A1Y1JE51_PLAGO/32-118     AC A0A1Y1JE51.1
#=GS A0A1J4J6E7_9EUKA/21-105     AC A0A1J4J6E7.1
#=GS A0A6P9BYZ5_PANGU/17-113     AC A0A6P9BYZ5.1
#=GS A0A139I9S3_9PEZI/627-710    AC A0A139I9S3.1
#=GS A0A5J4YUG6_PORPP/16-106     AC A0A5J4YUG6.1
#=GS A0A1C3KS02_9APIC/32-118     AC A0A1C3KS02.1
#=GS A0A1S2Z8L7_CICAR/21-111     AC A0A1S2Z8L7.1
#=GS Q9FLV1_ARATH/21-110         AC Q9FLV1.1
#=GS A0A1V6N4Z7_9EURY/16-101     AC A0A1V6N4Z7.1
#=GS X6MM70_RETFI/25-137         AC X6MM70.1
#=GS A0A0E0F2E2_9ORYZ/697-782    AC A0A0E0F2E2.1
#=GS A0A251VBQ7_HELAN/21-110     AC A0A251VBQ7.1
#=GS M7NX35_PNEMU/229-306        AC M7NX35.1
#=GS A0A0W0FKD7_9AGAR/229-312    AC A0A0W0FKD7.1
#=GS F6TQ53_MACMU/22-113         AC F6TQ53.1
#=GS A0A5N5EY89_9ROSA/21-110     AC A0A5N5EY89.1
#=GS A0A0B0N5W8_GOSAR/234-320    AC A0A0B0N5W8.1
#=GS A0A091M6C9_CARIC/17-107     AC A0A091M6C9.1
#=GS A0A2U1QJC2_ARTAN/17-110     AC A0A2U1QJC2.1
#=GS M3W9K1_FELCA/17-114         AC M3W9K1.3
#=GS A0A5B0NH05_PUCGR/229-311    AC A0A5B0NH05.1
#=GS A0A059JFE7_TRIIM/229-310    AC A0A059JFE7.1
#=GS A0A015I1B3_RHIIW/21-109     AC A0A015I1B3.1
#=GS A0A0L0C2H7_LUCCU/17-112     AC A0A0L0C2H7.1
#=GS A0A1R3JD19_COCAP/234-319    AC A0A1R3JD19.1
#=GS A0A026WMK5_OOCBI/22-109     AC A0A026WMK5.1
#=GS A0A0D2CMX9_9EURO/21-111     AC A0A0D2CMX9.1
#=GS R7QDX6_CHOCR/17-105         AC R7QDX6.1
#=GS A0A0L0BKJ7_LUCCU/14-48      AC A0A0L0BKJ7.1
#=GS A0A4S8JFF2_MUSBA/234-319    AC A0A4S8JFF2.1
#=GS A0A6A1Q797_BALPH/107-183    AC A0A6A1Q797.1
#=GS G0QXJ2_ICHMG/32-122         AC G0QXJ2.1
#=GS A0A179HNC8_PURLI/229-310    AC A0A179HNC8.1
#=GS A0A370TQM8_9HELO/21-108     AC A0A370TQM8.1
#=GS A0A0C9X1J7_9AGAR/21-109     AC A0A0C9X1J7.1
#=GS A0A1Y2G908_9FUNG/19-106     AC A0A1Y2G908.1
#=GS A8WQU5_CAEBR/17-110         AC A8WQU5.1
#=GS A0A4Q1BFT8_TREME/229-313    AC A0A4Q1BFT8.1
#=GS A0A0D2A2J8_9PEZI/230-313    AC A0A0D2A2J8.1
#=GS A0A545V6N9_9HYPO/229-312    AC A0A545V6N9.1
#=GS A0A5N5PMR5_9PEZI/229-314    AC A0A5N5PMR5.1
#=GS A0A0K9Q845_SPIOL/1-81       AC A0A0K9Q845.1
#=GS I3N2E2_ICTTR/22-113         AC I3N2E2.1
#=GS F2U5W8_SALR5/21-106         AC F2U5W8.1
#=GS A0A4D9BR94_SALSN/21-61      AC A0A4D9BR94.1
#=GS Q2QY46_ORYSJ/234-319        AC Q2QY46.1
#=GS A0A2K6R0K7_RHIRO/15-109     AC A0A2K6R0K7.1
#=GS F4IGR4_ARATH/42-129         AC F4IGR4.1
#=GS F2SXS7_TRIRC/164-252        AC F2SXS7.2
#=GS A0A452FQD1_CAPHI/24-106     AC A0A452FQD1.1
#=GS A0A5F5Q1J8_HORSE/169-254    AC A0A5F5Q1J8.1
#=GS A0A5P1EN00_ASPOF/67-146     AC A0A5P1EN00.1
#=GS A0A4R8RQ64_COLTR/229-310    AC A0A4R8RQ64.1
#=GS A0A5C2S9H7_9APHY/21-110     AC A0A5C2S9H7.1
#=GS A0A100INH0_ASPNG/21-107     AC A0A100INH0.1
#=GS A0A1E5RDQ1_HANUV/229-312    AC A0A1E5RDQ1.1
#=GS A0A3E2GS98_SCYLI/229-312    AC A0A3E2GS98.1
#=GS A0CXL4_PARTE/21-105         AC A0CXL4.1
#=GS A0A060SRB2_PYCCI/229-312    AC A0A060SRB2.1
#=GS A0A1W4X9G2_AGRPL/22-112     AC A0A1W4X9G2.1
#=GS A0A5E4Q0K5_9NEOP/22-111     AC A0A5E4Q0K5.1
#=GS A0A1E3PWL7_LIPST/29-73      AC A0A1E3PWL7.1
#=GS K1QVV8_CRAGI/65-159         AC K1QVV8.1
#=GS S8CWB2_9LAMI/241-328        AC S8CWB2.1
#=GS S7PTT8_GLOTA/21-109         AC S7PTT8.1
#=GS A0A1V6SKG6_9EURO/21-106     AC A0A1V6SKG6.1
#=GS A0A0D1W4W7_9EURO/229-315    AC A0A0D1W4W7.1
#=GS L8INW8_9CETA/17-128         AC L8INW8.1
#=GS A0A1E3PBX2_WICAA/20-106     AC A0A1E3PBX2.1
#=GS S8D3D7_9LAMI/19-119         AC S8D3D7.1
#=GS A0A1D1V394_RAMVA/192-285    AC A0A1D1V394.1
#=GS A0A091IK07_CALAN/233-319    AC A0A091IK07.1
#=GS M3ILW0_CANMX/229-286        AC M3ILW0.1
#=GS A0A0A2KP39_PENEN/17-107     AC A0A0A2KP39.1
#=GS R1GAY5_BOTPV/17-109         AC R1GAY5.1
#=GS S7PZG6_MYOBR/231-316        AC S7PZG6.1
#=GS A0A2G9T7P9_TELCI/231-314    AC A0A2G9T7P9.1
#=GS S2JPN3_MUCC1/20-104         AC S2JPN3.1
#=GS A0A6J1CQB9_MOMCH/17-116     AC A0A6J1CQB9.1
#=GS A0A1V9ZLB5_9STRA/26-111     AC A0A1V9ZLB5.1
#=GS Q0UPB2_PHANO/22-113         AC Q0UPB2.1
#=GS A0A2B7YC76_9EURO/229-310    AC A0A2B7YC76.1
#=GS G0VJ49_NAUCC/17-110         AC G0VJ49.1
#=GS C4R8M3_KOMPG/19-106         AC C4R8M3.1
#=GS A0A673UQ68_SURSU/231-316    AC A0A673UQ68.1
#=GS A0CPJ7_PARTE/17-111         AC A0CPJ7.1
#=GS A0A078B6E4_STYLE/17-107     AC A0A078B6E4.1
#=GS B8N1E9_ASPFN/229-312        AC B8N1E9.1
#=GS A0A5N6TMN5_9EURO/229-310    AC A0A5N6TMN5.1
#=GS A0A6D2HYJ4_9BRAS/48-144     AC A0A6D2HYJ4.1
#=GS A0A6J2L0S7_9CHIR/25-113     AC A0A6J2L0S7.1
#=GS B3MPX0_DROAN/17-112         AC B3MPX0.1
#=GS A0A2K6RBN1_RHIRO/231-317    AC A0A2K6RBN1.1
#=GS V4MJB8_EUTSA/234-316        AC V4MJB8.1
#=GS G3H8J3_CRIGR/22-95          AC G3H8J3.1
#=GS A0A5C3QNB2_9AGAR/17-110     AC A0A5C3QNB2.1
#=GS A0A2P5D6V7_PARAD/233-318    AC A0A2P5D6V7.1
#=GS A0A194WVZ2_9HELO/21-110     AC A0A194WVZ2.1
#=GS A0A6J1RW12_FRAOC/231-313    AC A0A6J1RW12.1
#=GS A0A287AY54_PIG/169-255      AC A0A287AY54.2
#=GS G3JMH3_CORMM/17-147         AC G3JMH3.1
#=GS Q8TI79_METAC/16-103         AC Q8TI79.1
#=GS A0A5P1EEY3_ASPOF/21-116     AC A0A5P1EEY3.1
#=GS A0A1E4TT32_PACTA/17-108     AC A0A1E4TT32.1
#=GS A0A0D3HR36_9ORYZ/870-955    AC A0A0D3HR36.1
#=GS T1KYW1_TETUR/231-314        AC T1KYW1.1
#=GS A0A4S8K646_MUSBA/16-124     AC A0A4S8K646.1
#=GS A0A3N6M5V9_9EURY/16-114     AC A0A3N6M5V9.1
#=GS Q2U017_ASPOR/17-108         AC Q2U017.1
#=GS A0A3Q0DUB8_CARSF/22-113     AC A0A3Q0DUB8.1
#=GS A0A1B8GEA0_9PEZI/21-108     AC A0A1B8GEA0.1
#=GS V8N9J7_OPHHA/213-296        AC V8N9J7.1
#=GS A0A667WJY8_9TELE/17-114     AC A0A667WJY8.1
#=GS A0A5J5AZD2_9ASTE/7-120      AC A0A5J5AZD2.1
#=GS A0A0D9X3U6_9ORYZ/65-153     AC A0A0D9X3U6.1
#=GS A0A072P706_9EURO/237-321    AC A0A072P706.1
#=GS A0A5A7PKN7_STRAF/21-110     AC A0A5A7PKN7.1
#=GS A0A2G4SU33_RHIZD/228-309    AC A0A2G4SU33.1
#=GS A0A059EMT3_9MICR/16-101     AC A0A059EMT3.1
#=GS D8LYC9_BLAHO/24-107         AC D8LYC9.1
#=GS A0A5D6Y538_9STRA/17-106     AC A0A5D6Y538.1
#=GS A0A0D1ZSR8_EXOME/229-314    AC A0A0D1ZSR8.1
#=GS A9RKJ0_PHYPA/17-113         AC A9RKJ0.1
#=GS K3ZY88_SETIT/17-111         AC K3ZY88.1
#=GS A0A0L1IY86_ASPNO/21-107     AC A0A0L1IY86.1
#=GS H0ZGQ3_TAEGU/231-317        AC H0ZGQ3.1
#=GS A0A6P5CD48_BOSIN/22-113     AC A0A6P5CD48.1
#=GS A0A182E6D2_ONCOC/231-319    AC A0A182E6D2.1
#=GS G5BA60_HETGA/44-77          AC G5BA60.1
#=GS A0A1Y3N8I7_PIRSE/21-106     AC A0A1Y3N8I7.1
#=GS A0A0K9P964_ZOSMR/234-315    AC A0A0K9P964.1
#=GS A0A2G8KXI9_STIJA/203-265    AC A0A2G8KXI9.1
#=GS A0A3Q3FIF2_9LABR/243-325    AC A0A3Q3FIF2.1
#=GS A0A0G4LXV4_9PEZI/22-114     AC A0A0G4LXV4.1
#=GS U3K7C4_FICAL/17-114         AC U3K7C4.1
#=GS C5YA36_SORBI/17-111         AC C5YA36.1
#=GS A0A6A4WC39_AMPAM/231-311    AC A0A6A4WC39.1
#=GS A0A6P6VW18_COFAR/21-111     AC A0A6P6VW18.1
#=GS A0A165WR98_9AGAM/21-109     AC A0A165WR98.1
#=GS A0A0R0M2M0_9MICR/23-107     AC A0A0R0M2M0.1
#=GS A0A182HAP0_AEDAL/17-111     AC A0A182HAP0.1
#=GS A0A0D1ZG47_9EURO/17-113     AC A0A0D1ZG47.1
#=GS A0A444D6G8_ENSVE/190-276    AC A0A444D6G8.1
#=GS M3ZAZ1_NOMLE/17-114         AC M3ZAZ1.1
#=GS A0A2R9BCE2_PANPA/39-115     AC A0A2R9BCE2.1
#=GS A0A2K6KX71_RHIBE/22-119     AC A0A2K6KX71.1
#=GS A0A1L9T462_9EURO/17-62      AC A0A1L9T462.1
#=GS A0A0B2W1V0_TOXCA/29-121     AC A0A0B2W1V0.1
#=GS A0A068V5Q5_COFCA/16-122     AC A0A068V5Q5.1
#=GS A0A376B5M2_9ASCO/17-98      AC A0A376B5M2.1
#=GS A0A1S4CUG0_TOBAC/21-112     AC A0A1S4CUG0.1
#=GS A0A2R8Z9H2_PANPA/160-246    AC A0A2R8Z9H2.1
#=GS A0A096PA80_OSTTA/17-106     AC A0A096PA80.1
#=GS A0A6J1KA82_CUCMA/17-113     AC A0A6J1KA82.1
#=GS A0A024G6R9_9STRA/26-113     AC A0A024G6R9.1
#=GS G5C8G4_HETGA/17-114         AC G5C8G4.1
#=GS L5MKB1_MYODS/17-79          AC L5MKB1.1
#=GS W5Q9W4_SHEEP/17-113         AC W5Q9W4.1
#=GS A0A139IKA9_9PEZI/285-370    AC A0A139IKA9.1
#=GS A0A1C1CI82_9EURO/229-314    AC A0A1C1CI82.1
#=GS A0A075AV84_ROZAC/382-470    AC A0A075AV84.1
#=GS A0A196SHP8_BLAHN/17-108     AC A0A196SHP8.1
#=GS A0A0V1AFD5_9BILA/231-319    AC A0A0V1AFD5.1
#=GS A0A103Y680_CYNCS/88-146     AC A0A103Y680.1
#=GS A0A162VM69_DIDRA/229-315    AC A0A162VM69.1
#=GS A0A383WB90_TETOB/21-107     AC A0A383WB90.1
#=GS D7KQB4_ARALL/22-112         AC D7KQB4.1
#=GS A0A0A1P0P5_RHIZD/17-107     AC A0A0A1P0P5.1
#=GS A0A5C5G586_9BASI/21-108     AC A0A5C5G586.1
#=GS A0A663LNP3_ATHCN/14-83      AC A0A663LNP3.1
#=GS I1S0X6_GIBZE/21-107         AC I1S0X6.1
#=GS A0A2H2IGU5_CAEJA/231-311    AC A0A2H2IGU5.1
#=GS A0A0F4ZAS3_9PEZI/17-108     AC A0A0F4ZAS3.1
#=GS A0A673JE60_9TELE/17-115     AC A0A673JE60.1
#=GS F6HNI3_VITVI/234-319        AC F6HNI3.1
#=GS E9AI48_LEIBR/20-106         AC E9AI48.1
#=GS A0A1W0X4G6_HYPDU/70-165     AC A0A1W0X4G6.1
#=GS A0A1U8H2V8_CAPAN/234-317    AC A0A1U8H2V8.1
#=GS A0B920_METTP/16-104         AC A0B920.1
#=GS Q17PA3_AEDAE/25-95          AC Q17PA3.1
#=GS A0A4U5VIW5_COLLU/22-111     AC A0A4U5VIW5.1
#=GS A0A2Y9PG23_DELLE/28-94      AC A0A2Y9PG23.1
#=GS A0A183PY38_9TREM/17-105     AC A0A183PY38.1
#=GS A0A0D2D885_9EURO/229-314    AC A0A0D2D885.1
#=GS A0A1H6SS31_9EURY/16-116     AC A0A1H6SS31.1
#=GS A0A653C089_CALMS/17-113     AC A0A653C089.1
#=GS H2N5Q2_PONAB/209-291        AC H2N5Q2.1
#=GS A0A6G1ES71_9ORYZ/17-111     AC A0A6G1ES71.1
#=GS A0A4Z1J8N2_9HELO/17-110     AC A0A4Z1J8N2.1
#=GS A0A0S6XHP9_9FUNG/21-99      AC A0A0S6XHP9.1
#=GS B7PRG2_IXOSC/231-318        AC B7PRG2.1
#=GS A0A1Y1Y099_9FUNG/20-97      AC A0A1Y1Y099.1
#=GS A0A2S7P2X6_9HELO/229-315    AC A0A2S7P2X6.1
#=GS A0A674J5J0_TERCA/17-111     AC A0A674J5J0.1
#=GS A0A151ZSZ5_9MYCE/17-112     AC A0A151ZSZ5.1
#=GS V4YHH6_9ARCH/16-111         AC V4YHH6.1
#=GS A0A498IEX4_MALDO/48-141     AC A0A498IEX4.1
#=GS A0A3Q7MKT6_CALUR/18-86      AC A0A3Q7MKT6.1
#=GS A0A194UQP5_9PEZI/229-312    AC A0A194UQP5.1
#=GS A0A2V1CPB8_9HELO/17-111     AC A0A2V1CPB8.1
#=GS A0A1U7YTX1_NELNU/17-113     AC A0A1U7YTX1.1
#=GS F9G530_FUSOF/17-109         AC F9G530.1
#=GS A0A397J5W2_9GLOM/16-111     AC A0A397J5W2.1
#=GS A0A367KBS0_RHIST/17-105     AC A0A367KBS0.1
#=GS A0A4T0J6Z3_WALIC/17-103     AC A0A4T0J6Z3.1
#=GS S7NHZ5_MYOBR/24-115         AC S7NHZ5.1
#=GS A0A1V6YBK1_PENNA/229-311    AC A0A1V6YBK1.1
#=GS W3X6Q8_PESFW/21-109         AC W3X6Q8.1
#=GS A0A367KRR5_RHIST/228-308    AC A0A367KRR5.1
#=GS C4WU73_ACYPI/23-110         AC C4WU73.1
#=GS A0A0K9QR72_SPIOL/21-107     AC A0A0K9QR72.1
#=GS A0A091UZ55_PHALP/17-109     AC A0A091UZ55.1
#=GS A0A094ZI98_SCHHA/21-113     AC A0A094ZI98.1
#=GS A0A484IEZ4_9ARCH/16-104     AC A0A484IEZ4.1
#=GS A0A3P7G8E4_HYDTA/1-76       AC A0A3P7G8E4.1
#=GS A0A643BVG3_BALPH/213-299    AC A0A643BVG3.1
#=GS A0A1Q2YKP6_9ASCO/17-107     AC A0A1Q2YKP6.1
#=GS A0A094AH38_9PEZI/229-309    AC A0A094AH38.1
#=GS A0A397YKY4_BRACM/17-112     AC A0A397YKY4.1
#=GS A0A3P8RYX5_AMPPE/231-314    AC A0A3P8RYX5.1
#=GS A0A6P6VNI6_COFAR/21-111     AC A0A6P6VNI6.1
#=GS A0A317SH34_9PEZI/21-110     AC A0A317SH34.1
#=GS A0A6P6VR31_COFAR/234-319    AC A0A6P6VR31.1
#=GS A0A1V1TQE8_9FUNG/229-311    AC A0A1V1TQE8.1
#=GS A0A5J5MWN6_MUNRE/22-107     AC A0A5J5MWN6.1
#=GS B4KFI9_DROMO/22-111         AC B4KFI9.1
#=GS A0A6J0UHV9_9SAUR/22-112     AC A0A6J0UHV9.1
#=GS A0A1E4S7N9_CYBJN/12-101     AC A0A1E4S7N9.1
#=GS A0A1Y1JFP4_PLAGO/231-315    AC A0A1Y1JFP4.1
#=GS A0A067FNS1_CITSI/234-318    AC A0A067FNS1.1
#=GS A0A6Q2Z994_ESOLU/22-111     AC A0A6Q2Z994.1
#=GS G3T9P3_LOXAF/22-112         AC G3T9P3.1
#=GS A0A135V5J4_9PEZI/229-313    AC A0A135V5J4.1
#=GS A0A199VHP1_ANACO/22-114     AC A0A199VHP1.1
#=GS M5X177_PRUPE/21-109         AC M5X177.1
#=GS M4A9A3_XIPMA/17-115         AC M4A9A3.1
#=GS Q6CEP2_YARLI/231-313        AC Q6CEP2.1
#=GS A0A202EDE9_9EURY/16-114     AC A0A202EDE9.1
#=GS G3AQQ2_SPAPN/16-109         AC G3AQQ2.1
#=GS A0A6I9T6W9_SESIN/17-113     AC A0A6I9T6W9.1
#=GS A0A2G5DPX0_AQUCA/34-116     AC A0A2G5DPX0.1
#=GS A0A2I3TSD2_PANTR/231-317    AC A0A2I3TSD2.1
#=GS A0A022PS20_ERYGU/234-321    AC A0A022PS20.1
#=GS Q16FZ1_AEDAE/17-95          AC Q16FZ1.1
#=GS A0A3P9P7D4_POERE/17-113     AC A0A3P9P7D4.1
#=GS A0A6G1P8H9_9TELE/17-114     AC A0A6G1P8H9.1
#=GS L2GQ90_VITCO/22-105         AC L2GQ90.1
#=GS A2DY95_TRIVA/20-102         AC A2DY95.1
#=GS A0A3Q2DN09_CYPVA/22-111     AC A0A3Q2DN09.1
#=GS A0A0E0E5Z4_9ORYZ/51-118     AC A0A0E0E5Z4.1
#=GS A0A1Y1Y9T3_9FUNG/20-105     AC A0A1Y1Y9T3.1
#=GS A0A397VXQ0_9GLOM/231-312    AC A0A397VXQ0.1
#=GS A0A5E4MAX5_9HEMI/23-110     AC A0A5E4MAX5.1
#=GS A0A392QZQ2_9FABA/1-52       AC A0A392QZQ2.1
#=GS A0A5B1L1L2_9ACTN/17-111     AC A0A5B1L1L2.1
#=GS J4DNE2_THEOR/231-312        AC J4DNE2.1
#=GS G3T948_LOXAF/231-317        AC G3T948.1
#=GS A0A1S4AV90_TOBAC/234-321    AC A0A1S4AV90.1
#=GS A0A3B6SHJ3_WHEAT/16-119     AC A0A3B6SHJ3.1
#=GS A0A421JM04_9ASCO/17-110     AC A0A421JM04.1
#=GS A0A4U6VGA1_SETVI/17-111     AC A0A4U6VGA1.1
#=GS A0A443I0H5_BYSSP/21-109     AC A0A443I0H5.1
#=GS W9SKG9_9ROSA/21-110         AC W9SKG9.1
#=GS A0A6J0V2Y5_9SAUR/231-314    AC A0A6J0V2Y5.1
#=GS B3H4N7_ARATH/28-118         AC B3H4N7.1
#=GS A0A3N4JVF8_9PEZI/17-105     AC A0A3N4JVF8.1
#=GS E3RLB1_PYRTT/17-111         AC E3RLB1.1
#=GS A8MQR4_ARATH/200-284        AC A8MQR4.1
#=GS A0A2Y9PJ14_DELLE/18-88      AC A0A2Y9PJ14.1
#=GS A0A1V8T4W8_9PEZI/17-112     AC A0A1V8T4W8.1
#=GS A0A6J0L4D6_RAPSA/34-119     AC A0A6J0L4D6.1
#=GS A0A3N4KL99_9PEZI/228-312    AC A0A3N4KL99.1
#=GS A0A6A3C4D7_HIBSY/22-113     AC A0A6A3C4D7.1
#=GS A0A0S3T1U6_PHAAN/234-319    AC A0A0S3T1U6.1
#=GS S9V9X6_9TRYP/16-105         AC S9V9X6.1
#=GS A0A5D6XY25_9STRA/17-107     AC A0A5D6XY25.1
#=GS A0A074ZID6_9TREM/21-112     AC A0A074ZID6.1
#=GS A0A4Y9Z2T0_9APHY/229-314    AC A0A4Y9Z2T0.1
#=GS A0A6P3RQ12_PTEVA/22-113     AC A0A6P3RQ12.1
#=GS U6H304_9EIME/19-112         AC U6H304.1
#=GS G3PS60_GASAC/17-104         AC G3PS60.1
#=GS M4B8T5_HYAAE/28-115         AC M4B8T5.1
#=GS A0A091D9Z9_FUKDA/229-315    AC A0A091D9Z9.1
#=GS A0A364LA76_9EURO/17-111     AC A0A364LA76.1
#=GS A0A034VUK6_BACDO/22-111     AC A0A034VUK6.1
#=GS A0A0E0IXV4_ORYNI/654-739    AC A0A0E0IXV4.1
#=GS A0A1S3UE79_VIGRR/17-112     AC A0A1S3UE79.1
#=GS F4WYW0_ACREC/17-61          AC F4WYW0.1
#=GS A0A6P8FQ46_CLUHA/17-115     AC A0A6P8FQ46.1
#=GS A0A5N6M9L3_9ASTR/17-112     AC A0A5N6M9L3.1
#=GS A0A6A2Y0T1_HIBSY/17-111     AC A0A6A2Y0T1.1
#=GS R0G0H9_9BRAS/234-318        AC R0G0H9.1
#=GS A0A1B8CAT0_9PEZI/21-108     AC A0A1B8CAT0.1
#=GS A0A6P3W372_CLUHA/22-111     AC A0A6P3W372.1
#=GS A0A6P5KSE3_PHACI/21-114     AC A0A6P5KSE3.1
#=GS A0A5N3X706_MUNRE/22-113     AC A0A5N3X706.1
#=GS D1FPL7_CIMLE/21-114         AC D1FPL7.1
#=GS A0A2V0PLD6_9CHLO/21-72      AC A0A2V0PLD6.1
#=GS A0A2K5ECQ2_AOTNA/17-114     AC A0A2K5ECQ2.1
#=GS A0A4Q4YVM5_9PEZI/21-110     AC A0A4Q4YVM5.1
#=GS A0A7D8ZA15_9TREE/17-111     AC A0A7D8ZA15.1
#=GS A0A2I3MQG2_PAPAN/22-113     AC A0A2I3MQG2.1
#=GS A0A074S6L3_9AGAM/21-110     AC A0A074S6L3.1
#=GS S2J866_MUCC1/228-307        AC S2J866.1
#=GS A0A1X7R2V9_9SACH/16-105     AC A0A1X7R2V9.1
#=GS A0A6P5JL48_PHACI/17-107     AC A0A6P5JL48.1
#=GS R7TVI3_CAPTE/22-108         AC R7TVI3.1
#=GS A0A6J3CEA7_AYTFU/22-113     AC A0A6J3CEA7.1
#=GS S9WUP8_CAMFR/13-86          AC S9WUP8.1
#=GS A0A6F9CXR4_9TELE/17-61      AC A0A6F9CXR4.1
#=GS A0A1J9RD77_9EURO/21-109     AC A0A1J9RD77.1
#=GS A0A1L9NML1_ASPTC/21-107     AC A0A1L9NML1.1
#=GS A0A2C6LB69_9APIC/75-163     AC A0A2C6LB69.1
#=GS A8NUM6_COPC7/300-393        AC A8NUM6.2
#=GS D2RF87_ARCPA/16-105         AC D2RF87.1
#=GS A0A0D9VGL6_9ORYZ/17-112     AC A0A0D9VGL6.1
#=GS A0A1H5U0X2_9EURY/16-112     AC A0A1H5U0X2.1
#=GS A0A1V6R8B9_9EURO/21-106     AC A0A1V6R8B9.1
#=GS A0A6G0YWX7_APHCR/23-110     AC A0A6G0YWX7.1
#=GS A0A673UF61_SURSU/17-113     AC A0A673UF61.1
#=GS A0A0E0JF30_ORYPU/75-171     AC A0A0E0JF30.1
#=GS A0A6I9L661_PERMB/17-112     AC A0A6I9L661.1
#=GS A0A0G2ECT6_9EURO/21-110     AC A0A0G2ECT6.1
#=GS A0A2A3E478_APICC/231-316    AC A0A2A3E478.1
#=GS A0A2D3USJ5_9PEZI/229-312    AC A0A2D3USJ5.1
#=GS A0A0R3PM18_ANGCS/143-222    AC A0A0R3PM18.1
#=GS A0A0B1P9P9_UNCNE/230-309    AC A0A0B1P9P9.1
#=GS S8FH24_FOMPI/17-111         AC S8FH24.1
#=GS G3UKL4_LOXAF/1-89           AC G3UKL4.1
#=GS A0A2S4L754_9HYPO/229-312    AC A0A2S4L754.1
#=GS A0A0D0BC83_9AGAM/17-111     AC A0A0D0BC83.1
#=GS L9L0I8_TUPCH/87-156         AC L9L0I8.1
#=GS A0A151NXA7_ALLMI/43-140     AC A0A151NXA7.1
#=GS A0A0G4LCF4_9PEZI/229-312    AC A0A0G4LCF4.1
#=GS W9QSW8_9ROSA/17-114         AC W9QSW8.1
#=GS Q6CEU7_YARLI/20-103         AC Q6CEU7.1
#=GS A0A1V6ULT6_9EURO/229-311    AC A0A1V6ULT6.1
#=GS A0A4X2KKZ8_VOMUR/146-231    AC A0A4X2KKZ8.1
#=GS A0A1D2VQU0_9ASCO/22-110     AC A0A1D2VQU0.1
#=GS A0A2I0RHV7_9PEZI/21-99      AC A0A2I0RHV7.1
#=GS F7B9V8_MONDO/169-254        AC F7B9V8.2
#=GS Q6CPR5_KLULA/17-108         AC Q6CPR5.1
#=GS A0A2I3LJV3_PAPAN/13-96      AC A0A2I3LJV3.1
#=GS RL10_PYRFU/233-338          AC Q8TZJ8.1
#=GS A0A6J1VZG5_9SAUR/22-112     AC A0A6J1VZG5.1
#=GS A0A251TCN0_HELAN/233-317    AC A0A251TCN0.1
#=GS W9X182_9EURO/17-113         AC W9X182.1
#=GS A0A2K5XQ90_MANLE/18-88      AC A0A2K5XQ90.1
#=GS A0A1S2Z6N6_CICAR/21-107     AC A0A1S2Z6N6.1
#=GS A0A1B8DA65_9PEZI/21-108     AC A0A1B8DA65.1
#=GS A0A565BTG1_9BRAS/17-110     AC A0A565BTG1.1
#=GS A0A392MYU3_9FABA/125-211    AC A0A392MYU3.1
#=GS A0A183NH97_9TREM/231-316    AC A0A183NH97.1
#=GS A0A267EPU5_9PLAT/37-129     AC A0A267EPU5.1
#=GS A0A3L8SCE0_CHLGU/231-318    AC A0A3L8SCE0.1
#=GS A0A0L9UMT8_PHAAN/21-111     AC A0A0L9UMT8.1
#=GS A0A6I9RDP9_ELAGV/17-113     AC A0A6I9RDP9.1
#=GS R1E4V9_NANST/18-100         AC R1E4V9.1
#=GS A0A425BQB1_9PEZI/229-312    AC A0A425BQB1.1
#=GS A0A094FY99_9PEZI/229-311    AC A0A094FY99.1
#=GS A2E256_TRIVA/17-103         AC A2E256.1
#=GS H0XV37_OTOGA/230-315        AC H0XV37.1
#=GS A0A2G3DFD8_CAPCH/17-111     AC A0A2G3DFD8.1
#=GS A0A3N0XLV5_ANAGA/22-112     AC A0A3N0XLV5.1
#=GS A5DVW4_LODEL/20-109         AC A5DVW4.1
#=GS A0A1P8B2C7_ARATH/4-90       AC A0A1P8B2C7.1
#=GS A0A317SZC0_9PEZI/17-102     AC A0A317SZC0.1
#=GS A0A2N5V767_9BASI/17-111     AC A0A2N5V767.1
#=GS A0A1R2AZ84_9CILI/17-111     AC A0A1R2AZ84.1
#=GS B0WRG9_CULQU/47-131         AC B0WRG9.1
#=GS A0A6J0D592_PERMB/27-119     AC A0A6J0D592.1
#=GS A0A226NVT6_COLVI/241-326    AC A0A226NVT6.1
#=GS A0A1J4JMG0_9EUKA/232-314    AC A0A1J4JMG0.1
#=GS A0A2R6W7D1_MARPO/22-106     AC A0A2R6W7D1.1
#=GS A0A0C9M7A6_9FUNG/17-105     AC A0A0C9M7A6.1
#=GS A0A1E4SGD9_9ASCO/17-108     AC A0A1E4SGD9.1
#=GS A0A0H2S4J3_9AGAM/17-110     AC A0A0H2S4J3.1
#=GS A0A096P8Y9_OSTTA/20-103     AC A0A096P8Y9.1
#=GS A0A1L9WW95_ASPA1/21-107     AC A0A1L9WW95.1
#=GS A0A0E0AJG8_9ORYZ/17-103     AC A0A0E0AJG8.1
#=GS F8VWS0_HUMAN/195-280        AC F8VWS0.1
#=GS A0A1Z5KM38_FISSO/17-104     AC A0A1Z5KM38.1
#=GS A0A197JV26_9FUNG/17-108     AC A0A197JV26.1
#=GS A0A0L0NLB5_TOLOC/229-311    AC A0A0L0NLB5.1
#=GS A0A1S3EZM8_DIPOR/231-316    AC A0A1S3EZM8.1
#=GS A0A1Z5SUK8_HORWE/17-110     AC A0A1Z5SUK8.1
#=GS C5DQR5_ZYGRC/17-107         AC C5DQR5.1
#=GS A0A482W9A4_9CUCU/27-121     AC A0A482W9A4.1
#=GS B4IAY7_DROSE/231-316        AC B4IAY7.1
#=GS A0A178ZUX0_9EURO/17-113     AC A0A178ZUX0.1
#=GS G1XBG0_ARTOA/17-110         AC G1XBG0.1
#=GS A0A2P8XSK5_BLAGE/22-114     AC A0A2P8XSK5.1
#=GS A0A2N5VH67_9BASI/49-138     AC A0A2N5VH67.1
#=GS A0A3M6UZV5_POCDA/231-316    AC A0A3M6UZV5.1
#=GS A0A093GFI5_DRYPU/22-113     AC A0A093GFI5.1
#=GS N1JL89_BLUG1/17-109         AC N1JL89.1
#=GS A0A0D2PJ47_GOSRA/17-113     AC A0A0D2PJ47.1
#=GS M0M6Q8_HALMO/16-112         AC M0M6Q8.1
#=GS C5DTK9_ZYGRC/19-103         AC C5DTK9.1
#=GS H2C850_9CREN/16-103         AC H2C850.1
#=GS A0A162DFT0_9CRUS/17-113     AC A0A162DFT0.1
#=GS B8AYR2_ORYSI/92-187         AC B8AYR2.1
#=GS A0A2Z7AF21_9LAMI/149-234    AC A0A2Z7AF21.1
#=GS A0A2Y9PJ04_DELLE/22-113     AC A0A2Y9PJ04.1
#=GS A0A485KPX2_9STRA/231-312    AC A0A485KPX2.1
#=GS A0A6P4DQ17_ARADU/17-112     AC A0A6P4DQ17.1
#=GS A0A5C7H081_9ROSI/233-318    AC A0A5C7H081.1
#=GS A0A4Y7QKT3_9AGAM/85-181     AC A0A4Y7QKT3.1
#=GS A0A5E4GN44_PRUDU/234-317    AC A0A5E4GN44.1
#=GS W6L3U8_9TRYP/18-111         AC W6L3U8.1
#=GS A0A2P5EDQ8_TREOI/21-110     AC A0A2P5EDQ8.1
#=GS A0A2T7PDX6_POMCA/18-119     AC A0A2T7PDX6.1
#=GS H3DXJ6_PRIPA/17-107         AC H3DXJ6.2
#=GS M0S1D5_MUSAM/22-111         AC M0S1D5.1
#=GS A0A267ETJ4_9PLAT/26-116     AC A0A267ETJ4.1
#=GS A0A5N5QM86_9AGAM/27-117     AC A0A5N5QM86.1
#=GS A0A5D2Y0Q5_GOSMU/21-111     AC A0A5D2Y0Q5.1
#=GS G1UBJ1_METIK/239-342        AC G1UBJ1.1
#=GS A0A1S2Z8L6_CICAR/21-108     AC A0A1S2Z8L6.1
#=GS A0A3N4IAL8_ASCIM/21-109     AC A0A3N4IAL8.1
#=GS A0A2P5ANT8_PARAD/17-115     AC A0A2P5ANT8.1
#=GS A0A6J3LWT5_9PEZI/21-107     AC A0A6J3LWT5.1
#=GS A0A4T0X7B4_9ASCO/67-155     AC A0A4T0X7B4.1
#=GS A0A392PQZ3_9FABA/43-128     AC A0A392PQZ3.1
#=GS A0A2U9R6G0_PICKU/17-104     AC A0A2U9R6G0.1
#=GS A0A3S3QYY4_9ACAR/17-65      AC A0A3S3QYY4.1
#=GS A0A4Q4YX34_9PEZI/17-111     AC A0A4Q4YX34.1
#=GS A0A2G3BYU9_CAPCH/31-117     AC A0A2G3BYU9.1
#=GS A0A672TPI5_STRHB/17-93      AC A0A672TPI5.1
#=GS A0A2G3BB75_CAPCH/17-111     AC A0A2G3BB75.1
#=GS A0A0G4ILF5_PLABS/17-108     AC A0A0G4ILF5.1
#=GS A0A6J0LKK2_RAPSA/22-112     AC A0A6J0LKK2.1
#=GS A0A1Z5SSV4_HORWE/259-337    AC A0A1Z5SSV4.1
#=GS A0A2I4DGW4_JUGRE/234-320    AC A0A2I4DGW4.1
#=GS A0A0A7LDJ0_9ARCH/16-104     AC A0A0A7LDJ0.1
#=GS M2QPS8_CERS8/17-111         AC M2QPS8.1
#=GS A0A452SPN4_URSAM/231-316    AC A0A452SPN4.1
#=GS A0A662WLE5_9STRA/17-107     AC A0A662WLE5.1
#=GS A0A3Q2HC31_HORSE/21-112     AC A0A3Q2HC31.1
#=GS A0A4X2LDH5_VOMUR/21-113     AC A0A4X2LDH5.1
#=GS A0A1Y3GGN5_9EURY/16-106     AC A0A1Y3GGN5.1
#=GS J9P6M3_CANLF/17-114         AC J9P6M3.1
#=GS A0A2U1LPW4_ARTAN/21-64      AC A0A2U1LPW4.1
#=GS A0A672HE05_SALFA/231-314    AC A0A672HE05.1
#=GS C5DJC7_LACTC/17-109         AC C5DJC7.1
#=GS A0A4U1EMM0_MONMO/17-114     AC A0A4U1EMM0.1
#=GS G0R6F8_ICHMG/32-121         AC G0R6F8.1
#=GS A8Q9T2_MALGO/17-111         AC A8Q9T2.1
#=GS A0A0B2V4S9_TOXCA/231-317    AC A0A0B2V4S9.1
#=GS A0A183SB89_SCHSO/25-84      AC A0A183SB89.1
#=GS A0A2Y9PD15_DELLE/34-119     AC A0A2Y9PD15.1
#=GS A0A5J5ELI2_9PEZI/17-112     AC A0A5J5ELI2.1
#=GS A0A0F9XXS0_TRIHA/17-109     AC A0A0F9XXS0.1
#=GS H2UUC0_TAKRU/231-313        AC H2UUC0.3
#=GS A0A394DET4_LUPAN/21-110     AC A0A394DET4.1
#=GS A0A226EPN2_FOLCA/231-314    AC A0A226EPN2.1
#=GS A0A0B7FZP7_THACB/53-137     AC A0A0B7FZP7.1
#=GS V2XB59_MONRO/17-112         AC V2XB59.1
#=GS J9DQC1_EDHAE/16-101         AC J9DQC1.1
#=GS A0A0L1KLU9_9EUGL/239-320    AC A0A0L1KLU9.1
#=GS A0A060HQZ0_9ARCH/25-110     AC A0A060HQZ0.1
#=GS D7LJ08_ARALL/17-97          AC D7LJ08.1
#=GS N1Q2T6_DOTSN/17-112         AC N1Q2T6.1
#=GS A0A1V6U041_9EURO/17-106     AC A0A1V6U041.1
#=GS A0A1R3KNQ4_9ROSI/263-354    AC A0A1R3KNQ4.1
#=GS A0A0C3BHN9_HEBCY/392-479    AC A0A0C3BHN9.1
#=GS A0A2S5B5Y7_9BASI/16-99      AC A0A2S5B5Y7.1
#=GS A0A1E3HN70_9TREE/17-110     AC A0A1E3HN70.1
#=GS G4N024_MAGO7/21-108         AC G4N024.1
#=GS A0A078JQ43_BRANA/132-219    AC A0A078JQ43.1
#=GS A0A0F7TRC2_PENBI/17-108     AC A0A0F7TRC2.1
#=GS M5G067_DACPD/17-114         AC M5G067.1
#=GS A0A2T9Y581_9FUNG/21-63      AC A0A2T9Y581.1
#=GS A0A1J6HXL0_NICAT/17-115     AC A0A1J6HXL0.1
#=GS A0DBJ7_PARTE/34-121         AC A0DBJ7.1
#=GS A0A098VPF9_9MICR/17-107     AC A0A098VPF9.1
#=GS A0A3D8SGY4_9HELO/229-313    AC A0A3D8SGY4.1
#=GS Q8PY50_METMA/16-103         AC Q8PY50.1
#=GS RLA3_YEAST/19-105           AC P10622.3
#=GS A0A1V6TFM1_9EURO/229-310    AC A0A1V6TFM1.1
#=GS A0A2U1P5T1_ARTAN/371-454    AC A0A2U1P5T1.1
#=GS A0A6J3RW85_TURTR/22-113     AC A0A6J3RW85.1
#=GS A0A5D2WD51_GOSMU/17-113     AC A0A5D2WD51.1
#=GS A0A1J7HS47_LUPAN/21-110     AC A0A1J7HS47.1
#=GS Q6DJI6_XENLA/17-110         AC Q6DJI6.1
#=GS Q7R992_PLAYO/32-118         AC Q7R992.1
#=GS D8T6I7_SELML/21-110         AC D8T6I7.1
#=GS E1BCL5_BOVIN/22-113         AC E1BCL5.1
#=GS A0A2C9W0M2_MANES/17-113     AC A0A2C9W0M2.1
#=GS G5C6T4_HETGA/22-113         AC G5C6T4.1
#=GS A0A1U7VRD1_NICSY/234-321    AC A0A1U7VRD1.1
#=GS A0RWZ8_CENSY/16-97          AC A0RWZ8.1
#=GS A0A150V845_9PEZI/17-111     AC A0A150V845.1
#=GS A0A7E5WJL7_TRINI/17-110     AC A0A7E5WJL7.1
#=GS U6GWB9_EIMAC/114-199        AC U6GWB9.1
#=GS M2P7L9_CERS8/229-312        AC M2P7L9.1
#=GS C1G9U4_PARBD/229-312        AC C1G9U4.1
#=GS A0A1Y2IZ87_PYCCO/229-311    AC A0A1Y2IZ87.1
#=GS A0A1I0MZ83_9EURY/16-114     AC A0A1I0MZ83.1
#=GS A0A507E3K3_9FUNG/17-111     AC A0A507E3K3.1
#=GS A0A2P6QDB6_ROSCH/17-113     AC A0A2P6QDB6.1
#=GS A0A1Y2AVT0_9TREE/20-109     AC A0A1Y2AVT0.1
#=GS A0A446XII7_TRITD/227-311    AC A0A446XII7.1
#=GS A4I5Z9_LEIIN/16-104         AC A4I5Z9.1
#=GS M0MKC4_9EURY/16-115         AC M0MKC4.1
#=GS G1Q6L0_MYOLU/22-94          AC G1Q6L0.1
#=GS A0A673X625_SALTR/169-252    AC A0A673X625.1
#=GS A0A2U0S2G9_9ARCH/16-101     AC A0A2U0S2G9.1
#=GS E2RLZ4_CANLF/197-281        AC E2RLZ4.3
#=GS A4H884_LEIBR/18-111         AC A4H884.1
#=GS A0A0C4DMY0_MAGP6/229-312    AC A0A0C4DMY0.1
#=GS G0V8E7_NAUCC/17-110         AC G0V8E7.1
#=GS A0A6I8S4B0_XENTR/22-95      AC A0A6I8S4B0.1
#=GS A0A0L0HJ29_SPIPD/17-109     AC A0A0L0HJ29.1
#=GS N4TZ83_FUSC1/229-312        AC N4TZ83.1
#=GS A0A2U9BGN6_SCOMX/231-314    AC A0A2U9BGN6.1
#=GS A0A1A8YSH4_9APIC/19-110     AC A0A1A8YSH4.1
#=GS A0A2R6RSH6_ACTCC/22-110     AC A0A2R6RSH6.1
#=GS A8J0R4_CHLRE/17-108         AC A8J0R4.1
#=GS A0A5N5F4Q8_9ROSA/234-319    AC A0A5N5F4Q8.1
#=GS G2QYJ8_THETT/17-111         AC G2QYJ8.1
#=GS A0A086SV71_ACRC1/17-109     AC A0A086SV71.1
#=GS A0A5D2TPW0_GOSMU/17-113     AC A0A5D2TPW0.1
#=GS A0A1U7TQH8_CARSF/22-113     AC A0A1U7TQH8.1
#=GS A0A3P9AP39_ESOLU/231-314    AC A0A3P9AP39.1
#=GS A0A2C9VCT0_MANES/3-100      AC A0A2C9VCT0.1
#=GS M2ULJ2_COCH5/229-313        AC M2ULJ2.1
#=GS V2Y0H6_MONRO/266-349        AC V2Y0H6.1
#=GS A0A671DTW8_RHIFE/18-88      AC A0A671DTW8.1
#=GS U6K4S7_9EIME/19-116         AC U6K4S7.1
#=GS A0A2T0FCS2_9ASCO/19-107     AC A0A2T0FCS2.1
#=GS A0A167M5G2_PHYB8/228-309    AC A0A167M5G2.1
#=GS A0A256IDY7_9EURY/16-109     AC A0A256IDY7.1
#=GS X0DB90_FUSOX/229-312        AC X0DB90.1
#=GS A0A084G738_PSEDA/17-109     AC A0A084G738.1
#=GS A0A485K4L7_9STRA/29-112     AC A0A485K4L7.1
#=GS T0KT72_COLGC/21-108         AC T0KT72.1
#=GS A0A6I9Z1Y4_9SAUR/22-112     AC A0A6I9Z1Y4.1
#=GS A0A139AXR1_GONPJ/271-362    AC A0A139AXR1.1
#=GS A0A663E2J0_AQUCH/18-88      AC A0A663E2J0.1
#=GS A0A6P4AQT5_ZIZJJ/20-109     AC A0A6P4AQT5.1
#=GS A0A6J0LP80_RAPSA/17-113     AC A0A6J0LP80.1
#=GS A0A452DWX0_CAPHI/22-113     AC A0A452DWX0.1
#=GS F2U585_SALR5/20-117         AC F2U585.1
#=GS A0A3B6RK63_WHEAT/234-318    AC A0A3B6RK63.1
#=GS A0A2G3B4K3_CAPCH/87-160     AC A0A2G3B4K3.1
#=GS A0A6D2IY96_9BRAS/233-319    AC A0A6D2IY96.1
#=GS Q6CDT9_YARLI/19-106         AC Q6CDT9.1
#=GS A0A087GR80_ARAAL/17-114     AC A0A087GR80.1
#=GS A0A1J4JX05_9EUKA/232-314    AC A0A1J4JX05.1
#=GS A0A2C5YYM2_9HYPO/22-109     AC A0A2C5YYM2.1
#=GS B5DGW8_SALSA/17-113         AC B5DGW8.1
#=GS A0A5A7R2K4_STRAF/234-322    AC A0A5A7R2K4.1
#=GS A0A2I4BBJ0_9TELE/231-314    AC A0A2I4BBJ0.1
#=GS Q7RRQ9_PLAYO/231-314        AC Q7RRQ9.1
#=GS A0A4D9AEC2_SALSN/14-83      AC A0A4D9AEC2.1
#=GS A0A5D2UB61_GOSMU/22-113     AC A0A5D2UB61.1
#=GS M0U057_MUSAM/38-121         AC M0U057.1
#=GS A0A1Q8R9V9_9PEZI/17-110     AC A0A1Q8R9V9.1
#=GS C9SMK1_VERA1/17-109         AC C9SMK1.1
#=GS A0A364MUP7_9PLEO/1127-1218  AC A0A364MUP7.1
#=GS A0A1E5VPT4_9POAL/210-295    AC A0A1E5VPT4.1
#=GS A0A402FLL9_9SAUR/18-84      AC A0A402FLL9.1
#=GS A0A452S8L9_URSAM/17-114     AC A0A452S8L9.1
#=GS A0A7C8MEU8_9PLEO/229-314    AC A0A7C8MEU8.1
#=GS A0A0L8GED2_OCTBM/231-319    AC A0A0L8GED2.1
#=GS A0A2I4GKU7_JUGRE/17-112     AC A0A2I4GKU7.1
#=GS A0A507CX29_9FUNG/76-173     AC A0A507CX29.1
#=GS A0A0N0NL08_9EURO/21-82      AC A0A0N0NL08.1
#=GS A0A6P8S247_GEOSA/17-99      AC A0A6P8S247.1
#=GS A0A540NFH7_MALBA/21-110     AC A0A540NFH7.1
#=GS A0A4S8MK76_DENBC/229-312    AC A0A4S8MK76.1
#=GS A0A1J4JRU1_9EUKA/21-105     AC A0A1J4JRU1.1
#=GS A0A2G7FT60_9EURO/229-312    AC A0A2G7FT60.1
#=GS A0A0E0DS56_9ORYZ/85-180     AC A0A0E0DS56.1
#=GS A0A152A266_9MYCE/27-119     AC A0A152A266.1
#=GS A0A653CP06_CALMS/22-111     AC A0A653CP06.1
#=GS A0A1R2BXR4_9CILI/32-118     AC A0A1R2BXR4.1
#=GS A0A2D3UXG0_9PEZI/17-109     AC A0A2D3UXG0.1
#=GS A0A179IK34_CORDF/17-109     AC A0A179IK34.1
#=GS U5HD23_USTV1/20-106         AC U5HD23.1
#=GS A0A1Z5JYN3_FISSO/231-316    AC A0A1Z5JYN3.1
#=GS G8Y5Z3_PICSO/17-105         AC G8Y5Z3.1
#=GS A0A498NCF3_LABRO/231-315    AC A0A498NCF3.1
#=GS A0A2K6BPI2_MACNE/216-303    AC A0A2K6BPI2.1
#=GS A0A2T4H2E2_FUSCU/229-311    AC A0A2T4H2E2.1
#=GS T0S967_SAPDV/53-138         AC T0S967.1
#=GS G7XCX2_ASPKW/17-108         AC G7XCX2.1
#=GS A0A1R3H1F3_COCAP/22-113     AC A0A1R3H1F3.1
#=GS A0A1X7R0N4_9SACH/22-107     AC A0A1X7R0N4.1
#=GS Q4DLC3_TRYCC/16-106         AC Q4DLC3.1
#=GS A0A642UWY4_DIURU/17-107     AC A0A642UWY4.1
#=GS A0A0R3QKX6_9BILA/113-208    AC A0A0R3QKX6.1
#=GS A0A430PZH1_SCHBO/21-113     AC A0A430PZH1.1
#=GS A0A067L8U4_JATCU/234-320    AC A0A067L8U4.1
#=GS F6Z0Y9_CALJA/22-113         AC F6Z0Y9.1
#=GS U7PTK4_SPOS1/229-311        AC U7PTK4.1
#=GS A0A7D5L3L9_9EURY/16-114     AC A0A7D5L3L9.1
#=GS A0A4S4LLI5_9APHY/6-90       AC A0A4S4LLI5.1
#=GS R8BRQ1_TOGMI/229-311        AC R8BRQ1.1
#=GS A0A0E0JF31_ORYPU/17-113     AC A0A0E0JF31.1
#=GS A0A0D9UXS2_9ORYZ/17-113     AC A0A0D9UXS2.1
#=GS A0A4U6U381_SETVI/21-108     AC A0A4U6U381.1
#=GS A0A096MPE9_PAPAN/191-278    AC A0A096MPE9.2
#=GS G9ND76_HYPVG/229-313        AC G9ND76.1
#=GS A0A5D2ZHH0_GOSMU/234-319    AC A0A5D2ZHH0.1
#=GS A0A3Q7Q2X8_CALUR/22-113     AC A0A3Q7Q2X8.1
#=GS A0C509_PARTE/21-105         AC A0C509.1
#=GS A0A2K1IJU3_PHYPA/21-107     AC A0A2K1IJU3.1
#=GS E2BUM9_HARSA/17-114         AC E2BUM9.1
#=GS A0A672HN42_SALFA/22-89      AC A0A672HN42.1
#=GS A0A5Q4C4C8_9PEZI/21-109     AC A0A5Q4C4C8.1
#=GS A0A1S4BJ93_TOBAC/17-111     AC A0A1S4BJ93.1
#=GS A0A1V8V4P4_9PEZI/229-312    AC A0A1V8V4P4.1
#=GS Q4E3A3_TRYCC/238-323        AC Q4E3A3.1
#=GS A0A2I4DX25_JUGRE/17-115     AC A0A2I4DX25.1
#=GS A0A7N5JVJ9_AILME/24-107     AC A0A7N5JVJ9.1
#=GS H3D0A0_TETNG/231-314        AC H3D0A0.1
#=GS V4KQ04_EUTSA/23-112         AC V4KQ04.1
#=GS A0A117NPJ8_9EURO/229-311    AC A0A117NPJ8.1
#=GS A0A0D3HR37_9ORYZ/841-926    AC A0A0D3HR37.1
#=GS A0A087XFL5_POEFO/17-114     AC A0A087XFL5.1
#=GS A0A1Y1UTV2_9TREE/20-112     AC A0A1Y1UTV2.1
#=GS A0A673JJH5_9TELE/29-125     AC A0A673JJH5.1
#=GS A0A196SI88_BLAHN/17-108     AC A0A196SI88.1
#=GS A0A0J8B052_BETVV/28-113     AC A0A0J8B052.1
#=GS A0A6J0ZPZ8_9ROSI/26-120     AC A0A6J0ZPZ8.1
#=GS A0A5N4EIE6_CAMDR/124-203    AC A0A5N4EIE6.1
#=GS D7TJ45_VITVI/17-113         AC D7TJ45.1
#=GS A0A1Y1Z5D5_9FUNG/17-107     AC A0A1Y1Z5D5.1
#=GS A0A4T0VKD2_9PEZI/21-109     AC A0A4T0VKD2.1
#=GS A0A6J1AQR1_9ROSI/17-95      AC A0A6J1AQR1.1
#=GS S9VUQ9_SCHCR/17-108         AC S9VUQ9.1
#=GS U6M027_EIMMA/32-123         AC U6M027.1
#=GS R4XBQ8_TAPDE/229-312        AC R4XBQ8.1
#=GS A0A2K5QZQ1_CEBIM/8-94       AC A0A2K5QZQ1.1
#=GS V5G7B6_BYSSN/21-107         AC V5G7B6.1
#=GS A0A225VL95_9STRA/17-107     AC A0A225VL95.1
#=GS A0A2I4GXN8_JUGRE/17-115     AC A0A2I4GXN8.1
#=GS A0A1I8I1D2_9PLAT/231-314    AC A0A1I8I1D2.1
#=GS A0A395IZ57_9HELO/43-131     AC A0A395IZ57.1
#=GS A4S8E4_OSTLU/20-103         AC A4S8E4.1
#=GS V9EVD5_PHYPR/17-105         AC V9EVD5.1
#=GS A0A1Y1Z0X1_9PLEO/21-111     AC A0A1Y1Z0X1.1
#=GS A0A398AI38_BRACM/17-113     AC A0A398AI38.1
#=GS A0A5F9C609_RABIT/169-255    AC A0A5F9C609.1
#=GS A0A3R7PC66_PENVA/60-129     AC A0A3R7PC66.1
#=GS A0A510E2D0_9CREN/16-102     AC A0A510E2D0.1
#=GS D3BDB6_POLPP/22-110         AC D3BDB6.1
#=GS G4UAY1_NEUT9/17-109         AC G4UAY1.1
#=GS A0A4R0REF2_9APHY/229-313    AC A0A4R0REF2.1
#=GS A0A6P8NV31_GEOSA/17-111     AC A0A6P8NV31.1
#=GS A0A5J9WB45_9POAL/135-229    AC A0A5J9WB45.1
#=GS A0A151IQ35_9HYME/17-113     AC A0A151IQ35.1
#=GS A0A6J3D7H0_AYTFU/17-114     AC A0A6J3D7H0.1
#=GS A0A1E1LDV2_9HELO/21-110     AC A0A1E1LDV2.1
#=GS A0A0E0IXY5_ORYNI/749-833    AC A0A0E0IXY5.1
#=GS F1MH76_BOVIN/32-129         AC F1MH76.2
#=GS A0A1S2XND4_CICAR/234-320    AC A0A1S2XND4.1
#=GS A0A1U8AJ68_NELNU/21-109     AC A0A1U8AJ68.1
#=GS A0A5N6DNY9_ASPPA/229-312    AC A0A5N6DNY9.1
#=GS A0A196SCN4_BLAHN/27-112     AC A0A196SCN4.1
#=GS A0A0V1AEA5_9BILA/22-118     AC A0A0V1AEA5.1
#=GS L0B229_THEEQ/32-114         AC L0B229.1
#=GS A0A081CL76_PSEA2/230-312    AC A0A081CL76.1
#=GS V9FK70_PHYPR/17-107         AC V9FK70.1
#=GS A0A2G9HT09_9LAMI/234-320    AC A0A2G9HT09.1
#=GS A0A2K1QUB8_9PEZI/17-110     AC A0A2K1QUB8.1
#=GS A0A6P6AJM7_DURZI/234-319    AC A0A6P6AJM7.1
#=GS A0A1E3I367_9TREE/20-107     AC A0A1E3I367.1
#=GS A0A1S7HK61_9SACH/16-104     AC A0A1S7HK61.1
#=GS A2YQN3_ORYSI/21-109         AC A2YQN3.1
#=GS A0A1R3JFZ4_COCAP/24-118     AC A0A1R3JFZ4.1
#=GS A0A177UL10_9BASI/21-108     AC A0A177UL10.1
#=GS A0A4P1QX93_LUPAN/21-96      AC A0A4P1QX93.1
#=GS Q8MZJ7_PLABA/231-314        AC Q8MZJ7.1
#=GS A0A0G2E143_9EURO/229-313    AC A0A0G2E143.1
#=GS A0A225AMX8_9EURO/17-110     AC A0A225AMX8.1
#=GS F6U184_CALJA/17-114         AC F6U184.1
#=GS A0A023B145_GRENI/22-108     AC A0A023B145.1
#=GS A0A0R3SKJ7_HYMDI/22-116     AC A0A0R3SKJ7.1
#=GS A0A0E0F293_9ORYZ/289-374    AC A0A0E0F293.1
#=GS A0A0L7LDY8_9NEOP/231-315    AC A0A0L7LDY8.1
#=GS A0A1L0C390_9ASCO/22-112     AC A0A1L0C390.1
#=GS A0A668RFC2_OREAU/17-117     AC A0A668RFC2.1
#=GS A0A1R3JRZ8_COCAP/17-90      AC A0A1R3JRZ8.1
#=GS Q8IIX0_PLAF7/32-117         AC Q8IIX0.1
#=GS I4Y734_WALMC/229-311        AC I4Y734.1
#=GS A0A0A0AS24_CHAVO/17-92      AC A0A0A0AS24.1
#=GS A0A0V1BPF0_TRISP/22-119     AC A0A0V1BPF0.1
#=GS A0A067MUE5_9AGAM/229-310    AC A0A067MUE5.1
#=GS A0A4Z1K0E1_9HELO/229-312    AC A0A4Z1K0E1.1
#=GS A0A2R6X1A3_MARPO/234-321    AC A0A2R6X1A3.1
#=GS A0A2I3G4D8_NOMLE/22-113     AC A0A2I3G4D8.1
#=GS A0A7H9B1I3_ZYGMR/20-106     AC A0A7H9B1I3.1
#=GS T1FSI2_HELRO/70-158         AC T1FSI2.1
#=GS B4FWI0_MAIZE/234-317        AC B4FWI0.1
#=GS A0A6J1J1Z8_CUCMA/17-113     AC A0A6J1J1Z8.1
#=GS A0A0A1U0R6_ENTIV/16-107     AC A0A0A1U0R6.1
#=GS A0A137PHB4_CONC2/22-107     AC A0A137PHB4.1
#=GS A0A1D6LNJ7_MAIZE/40-119     AC A0A1D6LNJ7.1
#=GS A0A5D3DB57_CUCME/21-112     AC A0A5D3DB57.1
#=GS R7UP78_CAPTE/17-109         AC R7UP78.1
#=GS G3GZV3_CRIGR/17-104         AC G3GZV3.1
#=GS A0A1B9IQN4_9TREE/229-312    AC A0A1B9IQN4.1
#=GS A0A0D2C1Z2_9EURO/229-313    AC A0A0D2C1Z2.1
#=GS F4B473_ACIHW/16-104         AC F4B473.1
#=GS A0A1Y2V482_9PEZI/17-110     AC A0A1Y2V482.1
#=GS A0A1X0S425_RHIZD/20-103     AC A0A1X0S425.1
#=GS A0A0D3AEY7_BRAOL/233-320    AC A0A0D3AEY7.1
#=GS A0A1L7WCX0_9HELO/229-313    AC A0A1L7WCX0.1
#=GS J3MHB1_ORYBR/13-118         AC J3MHB1.1
#=GS A0A0L9TFC9_PHAAN/21-111     AC A0A0L9TFC9.1
#=GS A0A3Q2HW44_HORSE/23-107     AC A0A3Q2HW44.1
#=GS A0A673UQN4_SURSU/169-254    AC A0A673UQN4.1
#=GS A0A061DE94_BABBI/1-50       AC A0A061DE94.1
#=GS A2FVM1_TRIVA/233-315        AC A2FVM1.1
#=GS A0A671K772_9TELE/17-115     AC A0A671K772.1
#=GS A0A194S3Y8_RHOGW/17-108     AC A0A194S3Y8.1
#=GS A0A166DWS0_9AGAM/17-111     AC A0A166DWS0.1
#=GS A0A6G0Z7G7_APHCR/231-313    AC A0A6G0Z7G7.1
#=GS A0A7H9HQ22_9SACH/19-105     AC A0A7H9HQ22.1
#=GS S7MT67_MYOBR/46-137         AC S7MT67.1
#=GS A0A5N5LI89_9ROSI/17-112     AC A0A5N5LI89.1
#=GS A0A2N6NGL3_BEABA/17-110     AC A0A2N6NGL3.1
#=GS A0A367K9D8_RHIST/20-102     AC A0A367K9D8.1
#=GS L5M5Z6_MYODS/22-113         AC L5M5Z6.1
#=GS A0CMI6_PARTE/34-121         AC A0CMI6.1
#=GS A0A2P5YBR6_GOSBA/234-320    AC A0A2P5YBR6.1
#=GS A0A5J9W690_9POAL/234-318    AC A0A5J9W690.1
#=GS B2W137_PYRTR/21-111         AC B2W137.1
#=GS A0A2H0ZNE1_CANAR/17-110     AC A0A2H0ZNE1.1
#=GS A0A2A4J9D4_HELVI/231-314    AC A0A2A4J9D4.1
#=GS A0A168N9Z6_MUCCL/17-105     AC A0A168N9Z6.1
#=GS A0A0B2R6U0_GLYSO/17-110     AC A0A0B2R6U0.1
#=GS A0A1E4RQH5_9ASCO/20-107     AC A0A1E4RQH5.1
#=GS A0A6D2KHM1_9BRAS/533-629    AC A0A6D2KHM1.1
#=GS A0A179V3C1_BLAGS/229-311    AC A0A179V3C1.1
#=GS A0A3B6JES4_WHEAT/235-320    AC A0A3B6JES4.1
#=GS A0A1W0E439_9MICR/45-128     AC A0A1W0E439.1
#=GS A0A0L0SP47_ALLM3/22-108     AC A0A0L0SP47.1
#=GS A0A498S632_ACAVI/17-112     AC A0A498S632.1
#=GS A0A3F3PMU9_9EURO/229-311    AC A0A3F3PMU9.1
#=GS A0A2K6MS92_RHIBE/8-101      AC A0A2K6MS92.1
#=GS S7Q4E7_GLOTA/229-311        AC S7Q4E7.1
#=GS A0A443HZM5_BYSSP/17-109     AC A0A443HZM5.1
#=GS A0A0V1AEJ0_9BILA/22-112     AC A0A0V1AEJ0.1
#=GS A0A314UQ16_PRUYE/75-171     AC A0A314UQ16.1
#=GS A0A0C3F7P0_PILCF/21-110     AC A0A0C3F7P0.1
#=GS H2LZD7_ORYLA/207-290        AC H2LZD7.2
#=GS A3LX37_PICST/20-107         AC A3LX37.1
#=GS A0A068V0G2_COFCA/234-319    AC A0A068V0G2.1
#=GS A0A022RIN3_ERYGU/16-121     AC A0A022RIN3.1
#=GS M0SDS5_MUSAM/22-112         AC M0SDS5.1
#=GS A0A100I3T1_ASPNG/229-311    AC A0A100I3T1.1
#=GS A0A4W2DNI3_BOBOX/22-113     AC A0A4W2DNI3.1
#=GS A0A133UM47_9EURY/1-73       AC A0A133UM47.1
#=GS A0A2H3BGV2_9AGAR/21-109     AC A0A2H3BGV2.1
#=GS A0A1S2YDT8_CICAR/21-111     AC A0A1S2YDT8.1
#=GS A0A6I9JX31_CHRAS/22-113     AC A0A6I9JX31.1
#=GS A0A5N5ICX0_9ROSA/11-99      AC A0A5N5ICX0.1
#=GS A0A5A7QL29_STRAF/17-119     AC A0A5A7QL29.1
#=GS A0A1E3PMU6_9ASCO/17-61      AC A0A1E3PMU6.1
#=GS A0A1X2HD90_SYNRA/20-106     AC A0A1X2HD90.1
#=GS A0A4U5M0M9_STECR/231-312    AC A0A4U5M0M9.1
#=GS S7W8T3_SPRLO/16-102         AC S7W8T3.1
#=GS A0A4S2L8Y5_9HYME/56-151     AC A0A4S2L8Y5.1
#=GS S7NST8_MYOBR/31-118         AC S7NST8.1
#=GS A0A1U8K031_GOSHI/22-113     AC A0A1U8K031.1
#=GS A0A0C9YM38_9AGAR/17-111     AC A0A0C9YM38.1
#=GS A0A238F6L2_9BASI/17-110     AC A0A238F6L2.1
#=GS Q8II61_PLAF7/231-315        AC Q8II61.1
#=GS RLA3_MAIZE/61-119           AC O24413.3
#=GS A0A1E5RPD8_HANUV/16-104     AC A0A1E5RPD8.1
#=GS A0A0Q4BHZ0_9ARCH/16-101     AC A0A0Q4BHZ0.1
#=GS A0A074YMA1_AURPU/21-107     AC A0A074YMA1.1
#=GS A0A4W6EWR9_LATCA/17-93      AC A0A4W6EWR9.1
#=GS A0A2V2N2W7_9EURY/10-102     AC A0A2V2N2W7.1
#=GS A0A1I6KSV4_9EURY/16-113     AC A0A1I6KSV4.1
#=GS A0A452GT84_9SAUR/17-112     AC A0A452GT84.1
#=GS A0A3B5YZL3_WHEAT/17-111     AC A0A3B5YZL3.1
#=GS G7JC94_MEDTR/234-320        AC G7JC94.1
#=GS A0A422N347_9TRYP/121-208    AC A0A422N347.1
#=GS A0A5D2YLT5_GOSMU/22-113     AC A0A5D2YLT5.1
#=GS A0A078I6E4_BRANA/233-320    AC A0A078I6E4.1
#=GS A0A0E0PN70_ORYRU/17-112     AC A0A0E0PN70.1
#=GS A0A261CDM3_9PELO/231-311    AC A0A261CDM3.1
#=GS A0A4W4DWS4_ELEEL/231-316    AC A0A4W4DWS4.1
#=GS A0A2G2VQP1_CAPBA/17-111     AC A0A2G2VQP1.1
#=GS A0A2P8AI13_9PEZI/229-313    AC A0A2P8AI13.1
#=GS A0A133UQP3_9EURY/16-56      AC A0A133UQP3.1
#=GS G8YUR0_PICSO/20-105         AC G8YUR0.1
#=GS A0A1D2M8R4_ORCCI/23-116     AC A0A1D2M8R4.1
#=GS A0A1V9XA52_9ACAR/22-109     AC A0A1V9XA52.1
#=GS A0A0C3JF45_PISTI/17-111     AC A0A0C3JF45.1
#=GS A0A1V8SYB1_9PEZI/17-112     AC A0A1V8SYB1.1
#=GS S7PBN4_MYOBR/33-122         AC S7PBN4.1
#=GS A0A368GSK4_ANCCA/248-339    AC A0A368GSK4.1
#=GS A0A4S2N5E4_9PEZI/228-307    AC A0A4S2N5E4.1
#=GS A0A068U9L3_COFCA/21-112     AC A0A068U9L3.1
#=GS A0A0G2H8J9_9EURO/17-109     AC A0A0G2H8J9.1
#=GS A0A5N6UCN3_9EURO/229-312    AC A0A5N6UCN3.1
#=GS A0A0R3X8C1_HYDTA/80-120     AC A0A0R3X8C1.1
#=GS RLA1_MOUSE/22-113           AC P47955.1
#=GS A0A2V1ATV8_9ASCO/20-107     AC A0A2V1ATV8.1
#=GS A0A094F6H5_9PEZI/229-309    AC A0A094F6H5.1
#=GS A0A5F8H161_MONDO/17-73      AC A0A5F8H161.1
#=GS A0A166NB92_EXIGL/17-111     AC A0A166NB92.1
#=GS A0A1Y1X8M2_9FUNG/21-106     AC A0A1Y1X8M2.1
#=GS A0A074SSC8_9AGAM/17-113     AC A0A074SSC8.1
#=GS A0A5J5MPM2_MUNRE/22-113     AC A0A5J5MPM2.1
#=GS Q4D4B9_TRYCC/26-114         AC Q4D4B9.1
#=GS A0A6J3RK69_TURTR/22-113     AC A0A6J3RK69.1
#=GS A0A1B8ELM9_9PEZI/229-311    AC A0A1B8ELM9.1
#=GS M4EA18_BRARP/15-83          AC M4EA18.1
#=GS A0A2I3SYL8_PANTR/231-316    AC A0A2I3SYL8.1
#=GS A0A7D8V354_9TREE/229-311    AC A0A7D8V354.1
#=GS A0A6P4YZ83_BRABE/231-312    AC A0A6P4YZ83.1
#=GS L5M6N6_MYODS/28-119         AC L5M6N6.1
#=GS A0A133V725_9EURY/16-100     AC A0A133V725.1
#=GS F2SUF2_TRIRC/55-136         AC F2SUF2.2
#=GS A0A3M9VVR6_9EURY/16-109     AC A0A3M9VVR6.1
#=GS A0A4Q2DND4_9AGAR/229-310    AC A0A4Q2DND4.1
#=GS A0A6P3WS87_DINQU/231-315    AC A0A6P3WS87.1
#=GS S7N152_MYOBR/231-316        AC S7N152.1
#=GS I1CVJ5_RHIO9/228-308        AC I1CVJ5.1
#=GS E2BW93_HARSA/231-315        AC E2BW93.1
#=GS A0A1L9X5F1_ASPA1/17-108     AC A0A1L9X5F1.1
#=GS A0A2V3JGU6_9EURY/16-120     AC A0A2V3JGU6.1
#=GS D4A4D5_RAT/17-114           AC D4A4D5.1
#=GS A0A2F0AVF9_ESCRO/22-79      AC A0A2F0AVF9.1
#=GS A0A553MVM9_9TELE/269-353    AC A0A553MVM9.1
#=GS A0A674N4X9_TAKRU/57-146     AC A0A674N4X9.1
#=GS A0A0K0ERM7_STRER/192-273    AC A0A0K0ERM7.1
#=GS A0A3B6IR18_WHEAT/225-310    AC A0A3B6IR18.1
#=GS A0A218XP16_PUNGR/15-119     AC A0A218XP16.1
#=GS A0A060W2U1_ONCMY/17-65      AC A0A060W2U1.1
#=GS A0A673TBL1_SURSU/17-114     AC A0A673TBL1.1
#=GS A8PH06_COPC7/948-1036       AC A8PH06.2
#=GS Q754C5_ASHGO/17-107         AC Q754C5.1
#=GS M1ABN6_SOLTU/17-115         AC M1ABN6.1
#=GS I2K134_DEKBR/19-107         AC I2K134.1
#=GS A0A4U1F9R3_MONMO/17-89      AC A0A4U1F9R3.1
#=GS A0A010RW72_9PEZI/21-108     AC A0A010RW72.1
#=GS A0A427Y2N1_9TREE/20-109     AC A0A427Y2N1.1
#=GS A0A545V0T2_9HYPO/21-107     AC A0A545V0T2.1
#=GS A0A0V0SKA9_9BILA/22-112     AC A0A0V0SKA9.1
#=GS M3XMA1_MUSPF/22-113         AC M3XMA1.1
#=GS A0A3R7K9I3_9STRA/27-124     AC A0A3R7K9I3.1
#=GS A0A3P6UBD2_LITSI/21-113     AC A0A3P6UBD2.1
#=GS A0A5N6EHH1_9EURO/229-312    AC A0A5N6EHH1.1
#=GS T0LYU1_9ARCH/10-100         AC T0LYU1.1
#=GS A0A540LLU4_MALBA/21-110     AC A0A540LLU4.1
#=GS A0A3F3PYG7_9EURO/21-107     AC A0A3F3PYG7.1
#=GS A0A2Y9MGL0_DELLE/17-114     AC A0A2Y9MGL0.1
#=GS A0A3E2HM47_SCYLI/17-111     AC A0A3E2HM47.1
#=GS A0A1X2HQ76_SYNRA/21-108     AC A0A1X2HQ76.1
#=GS Q6PBJ9_DANRE/17-114         AC Q6PBJ9.1
#=GS A0A5N4E0Y7_CAMDR/142-204    AC A0A5N4E0Y7.1
#=GS A0A565CRJ2_9BRAS/17-113     AC A0A565CRJ2.1
#=GS A0A6J0BFL1_NEOLC/17-89      AC A0A6J0BFL1.1
#=GS A0A1S3LAA3_SALSA/192-275    AC A0A1S3LAA3.1
#=GS A0A0W4ZS34_PNEJ7/20-104     AC A0A0W4ZS34.1
#=GS A0A5N4BXR2_CAMDR/22-119     AC A0A5N4BXR2.1
#=GS A0A2P5I0L0_9PEZI/21-109     AC A0A2P5I0L0.1
#=GS S9VZJ3_SCHCR/229-308        AC S9VZJ3.1
#=GS A0A1S3GCH2_DIPOR/231-316    AC A0A1S3GCH2.1
#=GS A0A1U8PLU2_GOSHI/234-319    AC A0A1U8PLU2.1
#=GS A0A044SL55_ONCVO/231-319    AC A0A044SL55.1
#=GS G8BW19_TETPH/20-106         AC G8BW19.1
#=GS A0A6A4L2R3_9ERIC/56-146     AC A0A6A4L2R3.1
#=GS A0A1D2M106_ORCCI/23-97      AC A0A1D2M106.1
#=GS A0A7C8J530_9PEZI/229-311    AC A0A7C8J530.1
#=GS A0A2T3B8F9_AMORE/229-313    AC A0A2T3B8F9.1
#=GS A0A0D1EBT5_USTMA/21-108     AC A0A0D1EBT5.1
#=GS A0A5J4P266_9TREM/227-313    AC A0A5J4P266.1
#=GS V7BXT2_PHAVU/21-100         AC V7BXT2.1
#=GS A0A1U8M2Z4_GOSHI/17-113     AC A0A1U8M2Z4.1
#=GS K5W2Y3_PHACS/229-311        AC K5W2Y3.1
#=GS A0A7I4C164_PHYPA/21-107     AC A0A7I4C164.1
#=GS J7RTY6_KAZNA/20-106         AC J7RTY6.1
#=GS A0A672RF86_SINGR/228-312    AC A0A672RF86.1
#=GS A0A672HE48_SALFA/169-252    AC A0A672HE48.1
#=GS T0MSU0_9ARCH/16-100         AC T0MSU0.1
#=GS F4IGR3_ARATH/17-97          AC F4IGR3.1
#=GS A0A165TLM8_9APHY/229-313    AC A0A165TLM8.1
#=GS A0A1S3YXL9_TOBAC/234-318    AC A0A1S3YXL9.1
#=GS A0A2I3H6T9_NOMLE/196-264    AC A0A2I3H6T9.1
#=GS G3S7X2_GORGO/22-113         AC G3S7X2.2
#=GS A0A3N6RMQ4_BRACR/56-142     AC A0A3N6RMQ4.1
#=GS A0A2I3LPW8_PAPAN/169-254    AC A0A2I3LPW8.1
#=GS A0A6J5WGW3_PRUAR/21-109     AC A0A6J5WGW3.1
#=GS G8ZTC2_TORDC/229-311        AC G8ZTC2.1
#=GS A0A1E5RRC8_HANUV/20-105     AC A0A1E5RRC8.1
#=GS G1NVF5_MYOLU/24-113         AC G1NVF5.1
#=GS RLA2_ENCCU/16-103           AC Q8SRM2.1
#=GS M5WI07_PRUPE/16-118         AC M5WI07.1
#=GS A0A1U8JT39_GOSHI/17-112     AC A0A1U8JT39.1
#=GS A0A1V9Y5M2_9STRA/231-315    AC A0A1V9Y5M2.1
#=GS I0YL12_COCSC/37-118         AC I0YL12.1
#=GS K7MPL5_SOYBN/171-237        AC K7MPL5.1
#=GS A0A671TSZ7_SPAAU/17-87      AC A0A671TSZ7.1
#=GS V4LZ75_EUTSA/233-320        AC V4LZ75.1
#=GS A0A1E4T230_9ASCO/20-106     AC A0A1E4T230.1
#=GS A0A0E0L354_ORYPU/17-114     AC A0A0E0L354.1
#=GS A0A6S7M0P5_LACSI/565-662    AC A0A6S7M0P5.1
#=GS A0A163J8I6_ABSGL/17-109     AC A0A163J8I6.1
#=GS A0A0C2N9U2_THEKT/26-113     AC A0A0C2N9U2.1
#=GS G0NH49_CAEBE/17-107         AC G0NH49.1
#=GS Q8ZWM8_PYRAE/16-110         AC Q8ZWM8.1
#=GS D8T6P9_SELML/20-109         AC D8T6P9.1
#=GS C4IYY6_MAIZE/17-111         AC C4IYY6.1
#=GS A0A6A3NFB9_9STRA/59-147     AC A0A6A3NFB9.1
#=GS A0A068RJR1_9FUNG/20-106     AC A0A068RJR1.1
#=GS A0A2H2I833_CAEJA/22-110     AC A0A2H2I833.1
#=GS RLA1_YEAST/20-105           AC P05318.4
#=GS W4J152_PLAFP/32-117         AC W4J152.1
#=GS A0A3S3QZG6_9MAGN/234-318    AC A0A3S3QZG6.1
#=GS Q754A9_ASHGO/19-104         AC Q754A9.1
#=GS C3ZD79_BRAFL/22-108         AC C3ZD79.1
#=GS L5M929_MYODS/22-113         AC L5M929.1
#=GS A0A2K6BPL2_MACNE/182-269    AC A0A2K6BPL2.1
#=GS A0A3M0JYY3_HIRRU/239-325    AC A0A3M0JYY3.1
#=GS A0A0D3BUD3_BRAOL/17-113     AC A0A0D3BUD3.1
#=GS A0A6I9KBN4_CHRAS/18-88      AC A0A6I9KBN4.1
#=GS A0A498IZ74_MALDO/17-116     AC A0A498IZ74.1
#=GS A0A6P5Y060_DURZI/22-114     AC A0A6P5Y060.1
#=GS A0A2R6T886_9ARCH/16-106     AC A0A2R6T886.1
#=GS B2B826_PODAN/21-109         AC B2B826.1
#=GS A0A4Z0A4D0_9AGAM/229-311    AC A0A4Z0A4D0.1
#=GS F6GUT3_VITVI/220-303        AC F6GUT3.1
#=GS A0A0G4MN03_9PEZI/22-114     AC A0A0G4MN03.1
#=GS A0A452SQC0_URSAM/22-113     AC A0A452SQC0.1
#=GS Q6P699_XENLA/22-112         AC Q6P699.1
#=GS S8DMC0_9LAMI/50-136         AC S8DMC0.1
#=GS A0A3Q3GXG8_9LABR/22-112     AC A0A3Q3GXG8.1
#=GS A0A6I9W5H2_9HYME/231-317    AC A0A6I9W5H2.1
#=GS A0A5J4ZG48_9ASTE/475-548    AC A0A5J4ZG48.1
#=GS RLA23_ARATH/17-114          AC Q9LH85.1
#=GS A0A671TJZ8_SPAAU/231-315    AC A0A671TJZ8.1
#=GS A0A316YG85_9BASI/16-111     AC A0A316YG85.1
#=GS L2GSK8_VAVCU/16-100         AC L2GSK8.1
#=GS I1CK49_RHIO9/20-105         AC I1CK49.1
#=GS A0A670XWX7_PSETE/17-113     AC A0A670XWX7.1
#=GS A0A0B2WQL5_METAS/229-311    AC A0A0B2WQL5.1
#=GS K0KKH2_WICCF/17-108         AC K0KKH2.1
#=GS A0A067E8D7_CITSI/8-79       AC A0A067E8D7.1
#=GS A0A452IC52_9SAUR/17-111     AC A0A452IC52.1
#=GS A0A162AYP0_DAUCS/21-109     AC A0A162AYP0.1
#=GS Q4CPY1_TRYCC/26-114         AC Q4CPY1.1
#=GS A0A6A5NX97_LUPAL/234-320    AC A0A6A5NX97.1
#=GS A0A109FIC0_9BASI/21-107     AC A0A109FIC0.1
#=GS A0A1X0P2R9_9TRYP/16-104     AC A0A1X0P2R9.1
#=GS T0LF15_9ARCH/16-102         AC T0LF15.1
#=GS A0A4S8IY13_MUSBA/3-74       AC A0A4S8IY13.1
#=GS A0A6A3MQG2_9STRA/27-113     AC A0A6A3MQG2.1
#=GS A0A6J0MYP8_RAPSA/17-112     AC A0A6J0MYP8.1
#=GS A0A4U6XIY4_9PEZI/17-109     AC A0A4U6XIY4.1
#=GS A0A1S3C0X1_CUCME/21-107     AC A0A1S3C0X1.1
#=GS A0A5C5FTN3_9BASI/17-108     AC A0A5C5FTN3.1
#=GS G8BV04_TETPH/229-313        AC G8BV04.1
#=GS J9P0A3_CANLF/22-113         AC J9P0A3.1
#=GS M0RED7_MUSAM/164-247        AC M0RED7.1
#=GS A0A2K5X705_MACFA/18-88      AC A0A2K5X705.1
#=GS B6JXU8_SCHJY/21-107         AC B6JXU8.1
#=GS Q28IA8_XENTR/22-112         AC Q28IA8.1
#=GS A0A1M5SGQ3_9EURY/16-115     AC A0A1M5SGQ3.1
#=GS A0A023EQJ9_AEDAL/231-314    AC A0A023EQJ9.1
#=GS A0A4W5PCF7_9TELE/17-111     AC A0A4W5PCF7.1
#=GS A0A507CUS2_9FUNG/262-345    AC A0A507CUS2.1
#=GS A0A423W3I8_9PEZI/17-109     AC A0A423W3I8.1
#=GS A0A5M9JW84_MONFR/99-189     AC A0A5M9JW84.1
#=GS A0A4Q4YLS1_9PEZI/21-110     AC A0A4Q4YLS1.1
#=GS W9Y0B7_9EURO/21-111         AC W9Y0B7.1
#=GS A0A5A8CXJ1_CAFRO/31-112     AC A0A5A8CXJ1.1
#=GS F0Y4H4_AURAN/17-106         AC F0Y4H4.1
#=GS A0A1Y2BTF4_9FUNG/23-109     AC A0A1Y2BTF4.1
#=GS A0A5C3F034_9BASI/229-313    AC A0A5C3F034.1
#=GS A0BSK2_PARTE/34-121         AC A0BSK2.1
#=GS E3K826_PUCGT/229-311        AC E3K826.2
#=GS A0A4W5QIZ6_9TELE/22-110     AC A0A4W5QIZ6.1
#=GS A0A1X0NVF0_9TRYP/18-110     AC A0A1X0NVF0.1
#=GS A0A6B0SPD3_9EURY/16-111     AC A0A6B0SPD3.1
#=GS A0A6G0U0G0_APHGL/231-313    AC A0A6G0U0G0.1
#=GS A0A6J3H9C3_SAPAP/17-113     AC A0A6J3H9C3.1
#=GS G8YLE4_PICSO/17-107         AC G8YLE4.1
#=GS A0A5C7GWM0_9ROSI/34-121     AC A0A5C7GWM0.1
#=GS A0A5N3X7C6_MUNRE/231-317    AC A0A5N3X7C6.1
#=GS A0A5N6SM53_ASPPS/17-108     AC A0A5N6SM53.1
#=GS A0A3M6Y355_HORWE/17-110     AC A0A3M6Y355.1
#=GS A0A6P6G0T5_ZIZJJ/234-317    AC A0A6P6G0T5.1
#=GS A0A0F4Z5T7_TALEM/17-109     AC A0A0F4Z5T7.1
#=GS A0A066XKX5_COLSU/17-109     AC A0A066XKX5.1
#=GS A0A1D8PTS0_CANAL/17-107     AC A0A1D8PTS0.1
#=GS A0A482W3T2_9CUCU/22-109     AC A0A482W3T2.1
#=GS A0A0K9PHD8_ZOSMR/1-59       AC A0A0K9PHD8.1
#=GS A0A316VNV0_9BASI/20-109     AC A0A316VNV0.1
#=GS A0A4D8YF65_SALSN/20-116     AC A0A4D8YF65.1
#=GS A0A287DVN5_HORVV/17-65      AC A0A287DVN5.1
#=GS A0A2G8RZW0_9APHY/21-109     AC A0A2G8RZW0.1
#=GS A0A1D2VMW4_9ASCO/17-111     AC A0A1D2VMW4.1
#=GS A0A0D2TAV8_GOSRA/17-119     AC A0A0D2TAV8.1
#=GS A0A210QLF9_MIZYE/231-313    AC A0A210QLF9.1
#=GS A0A5N7B464_9EURO/229-312    AC A0A5N7B464.1
#=GS A0A1E4TEH8_9ASCO/229-312    AC A0A1E4TEH8.1
#=GS A0A194V1X1_9PEZI/17-109     AC A0A194V1X1.1
#=GS A0A1E3PJJ4_9ASCO/19-105     AC A0A1E3PJJ4.1
#=GS A0A1V9ZUV4_9STRA/17-107     AC A0A1V9ZUV4.1
#=GS G8BZ00_TETPH/17-109         AC G8BZ00.1
#=GS A0A484BU39_DRONA/231-316    AC A0A484BU39.1
#=GS A5DLA6_PICGU/20-104         AC A5DLA6.1
#=GS V4T6T5_CITCL/234-318        AC V4T6T5.1
#=GS A0A087SAV4_AUXPR/21-62      AC A0A087SAV4.1
#=GS A0A0V0VGT8_9BILA/22-112     AC A0A0V0VGT8.1
#=GS A0A4W5NC37_9TELE/65-144     AC A0A4W5NC37.1
#=GS A0A267FS32_9PLAT/231-314    AC A0A267FS32.1
#=GS A0A5C3KL12_9AGAR/21-107     AC A0A5C3KL12.1
#=GS A0A2K5EPH2_AOTNA/185-248    AC A0A2K5EPH2.1
#=GS A0A1U8LK33_GOSHI/17-113     AC A0A1U8LK33.1
#=GS A0A1S2Z4H3_CICAR/21-107     AC A0A1S2Z4H3.1
#=GS D8R8E7_SELML/234-319        AC D8R8E7.1
#=GS A0A067LNR8_JATCU/234-318    AC A0A067LNR8.1
#=GS A0A2K6F359_PROCO/169-255    AC A0A2K6F359.1
#=GS H6BU64_EXODN/21-112         AC H6BU64.1
#=GS A0A4P1R9S0_LUPAN/17-111     AC A0A4P1R9S0.1
#=GS A0A091HAZ8_BUCRH/17-114     AC A0A091HAZ8.1
#=GS F0XY67_AURAN/34-111         AC F0XY67.1
#=GS A0A2I1CMH8_ASPN1/17-109     AC A0A2I1CMH8.1
#=GS A0A1U7RP91_ALLSI/22-112     AC A0A1U7RP91.1
#=GS A0A6A2ZT64_HIBSY/23-113     AC A0A6A2ZT64.1
#=GS Q4UE75_THEAN/19-109         AC Q4UE75.1
#=GS A0A565BZZ5_9BRAS/22-113     AC A0A565BZZ5.1
#=GS A0A0N4T4L2_BRUPA/244-324    AC A0A0N4T4L2.1
#=GS A0A6J2WGH5_CHACN/18-85      AC A0A6J2WGH5.1
#=GS A0A133UTM5_9EURY/16-56      AC A0A133UTM5.1
#=GS A0A5B6V7Q7_9ROSI/17-113     AC A0A5B6V7Q7.1
#=GS M9PBK5_DROME/22-111         AC M9PBK5.1
#=GS A0A484DGZ5_PERFV/36-125     AC A0A484DGZ5.1
#=GS A0A0N1P224_9EURO/229-314    AC A0A0N1P224.1
#=GS A0A672F7W9_SALFA/17-114     AC A0A672F7W9.1
#=GS A0A0K9PVD0_ZOSMR/17-109     AC A0A0K9PVD0.1
#=GS A0A3F2RXS7_9STRA/29-111     AC A0A3F2RXS7.1
#=GS B6SIT5_MAIZE/17-112         AC B6SIT5.1
#=GS A0A2K5KWH4_CERAT/22-110     AC A0A2K5KWH4.1
#=GS A0A0P7BL39_9HYPO/17-109     AC A0A0P7BL39.1
#=GS A0A0S4JKG7_BODSA/23-108     AC A0A0S4JKG7.1
#=GS A0A0D2AN11_9PEZI/17-112     AC A0A0D2AN11.1
#=GS A0A1B9I520_9TREE/229-311    AC A0A1B9I520.1
#=GS A0A094AX03_9PEZI/44-121     AC A0A094AX03.1
#=GS M1V6L3_CYAM1/230-322        AC M1V6L3.1
#=GS A0A540KUP5_MALBA/17-114     AC A0A540KUP5.1
#=GS A0A2I4BAI9_9TELE/22-113     AC A0A2I4BAI9.1
#=GS A0A5E8C6D7_9ASCO/21-112     AC A0A5E8C6D7.1
#=GS A0A1U7YQR0_NICSY/86-173     AC A0A1U7YQR0.1
#=GS A0A2R6XPV6_MARPO/50-122     AC A0A2R6XPV6.1
#=GS A0A1U8BF93_NELNU/17-113     AC A0A1U8BF93.1
#=GS A0A1U7Z297_NELNU/17-115     AC A0A1U7Z297.1
#=GS A0A6A6YNE7_9PEZI/21-110     AC A0A6A6YNE7.1
#=GS A0A212DBR7_CEREH/22-68      AC A0A212DBR7.1
#=GS A0A0U5FW20_9EURO/17-108     AC A0A0U5FW20.1
#=GS A0A2P5CYK2_PARAD/29-118     AC A0A2P5CYK2.1
#=GS A0A1E4TVQ4_PACTA/16-109     AC A0A1E4TVQ4.1
#=GS R0KLL1_NOSB1/25-106         AC R0KLL1.1
#=GS A0A2H3JZ74_WOLCO/17-111     AC A0A2H3JZ74.1
#=GS A0A067REX0_ZOONE/17-116     AC A0A067REX0.1
#=GS A0A0F8BWR6_CERFI/17-107     AC A0A0F8BWR6.1
#=GS D2VHP6_NAEGR/17-106         AC D2VHP6.1
#=GS A0A1Y2I6Z1_PYCCO/21-109     AC A0A1Y2I6Z1.1
#=GS A0A1D2VPN0_9ASCO/229-310    AC A0A1D2VPN0.1
#=GS Q7SGE3_NEUCR/17-109         AC Q7SGE3.1
#=GS S3CZH8_OPHP1/229-310        AC S3CZH8.1
#=GS A0A672ZFX0_9TELE/17-115     AC A0A672ZFX0.1
#=GS V5BL26_TRYCR/241-326        AC V5BL26.1
#=GS A0A0M3JSL1_ANISI/29-120     AC A0A0M3JSL1.1
#=GS A0A6J5X046_PRUAR/21-109     AC A0A6J5X046.1
#=GS A0A6J2G127_9PASS/22-113     AC A0A6J2G127.1
#=GS A0A0E0R3U7_ORYRU/610-695    AC A0A0E0R3U7.1
#=GS A0A3P8WC15_CYNSE/17-106     AC A0A3P8WC15.1
#=GS G2Q3A8_MYCTT/17-111         AC G2Q3A8.1
#=GS A0A2I4HSP5_JUGRE/21-109     AC A0A2I4HSP5.1
#=GS A0A2G3D260_CAPCH/22-113     AC A0A2G3D260.1
#=GS A0A3Q2WHC9_HAPBU/22-113     AC A0A3Q2WHC9.1
#=GS A0A2Y9DR60_TRIMA/231-317    AC A0A2Y9DR60.1
#=GS A0A2K5TWN9_MACFA/154-239    AC A0A2K5TWN9.2
#=GS A0A6P3V893_OCTDE/1-78       AC A0A6P3V893.1
#=GS A0A3Q4HFT8_NEOBR/231-313    AC A0A3Q4HFT8.1
#=GS A0A348B309_9CREN/16-102     AC A0A348B309.1
#=GS A0A238BXA4_9BILA/18-117     AC A0A238BXA4.1
#=GS A0A103P899_CYNCS/114-201    AC A0A103P899.1
#=GS A0A1S4AZ85_TOBAC/21-110     AC A0A1S4AZ85.1
#=GS A0A3Q1IEG2_ANATE/17-114     AC A0A3Q1IEG2.1
#=GS A0A341CUN6_NEOAA/22-113     AC A0A341CUN6.1
#=GS A0A3S3Q1A7_9ACAR/22-113     AC A0A3S3Q1A7.1
#=GS Q6BSI9_DEBHA/20-105         AC Q6BSI9.1
#=GS A0A4U7FBS4_9EURY/16-113     AC A0A4U7FBS4.1
#=GS A0A077Z107_TRITR/35-123     AC A0A077Z107.1
#=GS T0K4W9_COLGC/229-310        AC T0K4W9.1
#=GS A0A2Y9G2W1_NEOSC/17-114     AC A0A2Y9G2W1.1
#=GS Q586I4_TRYB2/16-106         AC Q586I4.1
#=GS V4LS34_EUTSA/34-120         AC V4LS34.1
#=GS A0A167NQL5_PHYB8/17-106     AC A0A167NQL5.1
#=GS F7EED9_MONDO/21-114         AC F7EED9.2
#=GS E3LVY9_CAERE/231-311        AC E3LVY9.1
#=GS A0A1X0P9L8_9TRYP/26-115     AC A0A1X0P9L8.1
#=GS A0A444FDP2_ENSVE/203-290    AC A0A444FDP2.1
#=GS M4FD84_BRARP/17-112         AC M4FD84.1
#=GS A0A087H8R3_ARAAL/233-321    AC A0A087H8R3.1
#=GS A0A4Z1J8Z2_9HELO/21-109     AC A0A4Z1J8Z2.1
#=GS G3YEG4_ASPNA/21-107         AC G3YEG4.1
#=GS W2QGN3_PHYPN/17-107         AC W2QGN3.1
#=GS A0A0V1LS45_9BILA/22-112     AC A0A0V1LS45.1
#=GS A0A2R6RSF3_ACTCC/22-111     AC A0A2R6RSF3.1
#=GS I1KB09_SOYBN/21-94          AC I1KB09.1
#=GS S4R8C1_PETMA/30-117         AC S4R8C1.1
#=GS A0A2K3L3M2_TRIPR/33-118     AC A0A2K3L3M2.1
#=GS M4B6X6_HYAAE/29-112         AC M4B6X6.1
#=GS A0A0R3W4L0_TAEAS/22-118     AC A0A0R3W4L0.1
#=GS A0A4V1IUV4_9FUNG/231-311    AC A0A4V1IUV4.1
#=GS A0A2Z7A0C0_9LAMI/27-110     AC A0A2Z7A0C0.1
#=GS A0A0U5GFZ4_9EURO/17-113     AC A0A0U5GFZ4.1
#=GS F0VPW1_NEOCL/232-310        AC F0VPW1.1
#=GS A0A178EKG0_9PLEO/17-110     AC A0A178EKG0.1
#=GS A0A1G4J1X5_9SACH/229-309    AC A0A1G4J1X5.1
#=GS M3IJZ2_CANMX/20-105         AC M3IJZ2.1
#=GS A0A372R9C9_9GLOM/16-110     AC A0A372R9C9.1
#=GS RLA1_RAT/22-113             AC P19944.1
#=GS Q38BQ9_TRYB2/26-113         AC Q38BQ9.1
#=GS D0MXQ7_PHYIT/29-111         AC D0MXQ7.1
#=GS A0A1Y1ZWG9_9PLEO/229-314    AC A0A1Y1ZWG9.1
#=GS A0A0E0MJB9_ORYPU/614-697    AC A0A0E0MJB9.1
#=GS W2PYA7_PHYPN/29-111         AC W2PYA7.1
#=GS A0A3Q0ECK3_CARSF/811-900    AC A0A3Q0ECK3.1
#=GS A0A1Y1XQ87_9FUNG/228-310    AC A0A1Y1XQ87.1
#=GS G3TUC7_LOXAF/231-299        AC G3TUC7.1
#=GS A0A6I9JYB5_CHRAS/18-88      AC A0A6I9JYB5.1
#=GS U1HYS7_ENDPU/21-112         AC U1HYS7.1
#=GS W7HS07_9PEZI/17-111         AC W7HS07.1
#=GS G3P132_GASAC/231-315        AC G3P132.1
#=GS A0A6A1QBR1_BALPH/33-104     AC A0A6A1QBR1.1
#=GS A0A0P7GR51_9EURY/16-109     AC A0A0P7GR51.1
#=GS A0A4Y7L215_PAPSO/17-112     AC A0A4Y7L215.1
#=GS A0A1B8DEF1_9PEZI/229-311    AC A0A1B8DEF1.1
#=GS A0A199UTC7_ANACO/64-122     AC A0A199UTC7.1
#=GS A0A540NIN8_MALBA/21-109     AC A0A540NIN8.1
#=GS A0A2I0VJI9_9ASPA/17-114     AC A0A2I0VJI9.1
#=GS A0A0C3DCU0_9AGAM/21-132     AC A0A0C3DCU0.1
#=GS K1X998_MARBU/229-312        AC K1X998.1
#=GS B6K1E5_SCHJY/17-110         AC B6K1E5.1
#=GS A0A6A4W9Z0_AMPAM/211-291    AC A0A6A4W9Z0.1
#=GS Q6H764_ORYSJ/17-112         AC Q6H764.1
#=GS A0A5N5MIV9_9PEZI/21-110     AC A0A5N5MIV9.1
#=GS A0A078GKJ9_BRANA/23-120     AC A0A078GKJ9.1
#=GS A0A2R9AAE7_PANPA/231-316    AC A0A2R9AAE7.1
#=GS L8IG74_9CETA/17-92          AC L8IG74.1
#=GS A0A4S2N4G4_9PEZI/21-109     AC A0A4S2N4G4.1
#=GS A0A2R8MFB6_CALJA/218-299    AC A0A2R8MFB6.1
#=GS A0A5N4E0Y7_CAMDR/26-125     AC A0A5N4E0Y7.1
#=GS A0A0D3GQT8_9ORYZ/17-107     AC A0A0D3GQT8.1
#=GS A0A168KLH5_MUCCL/18-77      AC A0A168KLH5.1
#=GS A0A1S3EUC2_DIPOR/22-113     AC A0A1S3EUC2.1
#=GS A0A2I2Y879_GORGO/17-104     AC A0A2I2Y879.1
#=GS A0A1Q8RVR3_9PEZI/229-311    AC A0A1Q8RVR3.1
#=GS M5GG71_DACPD/229-314        AC M5GG71.1
#=GS A0A178F681_TRIRU/229-310    AC A0A178F681.1
#=GS A0A0D2DFZ1_9EURO/231-315    AC A0A0D2DFZ1.1
#=GS A0A0H5C2Z7_CYBJN/48-138     AC A0A0H5C2Z7.1
#=GS A0A1V6Y3Z3_PENNA/21-106     AC A0A1V6Y3Z3.1
#=GS A0A1W3JEY8_CIOIN/231-310    AC A0A1W3JEY8.1
#=GS A0A2K5KIF9_CERAT/16-91      AC A0A2K5KIF9.1
#=GS A0A3Q7HH02_SOLLC/234-320    AC A0A3Q7HH02.1
#=GS A0A5E4B4L6_MARMO/22-113     AC A0A5E4B4L6.1
#=GS A0A165QIZ8_EXIGL/229-312    AC A0A165QIZ8.1
#=GS A0A210Q0V0_MIZYE/17-109     AC A0A210Q0V0.1
#=GS A0A0L7KA06_PLAFX/231-315    AC A0A0L7KA06.1
#=GS A9PF35_POPTR/234-319        AC A9PF35.1
#=GS Q6M0L2_METMP/16-98          AC Q6M0L2.1
#=GS D6GVC7_PARA5/16-97          AC D6GVC7.1
#=GS B0F9S0_TRISP/22-112         AC B0F9S0.1
#=GS A0A650A612_9EURY/16-114     AC A0A650A612.1
#=GS A0A448ZIL9_9STRA/17-106     AC A0A448ZIL9.1
#=GS A0A0E0QDL9_ORYRU/21-109     AC A0A0E0QDL9.1
#=GS A0A444Z788_ARAHY/17-112     AC A0A444Z788.1
#=GS A0A540M6Z4_MALBA/21-111     AC A0A540M6Z4.1
#=GS A0A167PNH9_CORFA/21-107     AC A0A167PNH9.1
#=GS A0A4X2LJ11_VOMUR/21-114     AC A0A4X2LJ11.1
#=GS A2R7V9_ASPNC/17-109         AC A2R7V9.1
#=GS A0A328E1G9_9ASTE/21-110     AC A0A328E1G9.1
#=GS A0A7E4RI27_CIMLE/231-316    AC A0A7E4RI27.1
#=GS A0A261BGB9_9PELO/17-110     AC A0A261BGB9.1
#=GS A0A0S3SGX8_PHAAN/17-112     AC A0A0S3SGX8.1
#=GS D0P2Q4_PHYIT/17-105         AC D0P2Q4.1
#=GS A0A0D9XP25_9ORYZ/234-319    AC A0A0D9XP25.1
#=GS A0A445ICT1_GLYSO/17-113     AC A0A445ICT1.1
#=GS A0A0C9VZ89_SPHS4/45-132     AC A0A0C9VZ89.1
#=GS A0A2I4F8C8_JUGRE/17-111     AC A0A2I4F8C8.1
#=GS B4FNM4_MAIZE/234-317        AC B4FNM4.1
#=GS A0A370THG6_9HELO/229-312    AC A0A370THG6.1
#=GS A0A6A3B4K9_HIBSY/17-115     AC A0A6A3B4K9.1
#=GS A0A2R6XP82_MARPO/21-110     AC A0A2R6XP82.1
#=GS A0A5D3BNN6_CUCME/35-119     AC A0A5D3BNN6.1
#=GS A0A2U3WV96_ODORO/8-86       AC A0A2U3WV96.1
#=GS I0A2Q6_FERFK/8-98           AC I0A2Q6.1
#=GS A0A444SQW5_ARMVU/231-315    AC A0A444SQW5.1
#=GS A0A2R6R407_ACTCC/19-120     AC A0A2R6R407.1
#=GS A0A1S4BZ62_TOBAC/197-274    AC A0A1S4BZ62.1
#=GS A0A670IDK3_PODMU/17-113     AC A0A670IDK3.1
#=GS R7QPF2_CHOCR/244-327        AC R7QPF2.1
#=GS A0A0S7E5T9_9EURO/21-109     AC A0A0S7E5T9.1
#=GS A0A6P7IQH5_9TELE/231-314    AC A0A6P7IQH5.1
#=GS A0A512UMT8_9ASCO/43-132     AC A0A512UMT8.1
#=GS G3TSS3_LOXAF/22-111         AC G3TSS3.1
#=GS A0A0G2EVD1_9PEZI/17-108     AC A0A0G2EVD1.1
#=GS E1Z395_CHLVA/9-91           AC E1Z395.1
#=GS M0F7S9_9EURY/16-113         AC M0F7S9.1
#=GS A0A401SZW0_CHIPU/4-88       AC A0A401SZW0.1
#=GS A0A1Y2BBF8_9TREE/229-313    AC A0A1Y2BBF8.1
#=GS A0A428QYF5_9HYPO/229-310    AC A0A428QYF5.1
#=GS A0A4D9BPX8_SALSN/21-110     AC A0A4D9BPX8.1
#=GS A0A5N4EHR5_CAMDR/22-91      AC A0A5N4EHR5.1
#=GS A0A6A9T2M2_9EURY/16-97      AC A0A6A9T2M2.1
#=GS Q6CW89_KLULA/229-310        AC Q6CW89.1
#=GS F2UBA3_SALR5/17-109         AC F2UBA3.1
#=GS A0A1Y2F242_9FUNG/16-102     AC A0A1Y2F242.1
#=GS B0WL94_CULQU/45-116         AC B0WL94.1
#=GS A0A0K0G0T9_STRVS/22-113     AC A0A0K0G0T9.1
#=GS A0A0D0DPZ2_9AGAM/21-111     AC A0A0D0DPZ2.1
#=GS A0A1R1PZJ7_ZANCU/228-316    AC A0A1R1PZJ7.1
#=GS A0A1A6H9V5_NEOLE/146-231    AC A0A1A6H9V5.1
#=GS J6EH42_SACK1/229-311        AC J6EH42.1
#=GS A0A4Y7KRZ9_PAPSO/22-110     AC A0A4Y7KRZ9.1
#=GS A0A6J2JBU9_BOMMA/17-111     AC A0A6J2JBU9.1
#=GS A0A5J5EFT5_9PEZI/228-312    AC A0A5J5EFT5.1
#=GS M1CZP0_SOLTU/234-317        AC M1CZP0.1
#=GS H0WNL0_OTOGA/231-316        AC H0WNL0.1
#=GS A0A154P6B2_DUFNO/22-109     AC A0A154P6B2.1
#=GS A0A1V6TP84_9EURO/17-108     AC A0A1V6TP84.1
#=GS A0CYN7_PARTE/21-105         AC A0CYN7.1
#=GS A0A445DN04_ARAHY/68-158     AC A0A445DN04.1
#=GS A0A4U6XP36_9PEZI/229-312    AC A0A4U6XP36.1
#=GS A0A3Q7QHM3_CALUR/231-316    AC A0A3Q7QHM3.1
#=GS A0A068V6I2_COFCA/234-321    AC A0A068V6I2.1
#=GS A0A1Q3EPG8_LENED/281-364    AC A0A1Q3EPG8.1
#=GS A0A1R2BQI6_9CILI/17-109     AC A0A1R2BQI6.1
#=GS A0A4V1XJ29_9PEZI/17-112     AC A0A4V1XJ29.1
#=GS S7P7S2_MYOBR/231-316        AC S7P7S2.1
#=GS A0A2R4ZUQ5_9CREN/1-86       AC A0A2R4ZUQ5.1
#=GS A0A2Y9G9K3_NEOSC/23-106     AC A0A2Y9G9K3.1
#=GS U7PYC8_SPOS1/17-110         AC U7PYC8.1
#=GS A0A099P5Q7_PICKU/20-105     AC A0A099P5Q7.1
#=GS A0A176VRF1_MARPO/234-321    AC A0A176VRF1.1
#=GS A0A2C9WNN0_MANES/234-321    AC A0A2C9WNN0.1
#=GS W9RA28_9ROSA/21-110         AC W9RA28.1
#=GS A0A7H8QJ97_9EURO/17-110     AC A0A7H8QJ97.1
#=GS K5VUP2_AGABU/21-108         AC K5VUP2.1
#=GS A0A3Q1JN12_ANATE/17-115     AC A0A3Q1JN12.1
#=GS W1QLU9_OGAPD/229-310        AC W1QLU9.1
#=GS M2N3C2_BAUPA/17-120         AC M2N3C2.1
#=GS A0A6P4AWV1_ZIZJJ/17-113     AC A0A6P4AWV1.1
#=GS A0A3N4JY41_9PEZI/21-98      AC A0A3N4JY41.1
#=GS A0A6J5VAT7_PRUAR/19-114     AC A0A6J5VAT7.1
#=GS G4YI50_PHYSP/17-107         AC G4YI50.1
#=GS Q17BC2_AEDAE/24-111         AC Q17BC2.1
#=GS A0A4S8JVQ9_MUSBA/40-121     AC A0A4S8JVQ9.1
#=GS W0JL94_9EURY/16-112         AC W0JL94.1
#=GS A0A1X7RV68_ZYMTR/229-312    AC A0A1X7RV68.1
#=GS F2DBD4_HORVV/234-318        AC F2DBD4.1
#=GS A0A5B6VQY7_9ROSI/22-113     AC A0A5B6VQY7.1
#=GS M2NEE3_BAUPA/21-115         AC M2NEE3.1
#=GS A0A2I0BEB6_9ASPA/17-113     AC A0A2I0BEB6.1
#=GS A0A5B0MMP7_PUCGR/19-107     AC A0A5B0MMP7.1
#=GS A0A384LLN5_PLAKH/32-118     AC A0A384LLN5.1
#=GS A0A395NK01_TRIAR/17-109     AC A0A395NK01.1
#=GS M7Z059_TRIUA/176-261        AC M7Z059.1
#=GS A0A1Q2YDU1_9ASCO/56-146     AC A0A1Q2YDU1.1
#=GS A0A1S3Y7X7_TOBAC/17-113     AC A0A1S3Y7X7.1
#=GS A0A084QIT6_STAC4/21-110     AC A0A084QIT6.1
#=GS A0A2K6RH70_RHIRO/178-264    AC A0A2K6RH70.1
#=GS A0A010RTY6_9PEZI/229-313    AC A0A010RTY6.1
#=GS A0A6J1KB28_CUCMA/51-120     AC A0A6J1KB28.1
#=GS A0A1D6FKZ4_MAIZE/186-280    AC A0A1D6FKZ4.1
#=GS A5E624_LODEL/20-108         AC A5E624.1
#=GS B6HQS8_PENRW/17-108         AC B6HQS8.1
#=GS W9SDU7_9ROSA/135-224        AC W9SDU7.1
#=GS A0A376B776_9ASCO/229-310    AC A0A376B776.1
#=GS A0A0M3JS03_ANISI/14-97      AC A0A0M3JS03.1
#=GS A0A6J5W1U6_PRUAR/234-317    AC A0A6J5W1U6.1
#=GS A0A1Y2BC65_9FUNG/17-111     AC A0A1Y2BC65.1
#=GS A0A6F9AAM5_9TELE/22-110     AC A0A6F9AAM5.1
#=GS A0A672Y926_9TELE/185-268    AC A0A672Y926.1
#=GS A0A1S3IJH9_LINUN/231-313    AC A0A1S3IJH9.1
#=GS A0A6P6RID8_CARAU/22-112     AC A0A6P6RID8.1
#=GS A0A2B4RB66_STYPI/231-316    AC A0A2B4RB66.1
#=GS A0A166A0Z1_9EURY/16-99      AC A0A166A0Z1.1
#=GS W9VQX0_9EURO/229-314        AC W9VQX0.1
#=GS A0A6H5J9G1_9HYME/401-487    AC A0A6H5J9G1.1
#=GS A0A3B5K0K7_TAKRU/17-112     AC A0A3B5K0K7.1
#=GS A0A6D2IBP8_9BRAS/70-166     AC A0A6D2IBP8.1
#=GS G8Y0P6_PICSO/229-308        AC G8Y0P6.1
#=GS A0A1Y2HCY1_9FUNG/20-107     AC A0A1Y2HCY1.1
#=GS B9SI03_RICCO/234-322        AC B9SI03.1
#=GS A0A1G4BJ12_9PEZI/229-313    AC A0A1G4BJ12.1
#=GS V4L2B1_EUTSA/71-161         AC V4L2B1.1
#=GS A0A1L0GBQ2_9ASCO/20-105     AC A0A1L0GBQ2.1
#=GS A0A0L0G6P1_9EUKA/16-109     AC A0A0L0G6P1.1
#=GS A0A6J2X0W0_CHACN/17-113     AC A0A6J2X0W0.1
#=GS A0A1S3BRK9_CUCME/35-119     AC A0A1S3BRK9.1
#=GS Q8TZC6_METKA/16-104         AC Q8TZC6.1
#=GS A0A093Z0Q4_9PEZI/229-310    AC A0A093Z0Q4.1
#=GS A0A2H6K7U0_9APIC/49-140     AC A0A2H6K7U0.1
#=GS A7EZ61_SCLS1/21-109         AC A7EZ61.1
#=GS A0A5N6UTS8_9EURO/21-107     AC A0A5N6UTS8.1
#=GS A0A2K6BUQ2_MACNE/8-95       AC A0A2K6BUQ2.1
#=GS A0A6A6NIB6_HEVBR/21-112     AC A0A6A6NIB6.1
#=GS G7WNB0_METH6/16-100         AC G7WNB0.1
#=GS A0A0V1DG86_TRIBR/22-112     AC A0A0V1DG86.1
#=GS A0A6J1VK77_9SAUR/231-314    AC A0A6J1VK77.1
#=GS A0A1Y1WMZ9_9FUNG/229-313    AC A0A1Y1WMZ9.1
#=GS A0A6P6T104_COFAR/12-101     AC A0A6P6T104.1
#=GS A0A176W912_MARPO/133-221    AC A0A176W912.1
#=GS A0A7N4V4L5_SARHA/17-102     AC A0A7N4V4L5.1
#=GS E4ZUZ7_LEPMJ/229-315        AC E4ZUZ7.1
#=GS A0A5B1QER8_9AGAM/229-310    AC A0A5B1QER8.1
#=GS A0A218ZSR5_9ARCH/16-104     AC A0A218ZSR5.1
#=GS C1N791_MICPC/233-314        AC C1N791.1
#=GS Q4Q6R6_LEIMA/16-105         AC Q4Q6R6.1
#=GS A0A6S7N1Y9_LACSI/4-90       AC A0A6S7N1Y9.1
#=GS A0A1Q3BZQ6_CEPFO/21-111     AC A0A1Q3BZQ6.1
#=GS A0A067RBI1_ZOONE/22-116     AC A0A067RBI1.1
#=GS A0A2K3N6Z1_TRIPR/17-113     AC A0A2K3N6Z1.1
#=GS G7XSX5_ASPKW/21-107         AC G7XSX5.1
#=GS A0A2R6Q9C7_ACTCC/22-88      AC A0A2R6Q9C7.1
#=GS G0W3R9_NAUDC/19-105         AC G0W3R9.1
#=GS A0A2G2YRN7_CAPAN/28-110     AC A0A2G2YRN7.1
#=GS C6SWA9_SOYBN/17-113         AC C6SWA9.1
#=GS G0PCW9_CAEBE/22-110         AC G0PCW9.1
#=GS A0A453S185_AEGTS/21-69      AC A0A453S185.1
#=GS U6JF89_ECHGR/22-120         AC U6JF89.1
#=GS A0A1D3D5I5_9EIME/19-74      AC A0A1D3D5I5.1
#=GS D8S0E7_SELML/34-119         AC D8S0E7.1
#=GS A0A4U5UAE1_COLLU/206-289    AC A0A4U5UAE1.1
#=GS A0A1A0H941_9ASCO/20-105     AC A0A1A0H941.1
#=GS A0A2K1XFX6_POPTR/21-109     AC A0A2K1XFX6.1
#=GS A2DQV0_TRIVA/17-105         AC A2DQV0.1
#=GS H2QZH4_PANTR/22-113         AC H2QZH4.1
#=GS A0A453SPA2_AEGTS/37-119     AC A0A453SPA2.1
#=GS A0A2I3N7Z9_PAPAN/208-291    AC A0A2I3N7Z9.1
#=GS A0A319EEH7_ASPSB/21-106     AC A0A319EEH7.1
#=GS A0A1Y2AAC0_9PLEO/17-111     AC A0A1Y2AAC0.1
#=GS A0A4U0TYN0_9PEZI/75-164     AC A0A4U0TYN0.1
#=GS B4M1P7_DROVI/17-114         AC B4M1P7.1
#=GS L1J787_GUITC/239-322        AC L1J787.1
#=GS A0A1R2BJ76_9CILI/17-109     AC A0A1R2BJ76.1
#=GS A0A1S7HNA6_9SACH/19-105     AC A0A1S7HNA6.1
#=GS A0A6P6LWP3_CARAU/22-112     AC A0A6P6LWP3.1
#=GS Q1HR99_AEDAE/231-314        AC Q1HR99.1
#=GS A0A0D2UYW6_GOSRA/234-320    AC A0A0D2UYW6.1
#=GS A0A0D1CLB4_USTMA/17-110     AC A0A0D1CLB4.1
#=GS A0A5B7J542_PORTR/1-65       AC A0A5B7J542.1
#=GS A0A2Y9K458_ENHLU/18-88      AC A0A2Y9K458.1
#=GS A0A1D3L0C0_9EURY/16-99      AC A0A1D3L0C0.1
#=GS A0A3L6PRG6_PANMI/21-108     AC A0A3L6PRG6.1
#=GS A0A090LFB6_STRRB/17-109     AC A0A090LFB6.1
#=GS A0A284R8H5_ARMOS/105-193    AC A0A284R8H5.1
#=GS A0A6P3V8T1_OCTDE/21-105     AC A0A6P3V8T1.1
#=GS A0A1S3CUK5_DIACI/229-313    AC A0A1S3CUK5.1
#=GS A0A166E3Q5_DAUCS/21-109     AC A0A166E3Q5.1
#=GS A0A383VVT5_TETOB/17-108     AC A0A383VVT5.1
#=GS A0A7F8RPN4_LEPWE/22-113     AC A0A7F8RPN4.1
#=GS A0A4P9Y0C8_9FUNG/21-106     AC A0A4P9Y0C8.1
#=GS A0A044TKS4_ONCVO/18-117     AC A0A044TKS4.1
#=GS A0A0R0F6M5_SOYBN/234-304    AC A0A0R0F6M5.1
#=GS A0A4Q4TJ06_9PEZI/17-112     AC A0A4Q4TJ06.1
#=GS A0A2H9TLL1_9FUNG/619-697    AC A0A2H9TLL1.1
#=GS G4UEF2_NEUT9/21-108         AC G4UEF2.1
#=GS Q0PXX2_DIACI/17-113         AC Q0PXX2.1
#=GS A0A179H1U0_PURLI/21-108     AC A0A179H1U0.1
#=GS A0A397SV74_9GLOM/21-110     AC A0A397SV74.1
#=GS G8C263_TETPH/19-105         AC G8C263.1
#=GS D7M5K2_ARALL/22-112         AC D7M5K2.1
#=GS A0A183WUA2_TRIRE/214-293    AC A0A183WUA2.1
#=GS A0A3Q7MKS9_CALUR/22-113     AC A0A3Q7MKS9.1
#=GS A0A6G1AEL9_CROCR/22-113     AC A0A6G1AEL9.1
#=GS D0NVM9_PHYIT/231-311        AC D0NVM9.1
#=GS C4QYM0_KOMPG/27-117         AC C4QYM0.1
#=GS B4QKR0_DROSI/231-316        AC B4QKR0.1
#=GS A0A5A7PH52_STRAF/21-108     AC A0A5A7PH52.1
#=GS A0A1X1BJ56_9APIC/32-115     AC A0A1X1BJ56.1
#=GS A0A2K6ASU5_MACNE/17-114     AC A0A2K6ASU5.1
#=GS A0A4S3JF23_9EURO/229-310    AC A0A4S3JF23.1
#=GS A0A2I0JDB0_PUNGR/20-68      AC A0A2I0JDB0.1
#=GS A4HFR6_LEIBR/238-323        AC A4HFR6.1
#=GS A0A0F8WAD3_9EURO/48-135     AC A0A0F8WAD3.1
#=GS A0A0E0IXY8_ORYNI/551-635    AC A0A0E0IXY8.1
#=GS A0A5N5JYL1_9ROSI/393-482    AC A0A5N5JYL1.1
#=GS A5E0C0_LODEL/17-109         AC A5E0C0.1
#=GS A0A095C8H8_CRYGR/17-110     AC A0A095C8H8.1
#=GS A0A165SAS5_9APHY/37-125     AC A0A165SAS5.1
#=GS A0A0B2V8V0_TOXCA/17-117     AC A0A0B2V8V0.1
#=GS A0A425BL34_9PEZI/40-129     AC A0A425BL34.1
#=GS A0A6P7ZHZ8_9AMPH/17-111     AC A0A6P7ZHZ8.1
#=GS A0A673UDI1_SURSU/245-330    AC A0A673UDI1.1
#=GS A0A3D8QGJ8_9HELO/21-109     AC A0A3D8QGJ8.1
#=GS H3FJM0_PRIPA/169-254        AC H3FJM0.2
#=GS A0A4S4L3M0_9AGAM/21-109     AC A0A4S4L3M0.1
#=GS A0A6P5XKW4_DURZI/44-134     AC A0A6P5XKW4.1
#=GS A0A1E5VM95_9POAL/1-67       AC A0A1E5VM95.1
#=GS A0A2T3BA71_AMORE/17-112     AC A0A2T3BA71.1
#=GS A0A4Y7KD97_PAPSO/22-112     AC A0A4Y7KD97.1
#=GS A0A0B2UKZ5_9MICR/24-105     AC A0A0B2UKZ5.1
#=GS A0A4V4HA14_MUSBA/260-350    AC A0A4V4HA14.1
#=GS A0A2R5GMT5_9STRA/231-316    AC A0A2R5GMT5.1
#=GS A0A367YKM9_9ASCO/20-107     AC A0A367YKM9.1
#=GS A0A0A2W3V9_BEABA/17-89      AC A0A0A2W3V9.1
#=GS A0A6A3N702_9STRA/17-107     AC A0A6A3N702.1
#=GS A0A1V6NYZ1_PENDC/21-108     AC A0A1V6NYZ1.1
#=GS A0A6A3ANQ3_HIBSY/20-102     AC A0A6A3ANQ3.1
#=GS A0A642UZZ6_DIURU/229-309    AC A0A642UZZ6.1
#=GS A0A367K3T4_RHIAZ/17-107     AC A0A367K3T4.1
#=GS A0A7C8MP74_9PEZI/21-109     AC A0A7C8MP74.1
#=GS F4C0T3_METSG/234-323        AC F4C0T3.1
#=GS A0A6D2LJZ0_9BRAS/18-118     AC A0A6D2LJZ0.1
#=GS A0A212FEQ6_DANPL/231-315    AC A0A212FEQ6.1
#=GS I7IS73_BABMR/32-119         AC I7IS73.1
#=GS A0A482XI64_LAOST/17-113     AC A0A482XI64.1
#=GS B0WQZ4_CULQU/231-314        AC B0WQZ4.1
#=GS B0W7R3_CULQU/15-98          AC B0W7R3.1
#=GS S8EKB5_FOMPI/41-129         AC S8EKB5.1
#=GS A0A0K0FUR6_STRVS/17-108     AC A0A0K0FUR6.1
#=GS A0A2P5XN67_GOSBA/17-79      AC A0A2P5XN67.1
#=GS A0A177UE67_9BASI/229-313    AC A0A177UE67.1
#=GS L5LSG8_MYODS/29-104         AC L5LSG8.1
#=GS A0A3Q7NPZ6_CALUR/231-308    AC A0A3Q7NPZ6.1
#=GS R7YJP5_CONA1/17-113         AC R7YJP5.1
#=GS A0A2C5ZKV5_9HYPO/17-110     AC A0A2C5ZKV5.1
#=GS A0A340XQA3_LIPVE/159-237    AC A0A340XQA3.1
#=GS A0A4Q4WE94_9PEZI/229-311    AC A0A4Q4WE94.1
#=GS A0A0C3A0X3_9AGAM/229-313    AC A0A0C3A0X3.1
#=GS Q4N5C0_THEPA/19-109         AC Q4N5C0.1
#=GS A0A5J9V7U0_9POAL/234-318    AC A0A5J9V7U0.1
#=GS A0A673UML8_SURSU/22-96      AC A0A673UML8.1
#=GS A0A1A0HJJ5_9ASCO/24-114     AC A0A1A0HJJ5.1
#=GS A0A1L9RXS4_ASPWE/230-311    AC A0A1L9RXS4.1
#=GS U4UXJ9_DENPD/55-149         AC U4UXJ9.1
#=GS A0A559M3L5_9HELO/229-314    AC A0A559M3L5.1
#=GS A0A0F8A467_9HYPO/17-109     AC A0A0F8A467.1
#=GS A0A6J1X8V7_GALME/22-109     AC A0A6J1X8V7.1
#=GS A7E2K4_DANRE/17-113         AC A7E2K4.1
#=GS I1BZD4_RHIO9/17-107         AC I1BZD4.1
#=GS A0A1A6HTU6_NEOLE/22-110     AC A0A1A6HTU6.1
#=GS A0A2I3GZ98_NOMLE/20-105     AC A0A2I3GZ98.1
#=GS A0A5D6Y7H3_9STRA/26-110     AC A0A5D6Y7H3.1
#=GS A0A175YAJ3_DAUCS/234-319    AC A0A175YAJ3.1
#=GS B4FUB4_MAIZE/21-108         AC B4FUB4.1
#=GS A0A078IBN0_BRANA/17-113     AC A0A078IBN0.1
#=GS A0A556VXV7_BAGYA/17-114     AC A0A556VXV7.1
#=GS A0A6P7SHT9_OCTVU/17-111     AC A0A6P7SHT9.1
#=GS A0A420J9W3_9PEZI/17-109     AC A0A420J9W3.1
#=GS A0A2K6ANU6_MACNE/17-114     AC A0A2K6ANU6.1
#=GS G0R4G7_ICHMG/17-110         AC G0R4G7.1
#=GS A0A0M9VNY7_9BASI/17-110     AC A0A0M9VNY7.1
#=GS B6JZT8_SCHJY/15-108         AC B6JZT8.1
#=GS A0A6S7PLP4_LACSI/4-87       AC A0A6S7PLP4.1
#=GS A0A0A1UC61_ENTIV/23-107     AC A0A0A1UC61.1
#=GS A0A409YKX2_9AGAR/229-310    AC A0A409YKX2.1
#=GS A0A177B0E9_9BILA/194-272    AC A0A177B0E9.1
#=GS A7S837_NEMVE/22-109         AC A7S837.1
#=GS F9WD61_TRYCI/35-126         AC F9WD61.1
#=GS A0A133UZZ9_9EURY/16-100     AC A0A133UZZ9.1
#=GS A9CS87_ENTBH/16-100         AC A9CS87.1
#=GS F6YZ91_MONDO/22-113         AC F6YZ91.2
#=GS A0A0L7KQG6_9NEOP/1-78       AC A0A0L7KQG6.1
#=GS A0A5E4E9H6_PRUDU/21-111     AC A0A5E4E9H6.1
#=GS A0A1X2HB53_SYNRA/17-108     AC A0A1X2HB53.1
#=GS A0A3Q4GM19_NEOBR/17-113     AC A0A3Q4GM19.1
#=GS A0A409WF68_PSICY/229-311    AC A0A409WF68.1
#=GS A0A2G4SV56_RHIZD/12-102     AC A0A2G4SV56.1
#=GS A0A0V1I0S4_9BILA/37-134     AC A0A0V1I0S4.1
#=GS A0A0M9FPN2_9TRYP/20-107     AC A0A0M9FPN2.1
#=GS G1KQZ8_ANOCA/17-113         AC G1KQZ8.1
#=GS F7IJ35_CALJA/158-239        AC F7IJ35.3
#=GS D8QPV7_SELML/234-320        AC D8QPV7.1
#=GS A0A6G1ATR1_CROCR/22-110     AC A0A6G1ATR1.1
#=GS A0A494BA26_MOUSE/23-112     AC A0A494BA26.1
#=GS A0A401PIA8_SCYTO/22-108     AC A0A401PIA8.1
#=GS A0A0C4DRL8_MAGP6/17-109     AC A0A0C4DRL8.1
#=GS A0A665T1W4_ECHNA/231-313    AC A0A665T1W4.1
#=GS A0A1D3TH45_9APIC/19-110     AC A0A1D3TH45.1
#=GS A0A7N5KA36_AILME/169-254    AC A0A7N5KA36.1
#=GS T0R8E2_SAPDV/17-107         AC T0R8E2.1
#=GS A0A436ZND0_9PEZI/87-174     AC A0A436ZND0.1
#=GS A0A507DJ02_9FUNG/23-118     AC A0A507DJ02.1
#=GS A0A0D2XM57_FUSO4/21-108     AC A0A0D2XM57.1
#=GS A0A251TMQ5_HELAN/21-110     AC A0A251TMQ5.1
#=GS A0A2T0FKK6_9ASCO/21-105     AC A0A2T0FKK6.1
#=GS A0A3B1IM00_ASTMX/17-115     AC A0A3B1IM00.1
#=GS A0A136JEJ6_9PEZI/229-310    AC A0A136JEJ6.1
#=GS A0A1J4K7Y3_9EUKA/17-104     AC A0A1J4K7Y3.1
#=GS A0A091S823_NESNO/213-270    AC A0A091S823.1
#=GS H2Z4W6_CIOSA/21-105         AC H2Z4W6.1
#=GS A0A1L9N3Q1_ASPTC/17-109     AC A0A1L9N3Q1.1
#=GS A0A165Z7X5_9AGAM/17-100     AC A0A165Z7X5.1
#=GS A0A1U8L1S6_GOSHI/23-110     AC A0A1U8L1S6.1
#=GS A0A2G3CBP6_CAPCH/234-317    AC A0A2G3CBP6.1
#=GS A0A4Y9XZC2_9APHY/21-107     AC A0A4Y9XZC2.1
#=GS A0A1U7WFP4_NICSY/21-111     AC A0A1U7WFP4.1
#=GS A0A2H1EDV3_9ARCH/16-99      AC A0A2H1EDV3.1
#=GS A0A1U7Q529_MESAU/17-114     AC A0A1U7Q529.1
#=GS M9MH80_PSEA3/131-176        AC M9MH80.1
#=GS G1QDJ9_MYOLU/22-113         AC G1QDJ9.1
#=GS M7TB45_BOTF1/44-137         AC M7TB45.1
#=GS A0A2J7QLA8_9NEOP/22-110     AC A0A2J7QLA8.1
#=GS A0A2K6MFT5_RHIBE/231-317    AC A0A2K6MFT5.1
#=GS A0A068VM04_COFCA/17-112     AC A0A068VM04.1
#=GS A8WS55_CAEBR/231-311        AC A8WS55.1
#=GS A0A2I4GFV6_JUGRE/21-112     AC A0A2I4GFV6.1
#=GS A0A2K0VX42_GIBNY/229-312    AC A0A2K0VX42.1
#=GS A0A2H5V0Q2_9ARCH/16-102     AC A0A2H5V0Q2.1
#=GS A0A136J169_9PEZI/21-108     AC A0A136J169.1
#=GS A0A0B0MC61_GOSAR/22-113     AC A0A0B0MC61.1
#=GS A0A3P9DTF3_9CICH/17-113     AC A0A3P9DTF3.1
#=GS C7YYI8_FUSV7/17-109         AC C7YYI8.1
#=GS A0A0F7PE23_9EURY/16-111     AC A0A0F7PE23.1
#=GS B3MAK8_DROAN/231-316        AC B3MAK8.1
#=GS A0A0A0L5M7_CUCSA/21-112     AC A0A0A0L5M7.1
#=GS A0A444U488_ACIRT/17-114     AC A0A444U488.1
#=GS M9SGT3_METAX/230-333        AC M9SGT3.1
#=GS A0A6J0P7C2_RAPSA/233-320    AC A0A6J0P7C2.1
#=GS A3LSH5_PICST/17-108         AC A3LSH5.1
#=GS C9S6M2_VERA1/21-108         AC C9S6M2.1
#=GS A0A6A1PZX4_BALPH/22-107     AC A0A6A1PZX4.1
#=GS I3MKZ5_ICTTR/17-114         AC I3MKZ5.1
#=GS A0A2B7XE13_9EURO/229-310    AC A0A2B7XE13.1
#=GS A0A016VEM1_9BILA/17-92      AC A0A016VEM1.1
#=GS A0A6A6YE54_9PEZI/234-320    AC A0A6A6YE54.1
#=GS A0A1A8YUU9_9APIC/32-118     AC A0A1A8YUU9.1
#=GS A0A5C7HNP0_9ROSI/213-294    AC A0A5C7HNP0.1
#=GS B0X3D8_CULQU/17-109         AC B0X3D8.1
#=GS A0A6I9U4Q7_SESIN/7-120      AC A0A6I9U4Q7.1
#=GS A0A0N0BIW7_9HYME/231-318    AC A0A0N0BIW7.1
#=GS A0A2K5V6U5_MACFA/147-233    AC A0A2K5V6U5.1
#=GS H0XPU5_OTOGA/22-113         AC H0XPU5.1
#=GS A0A3Q3E7W4_9LABR/17-111     AC A0A3Q3E7W4.1
#=GS M7SX42_EUTLA/229-311        AC M7SX42.1
#=GS L5KEP9_PTEAL/2-76           AC L5KEP9.1
#=GS A0A3Q7I9R0_SOLLC/234-318    AC A0A3Q7I9R0.1
#=GS A0A1J7K5E3_9PEZI/17-111     AC A0A1J7K5E3.1
#=GS M0THF3_MUSAM/234-319        AC M0THF3.1
#=GS A0A6P8QU91_GEOSA/22-112     AC A0A6P8QU91.1
#=GS A0A2G5VJ03_9PELO/231-311    AC A0A2G5VJ03.1
#=GS A0A212C031_CEREH/22-113     AC A0A212C031.1
#=GS H9G833_ANOCA/231-314        AC H9G833.1
#=GS A0A166NIK9_9PEZI/17-110     AC A0A166NIK9.1
#=GS Q5NB69_ORYSJ/53-118         AC Q5NB69.1
#=GS A0A672QJY0_SINGR/17-115     AC A0A672QJY0.1
#=GS A0A1S2XV01_CICAR/21-92      AC A0A1S2XV01.1
#=GS A0A662WIS2_9STRA/27-108     AC A0A662WIS2.1
#=GS A0A165D769_9BASI/229-313    AC A0A165D769.1
#=GS A0A067JWR3_JATCU/21-113     AC A0A067JWR3.1
#=GS A0A093GJR2_DRYPU/17-64      AC A0A093GJR2.1
#=GS A0A550BRM4_9AGAR/32-119     AC A0A550BRM4.1
#=GS A0A2P5AII2_PARAD/17-109     AC A0A2P5AII2.1
#=GS G4T6X4_SERID/229-310        AC G4T6X4.1
#=GS A0A0C9TAC9_PLICR/229-311    AC A0A0C9TAC9.1
#=GS A0A670IA97_PODMU/18-87      AC A0A670IA97.1
#=GS M0RXH3_MUSAM/24-115         AC M0RXH3.1
#=GS A0A167ZU72_9PEZI/229-310    AC A0A167ZU72.1
#=GS A0A177DEP8_ALTAL/21-104     AC A0A177DEP8.1
#=GS A0A0D3GXZ9_9ORYZ/17-108     AC A0A0D3GXZ9.1
#=GS A0A2C9WNJ3_MANES/21-111     AC A0A2C9WNJ3.1
#=GS A0A251TVF1_HELAN/50-140     AC A0A251TVF1.1
#=GS A0A3Q1IBG1_ANATE/22-112     AC A0A3Q1IBG1.1
#=GS A0A316ZHD9_9BASI/229-312    AC A0A316ZHD9.1
#=GS A0A2G9HKX3_9LAMI/25-119     AC A0A2G9HKX3.1
#=GS A0A4U1EAX9_MONMO/41-86      AC A0A4U1EAX9.1
#=GS A0A671L4B5_9TELE/162-243    AC A0A671L4B5.1
#=GS D2VM36_NAEGR/249-328        AC D2VM36.1
#=GS A0A2H1A5Q8_CANAR/229-310    AC A0A2H1A5Q8.1
#=GS A0A2K5E8B8_AOTNA/231-316    AC A0A2K5E8B8.1
#=GS A0A067PL09_9AGAM/21-110     AC A0A067PL09.1
#=GS A0A397XQH1_BRACM/17-112     AC A0A397XQH1.1
#=GS A0A0B0PBV6_GOSAR/150-236    AC A0A0B0PBV6.1
#=GS A0A2K6KZU9_RHIBE/22-112     AC A0A2K6KZU9.1
#=GS A0A232F4M2_9HYME/17-112     AC A0A232F4M2.1
#=GS A0A1S4C137_TOBAC/33-120     AC A0A1S4C137.1
#=GS A0A6P6IQD5_PUMCO/231-316    AC A0A6P6IQD5.1
#=GS A0A6I9TK36_SESIN/21-111     AC A0A6I9TK36.1
#=GS A0A0W8E197_PHYNI/29-111     AC A0A0W8E197.1
#=GS F1A4T6_DICPU/24-110         AC F1A4T6.1
#=GS A0A6A4JW65_APOLU/55-114     AC A0A6A4JW65.1
#=GS A0A3F3Q5L8_9EURO/17-109     AC A0A3F3Q5L8.1
#=GS A0A0E0R3U6_ORYRU/610-695    AC A0A0E0R3U6.1
#=GS A0A0N4YB01_NIPBR/17-111     AC A0A0N4YB01.1
#=GS A0A5N4DVT4_CAMDR/22-113     AC A0A5N4DVT4.1
#=GS A0A4U6V1A8_SETVI/59-119     AC A0A4U6V1A8.1
#=GS A0A6I9HEQ9_GEOFO/25-122     AC A0A6I9HEQ9.1
#=GS S4R8E5_PETMA/78-160         AC S4R8E5.1
#=GS A0A5J5BCJ6_9ASTE/227-314    AC A0A5J5BCJ6.1
#=GS A0A0A2L8B2_PENIT/229-311    AC A0A0A2L8B2.1
#=GS W6LGU4_9TRYP/238-323        AC W6LGU4.1
#=GS W6MVL8_9ASCO/19-103         AC W6MVL8.1
#=GS G0RFG1_HYPJQ/229-314        AC G0RFG1.1
#=GS A0A0C9MH63_9FUNG/20-104     AC A0A0C9MH63.1
#=GS A0A2I3MUK5_PAPAN/26-113     AC A0A2I3MUK5.1
#=GS S9XIT4_CAMFR/76-152         AC S9XIT4.1
#=GS A0A5N4CE16_CAMDR/22-114     AC A0A5N4CE16.1
#=GS A0A251NA79_PRUPE/17-112     AC A0A251NA79.1
#=GS A0A2P4YA36_9STRA/29-107     AC A0A2P4YA36.1
#=GS A0A4Q4V806_9PEZI/229-311    AC A0A4Q4V806.1
#=GS A0A2I0JDB6_PUNGR/17-113     AC A0A2I0JDB6.1
#=GS A0A0L0SEJ3_ALLM3/22-108     AC A0A0L0SEJ3.1
#=GS A0A1J9QPW3_9EURO/229-311    AC A0A1J9QPW3.1
#=GS A0A397ZM66_BRACM/233-320    AC A0A397ZM66.1
#=GS A0A6A2WMA0_HIBSY/17-110     AC A0A6A2WMA0.1
#=GS A0A1E3NL17_9ASCO/17-107     AC A0A1E3NL17.1
#=GS A0A5N3XSX8_MUNRE/17-114     AC A0A5N3XSX8.1
#=GS A0A2N5VD02_9BASI/361-443    AC A0A2N5VD02.1
#=GS U6KZ60_EIMTE/9-105          AC U6KZ60.1
#=GS A0A0V1J743_TRIPS/24-121     AC A0A0V1J743.1
#=GS A0A2A4KAR6_HELVI/22-110     AC A0A2A4KAR6.1
#=GS A0A6A5ETX6_PERFL/36-131     AC A0A6A5ETX6.1
#=GS A0A2G7FTX0_9EURO/17-108     AC A0A2G7FTX0.1
#=GS RLA0_NEUCR/229-312          AC Q96TJ5.1
#=GS K3YKC6_SETIT/17-111         AC K3YKC6.1
#=GS A0A6J1J9L0_CUCMA/234-319    AC A0A6J1J9L0.1
#=GS A0A226NRX3_COLVI/22-113     AC A0A226NRX3.1
#=GS RLA21_ARATH/17-114          AC P51407.2
#=GS A0A1S2YFQ0_CICAR/7-120      AC A0A1S2YFQ0.1
#=GS A0A151GU46_9HYPO/21-108     AC A0A151GU46.1
#=GS G3IIQ6_CRIGR/17-102         AC G3IIQ6.1
#=GS A0A1R2CNC2_9CILI/32-117     AC A0A1R2CNC2.1
#=GS A0A0A1NEJ3_RHIZD/20-106     AC A0A0A1NEJ3.1
#=GS A0A4D8XPK9_9ALVE/19-109     AC A0A4D8XPK9.1
#=GS A0A0D3E0J5_BRAOL/17-113     AC A0A0D3E0J5.1
#=GS A0A1U8LST2_GOSHI/22-113     AC A0A1U8LST2.1
#=GS A0A1L8GJK1_XENLA/17-68      AC A0A1L8GJK1.1
#=GS A0A2Y9M1K0_DELLE/22-113     AC A0A2Y9M1K0.1
#=GS A0A1R3KLB6_9ROSI/17-113     AC A0A1R3KLB6.1
#=GS A0A6P5T5Z9_PRUAV/21-109     AC A0A6P5T5Z9.1
#=GS A0A0K9Q9F4_SPIOL/127-213    AC A0A0K9Q9F4.1
#=GS A0A4V1IW96_9FUNG/17-107     AC A0A4V1IW96.1
#=GS G0RUV7_HYPJQ/21-108         AC G0RUV7.1
#=GS A0A668S921_OREAU/22-113     AC A0A668S921.1
#=GS A0A384LP84_PLAKH/231-313    AC A0A384LP84.1
#=GS A0A2T3ZPY1_9HYPO/229-312    AC A0A2T3ZPY1.1
#=GS A0A2I4HWR3_JUGRE/21-111     AC A0A2I4HWR3.2
#=GS M0AUD2_NATA1/16-113         AC M0AUD2.1
#=GS A0A0D2QQU5_GOSRA/22-104     AC A0A0D2QQU5.1
#=GS G8BKG6_CANPC/20-110         AC G8BKG6.1
#=GS A0A3Q3MHQ9_9TELE/231-314    AC A0A3Q3MHQ9.2
#=GS A0A261Y6D0_9FUNG/17-108     AC A0A261Y6D0.1
#=GS A0A212DGB9_CEREH/17-114     AC A0A212DGB9.1
#=GS A0A2S6C7J9_9PEZI/21-111     AC A0A2S6C7J9.1
#=GS V2XWK9_MONRO/26-115         AC V2XWK9.1
#=GS A0A337SCY9_FELCA/17-113     AC A0A337SCY9.1
#=GS A0A2C5XYB1_9HYPO/229-313    AC A0A2C5XYB1.1
#=GS A0A1Y1VL06_9FUNG/23-107     AC A0A1Y1VL06.1
#=GS A0A2I3SM72_PANTR/18-88      AC A0A2I3SM72.1
#=GS W9R644_9ROSA/234-319        AC W9R644.1
#=GS F7HRN7_MACMU/231-317        AC F7HRN7.1
#=GS A0A2I2FWR2_9EURO/229-311    AC A0A2I2FWR2.1
#=GS R0G646_9BRAS/233-320        AC R0G646.1
#=GS A0A1B8AJX3_FUSPO/17-108     AC A0A1B8AJX3.1
#=GS A0A1Y2HM56_9FUNG/192-273    AC A0A1Y2HM56.1
#=GS A0A498KPJ5_MALDO/21-96      AC A0A498KPJ5.1
#=GS A0A5E4QCN8_9NEOP/231-293    AC A0A5E4QCN8.1
#=GS A1CRF6_ASPCL/229-312        AC A1CRF6.1
#=GS A0A060Y3F6_ONCMY/22-110     AC A0A060Y3F6.1
#=GS A0A2H3GYK8_FUSOX/21-67      AC A0A2H3GYK8.1
#=GS M4AM80_XIPMA/22-112         AC M4AM80.1
#=GS A0A5E4F275_PRUDU/107-202    AC A0A5E4F275.1
#=GS G3I1S0_CRIGR/1-82           AC G3I1S0.1
#=GS A0A093ZE07_9PEZI/229-311    AC A0A093ZE07.1
#=GS J8Q6X0_SACAR/20-105         AC J8Q6X0.1
#=GS A0A5N3XG11_MUNRE/21-112     AC A0A5N3XG11.1
#=GS A0A662XWW5_9STRA/231-312    AC A0A662XWW5.1
#=GS A0A0D2EPD2_9EURO/17-113     AC A0A0D2EPD2.1
#=GS A0A1E5V3V4_9POAL/1-73       AC A0A1E5V3V4.1
#=GS A0A401KSK5_ASPAW/21-107     AC A0A401KSK5.1
#=GS G1X570_ARTOA/21-108         AC G1X570.1
#=GS A0A498IUC8_MALDO/120-205    AC A0A498IUC8.1
#=GS C5YFT4_SORBI/17-111         AC C5YFT4.1
#=GS A0A6P5S8S2_PRUAV/17-112     AC A0A6P5S8S2.1
#=GS A0A6A3Y2A9_9STRA/27-113     AC A0A6A3Y2A9.1
#=GS A0A168SER6_ABSGL/182-263    AC A0A168SER6.1
#=GS A0A4S4DBW6_CAMSI/37-118     AC A0A4S4DBW6.1
#=GS B4NEP4_DROWI/17-115         AC B4NEP4.1
#=GS F1RTU6_PIG/22-107           AC F1RTU6.1
#=GS A0A2G5USZ0_9PELO/17-109     AC A0A2G5USZ0.1
#=GS H1VCD7_COLHI/22-105         AC H1VCD7.1
#=GS RLA32_ARATH/28-119          AC Q9LVC9.1
#=GS A0A1R1XTU9_9FUNG/228-315    AC A0A1R1XTU9.1
#=GS A0A2S7P752_9HELO/232-317    AC A0A2S7P752.1
#=GS A0A067CTV2_SAPPC/231-314    AC A0A067CTV2.1
#=GS D6WMT4_TRICA/231-315        AC D6WMT4.1
#=GS A0A061GVH2_THECC/17-112     AC A0A061GVH2.1
#=GS S9W6Q9_SCHCR/21-106         AC S9W6Q9.1
#=GS A0A445HGZ5_GLYSO/237-322    AC A0A445HGZ5.1
#=GS A0A1X7UML1_AMPQE/74-166     AC A0A1X7UML1.1
#=GS S8AS47_PENO1/17-108         AC S8AS47.1
#=GS A0A0D1ZPR8_9EURO/229-314    AC A0A0D1ZPR8.1
#=GS V4CM71_LOTGI/231-313        AC V4CM71.1
#=GS A0A544ZWS7_9PEZI/21-108     AC A0A544ZWS7.1
#=GS A0A093XD20_9PEZI/17-109     AC A0A093XD20.1
#=GS K3WS98_GLOUD/26-110         AC K3WS98.1
#=GS A0A5N3X7M4_MUNRE/22-113     AC A0A5N3X7M4.1
#=GS A3BJK9_ORYSJ/17-106         AC A3BJK9.1
#=GS A0A2T3AAS7_9PEZI/17-100     AC A0A2T3AAS7.1
#=GS A0A2U3VNZ7_ODORO/231-316    AC A0A2U3VNZ7.1
#=GS A0A1E5RNN1_9ASCO/20-106     AC A0A1E5RNN1.1
#=GS A0A068V676_COFCA/17-115     AC A0A068V676.1
#=GS A0A6A3B7F6_HIBSY/234-322    AC A0A6A3B7F6.1
#=GS A0A1S7UJ91_ROSNE/21-109     AC A0A1S7UJ91.1
#=GS A0A2G2ZTX4_CAPAN/194-277    AC A0A2G2ZTX4.1
#=GS A0A2Y9KGF6_ENHLU/231-316    AC A0A2Y9KGF6.1
#=GS A0A2K6L8W0_RHIBE/186-268    AC A0A2K6L8W0.1
#=GS A0A287G7Z3_HORVV/2-91       AC A0A287G7Z3.1
#=GS A0A0L0SFT9_ALLM3/21-105     AC A0A0L0SFT9.1
#=GS A0A4Q4VR53_9PEZI/21-110     AC A0A4Q4VR53.1
#=GS A0A448ZN84_9STRA/231-311    AC A0A448ZN84.1
#=GS A0A2A2KFL4_9BILA/231-316    AC A0A2A2KFL4.1
#=GS G3WPT4_SARHA/22-113         AC G3WPT4.1
#=GS G2R499_THETT/229-312        AC G2R499.1
#=GS A0A016VFG8_9BILA/1-57       AC A0A016VFG8.1
#=GS A0A5N3XMI5_MUNRE/22-113     AC A0A5N3XMI5.1
#=GS C1GQK6_PARBA/229-312        AC C1GQK6.1
#=GS A0A072VI67_MEDTR/1-78       AC A0A072VI67.1
#=GS A0A074WVD8_9PEZI/229-302    AC A0A074WVD8.1
#=GS A0A553PR76_9TELE/17-114     AC A0A553PR76.1
#=GS A0A0L8G8N4_OCTBM/14-92      AC A0A0L8G8N4.1
#=GS F1RNZ2_PIG/17-114           AC F1RNZ2.1
#=GS W2YX96_PHYPR/29-111         AC W2YX96.1
#=GS A0A2H3IAJ2_9EURO/17-111     AC A0A2H3IAJ2.1
#=GS A0A200Q7M0_9MAGN/234-323    AC A0A200Q7M0.1
#=GS A0A7E6DSI2_9CHIR/22-94      AC A0A7E6DSI2.1
#=GS A0A031LR95_9CREN/16-102     AC A0A031LR95.1
#=GS K2N1X8_TRYCR/238-323        AC K2N1X8.1
#=GS A0A0E0IXY7_ORYNI/559-643    AC A0A0E0IXY7.1
#=GS A0A162AMY4_DAUCS/17-114     AC A0A162AMY4.1
#=GS U3J062_ANAPP/17-99          AC U3J062.2
#=GS A0A395GXZ9_9EURO/229-312    AC A0A395GXZ9.1
#=GS A0A0A0KKF6_CUCSA/17-114     AC A0A0A0KKF6.1
#=GS A0A0E0DS57_9ORYZ/17-112     AC A0A0E0DS57.1
#=GS A0A6P4DWY1_ARADU/234-309    AC A0A6P4DWY1.1
#=GS A0A3M6UKY9_POCDA/17-114     AC A0A3M6UKY9.1
#=GS A0A2Y9QLR7_TRIMA/17-113     AC A0A2Y9QLR7.1
#=GS A0A2K5CHA1_AOTNA/22-102     AC A0A2K5CHA1.1
#=GS F9F1Y7_FUSOF/229-312        AC F9F1Y7.1
#=GS S7RPJ3_GLOTA/17-112         AC S7RPJ3.1
#=GS A0A1Q3C2Q1_CEPFO/167-252    AC A0A1Q3C2Q1.1
#=GS A0A2G3DEK6_CAPCH/21-111     AC A0A2G3DEK6.1
#=GS A0A091D800_FUKDA/71-168     AC A0A091D800.1
#=GS A0A0N4VKR7_ENTVE/24-120     AC A0A0N4VKR7.1
#=GS A0A286UFF8_9AGAM/21-108     AC A0A286UFF8.1
#=GS A0A1Y2F9D5_PROLT/229-309    AC A0A1Y2F9D5.1
#=GS A0A016UDG4_9BILA/231-314    AC A0A016UDG4.1
#=GS A0A3Q4HEJ7_NEOBR/22-113     AC A0A3Q4HEJ7.1
#=GS A0A0V1I011_9BILA/22-112     AC A0A0V1I011.1
#=GS R0KX96_SETT2/21-110         AC R0KX96.1
#=GS A0A218X2C0_PUNGR/17-114     AC A0A218X2C0.1
#=GS A0A1Y1JHB0_PLAGO/19-110     AC A0A1Y1JHB0.1
#=GS E4UY93_ARTGP/17-112         AC E4UY93.1
#=GS A0A132AAI5_SARSC/231-316    AC A0A132AAI5.1
#=GS A0A2T4GGK2_FUSCU/21-107     AC A0A2T4GGK2.1
#=GS A0A3D8QJB2_9EURO/229-311    AC A0A3D8QJB2.1
#=GS A0A168JRC4_MUCCL/17-105     AC A0A168JRC4.1
#=GS W9SDZ4_9ROSA/34-120         AC W9SDZ4.1
#=GS A0A3M6VKY5_9STRA/25-117     AC A0A3M6VKY5.1
#=GS C5MGJ9_CANTT/20-106         AC C5MGJ9.1
#=GS E3S4C1_PYRTT/229-314        AC E3S4C1.1
#=GS A0A1U7UUA4_CARSF/12-102     AC A0A1U7UUA4.1
#=GS A0A2J6SY11_9HELO/21-110     AC A0A2J6SY11.1
#=GS A0A095EFQ3_CRYGR/229-311    AC A0A095EFQ3.1
#=GS M8A407_TRIUA/17-112         AC M8A407.1
#=GS A0A1Y2H4D0_9FUNG/17-110     AC A0A1Y2H4D0.1
#=GS A0A485LG63_9STRA/16-105     AC A0A485LG63.1
#=GS A0A5B0Q684_PUCGR/17-112     AC A0A5B0Q684.1
#=GS E5S6M4_TRISP/231-320        AC E5S6M4.1
#=GS A0A4U5JJ98_9EURY/16-110     AC A0A4U5JJ98.1
#=GS A0A6G1D1R5_9ORYZ/17-111     AC A0A6G1D1R5.1
#=GS A0A1Q3DII9_CEPFO/234-319    AC A0A1Q3DII9.1
#=GS C6HAJ2_AJECH/229-310        AC C6HAJ2.1
#=GS A0A5C3LJA7_9AGAR/17-110     AC A0A5C3LJA7.1
#=GS I1JYI8_SOYBN/21-109         AC I1JYI8.1
#=GS A0A1E3P4C6_WICAA/15-105     AC A0A1E3P4C6.1
#=GS A0A2T7D322_9POAL/234-317    AC A0A2T7D322.1
#=GS A0A6P3ZZ43_ZIZJJ/30-118     AC A0A6P3ZZ43.1
#=GS B6QNT0_TALMQ/229-312        AC B6QNT0.1
#=GS A0A0L7LLV1_9NEOP/6-61       AC A0A0L7LLV1.1
#=GS J4KR91_BEAB2/229-312        AC J4KR91.1
#=GS L5JNQ5_PTEAL/22-113         AC L5JNQ5.1
#=GS A0A0D2B277_9EURO/21-111     AC A0A0D2B277.1
#=GS A0A5C3ET03_9BASI/22-110     AC A0A5C3ET03.1
#=GS A0A1A8VVS4_9APIC/231-313    AC A0A1A8VVS4.1
#=GS A0A3Q2CU71_CYPVA/17-114     AC A0A3Q2CU71.1
#=GS A0A2I2YLU0_GORGO/189-273    AC A0A2I2YLU0.1
#=GS A0A443PZD8_9MAGN/17-115     AC A0A443PZD8.1
#=GS A0A669CHA7_ORENI/169-252    AC A0A669CHA7.1
#=GS G3JKF4_CORMM/229-310        AC G3JKF4.1
#=GS A0A0D9YT45_9ORYZ/17-112     AC A0A0D9YT45.1
#=GS A0A261BP23_9PELO/17-107     AC A0A261BP23.1
#=GS A0A6J3F4L9_SAPAP/22-113     AC A0A6J3F4L9.1
#=GS A0A392RIP3_9FABA/11-93      AC A0A392RIP3.1
#=GS A0A2G9UIT8_TELCI/153-236    AC A0A2G9UIT8.1
#=GS W7I4U6_9PEZI/21-67          AC W7I4U6.1
#=GS A0A2G3A027_CAPAN/21-94      AC A0A2G3A027.1
#=GS A0A4R0RAN3_9APHY/17-112     AC A0A4R0RAN3.1
#=GS A0A4U1F754_MONMO/22-113     AC A0A4U1F754.1
#=GS A0A7C8MMC0_9PLEO/21-111     AC A0A7C8MMC0.1
#=GS A0A5A7TTB2_CUCME/21-107     AC A0A5A7TTB2.1
#=GS A0A409VN97_9AGAR/17-111     AC A0A409VN97.1
#=GS A0A4Q4UHU4_9PEZI/21-110     AC A0A4Q4UHU4.1
#=GS A0A1L8GJE9_XENLA/1-50       AC A0A1L8GJE9.1
#=GS A0A3R7NK96_TRYRA/26-113     AC A0A3R7NK96.1
#=GS A0A103YFN8_CYNCS/138-225    AC A0A103YFN8.1
#=GS A0A6A4X207_AMPAM/180-251    AC A0A6A4X207.1
#=GS A0A1Z5TT99_HORWE/259-339    AC A0A1Z5TT99.1
#=GS A0A427B8D7_ENSVE/76-134     AC A0A427B8D7.1
#=GS A0A0K9PJH4_ZOSMR/17-109     AC A0A0K9PJH4.1
#=GS A0A3Q7TF58_VULVU/15-86      AC A0A3Q7TF58.1
#=GS A0A6P8TTI1_GYMAC/17-114     AC A0A6P8TTI1.1
#=GS A0A6A2XQ93_HIBSY/22-113     AC A0A6A2XQ93.1
#=GS A0A0W8BUF5_PHYNI/105-193    AC A0A0W8BUF5.1
#=GS A0A7M7RH49_STRPU/25-110     AC A0A7M7RH49.1
#=GS R7S1P7_PUNST/229-312        AC R7S1P7.1
#=GS M1DCK1_SOLTU/22-110         AC M1DCK1.1
#=GS A0A667WGQ9_9TELE/17-113     AC A0A667WGQ9.1
#=GS V5EQD2_KALBG/230-312        AC V5EQD2.1
#=GS A0A125PHF4_9BASI/35-118     AC A0A125PHF4.1
#=GS A0A452Z803_AEGTS/17-109     AC A0A452Z803.1
#=GS A0A0N4TVG5_BRUPA/10-110     AC A0A0N4TVG5.1
#=GS A0A176WHU5_MARPO/50-122     AC A0A176WHU5.1
#=GS A0A6L2Q1I9_COPFO/22-106     AC A0A6L2Q1I9.1
#=GS J3KXZ7_ORYBR/61-119         AC J3KXZ7.1
#=GS A0A2T9X0V1_9CREN/16-105     AC A0A2T9X0V1.1
#=GS A0A6A5B8E4_NAEFO/23-109     AC A0A6A5B8E4.1
#=GS G8B8T9_CANPC/229-311        AC G8B8T9.1
#=GS G0QRE6_ICHMG/21-108         AC G0QRE6.1
#=GS I1CHH6_RHIO9/20-105         AC I1CHH6.1
#=GS A0A3M0JHT0_HIRRU/122-220    AC A0A3M0JHT0.1
#=GS A0A6P6MSX3_CARAU/231-315    AC A0A6P6MSX3.1
#=GS A0A078B325_STYLE/32-117     AC A0A078B325.1
#=GS A0A1S3Y0Y1_TOBAC/17-111     AC A0A1S3Y0Y1.1
#=GS A0A314KRS1_NICAT/17-111     AC A0A314KRS1.1
#=GS A0A1Q5UIZ8_9EURO/229-312    AC A0A1Q5UIZ8.1
#=GS A0A5N5HXU2_9ROSA/9-68       AC A0A5N5HXU2.1
#=GS A0A2X0KKL2_9BASI/229-310    AC A0A2X0KKL2.1
#=GS A0A024X6D8_PLAFC/231-315    AC A0A024X6D8.1
#=GS A0A1A6G4K8_NEOLE/22-66      AC A0A1A6G4K8.1
#=GS C4M4I3_ENTHI/16-105         AC C4M4I3.1
#=GS A0A5E4G3K9_PRUDU/17-112     AC A0A5E4G3K9.1
#=GS C5ME44_CANTT/20-106         AC C5ME44.1
#=GS A0A176VYG5_MARPO/17-112     AC A0A176VYG5.1
#=GS C5YVH3_SORBI/234-317        AC C5YVH3.1
#=GS A0A060WJW3_ONCMY/36-132     AC A0A060WJW3.1
#=GS A0A3L8T169_CHLGU/22-113     AC A0A3L8T169.1
#=GS A0A061G2B7_THECC/337-423    AC A0A061G2B7.1
#=GS A0A668U735_OREAU/169-252    AC A0A668U735.1
#=GS A0A1X0P470_9TRYP/238-323    AC A0A1X0P470.1
#=GS A0A0D3HHW0_9ORYZ/658-743    AC A0A0D3HHW0.1
#=GS A0A1A5ZVJ1_9TREE/20-105     AC A0A1A5ZVJ1.1
#=GS F0U5V7_AJEC8/21-109         AC F0U5V7.1
#=GS D3E154_METRM/230-334        AC D3E154.1
#=GS A0A2K6P440_RHIRO/186-267    AC A0A2K6P440.1
#=GS A0A654HG52_9CEST/223-313    AC A0A654HG52.1
#=GS A0A2T9Z9W6_9FUNG/17-57      AC A0A2T9Z9W6.1
#=GS I1I0I0_BRADI/21-109         AC I1I0I0.1
#=GS A0A2A9PHS9_9HYPO/22-109     AC A0A2A9PHS9.1
#=GS A0A5A7QZX7_STRAF/150-238    AC A0A5A7QZX7.1
#=GS A0A2K0WE90_GIBNY/21-108     AC A0A2K0WE90.1
#=GS A0A5M9JRP1_MONFR/277-359    AC A0A5M9JRP1.1
#=GS H8ZB36_NEMS1/20-98          AC H8ZB36.1
#=GS A0A409VU13_9AGAR/229-311    AC A0A409VU13.1
#=GS A0A364L012_9EURO/229-312    AC A0A364L012.1
#=GS A0A445HGE7_GLYSO/17-113     AC A0A445HGE7.1
#=GS A0A3R7C8K2_CLOSI/17-117     AC A0A3R7C8K2.1
#=GS A0A1E3NT89_9ASCO/22-107     AC A0A1E3NT89.1
#=GS M0LF70_9EURY/16-112         AC M0LF70.1
#=GS R0IWB7_SETT2/229-313        AC R0IWB7.1
#=GS V7AS03_PHAVU/24-111         AC V7AS03.1
#=GS A0A0J7JZM0_LASNI/22-112     AC A0A0J7JZM0.1
#=GS J9JRN4_ACYPI/23-110         AC J9JRN4.1
#=GS A0A2R9A5P9_PANPA/169-254    AC A0A2R9A5P9.1
#=GS A0A2K5XYR7_MANLE/169-255    AC A0A2K5XYR7.1
#=GS A0A6P8ZID2_THRPL/231-314    AC A0A6P8ZID2.1
#=GS A0A5F5PRF6_HORSE/18-88      AC A0A5F5PRF6.1
#=GS B4JDP3_DROGR/22-111         AC B4JDP3.1
#=GS A0A232LP70_9EURO/21-108     AC A0A232LP70.1
#=GS A0A4Y7QJZ7_9AGAM/21-110     AC A0A4Y7QJZ7.1
#=GS Q5B0D4_EMENI/17-108         AC Q5B0D4.1
#=GS A0A1U8NYI9_GOSHI/17-113     AC A0A1U8NYI9.1
#=GS C5E3Q9_LACTC/20-106         AC C5E3Q9.1
#=GS D8RTH0_SELML/234-317        AC D8RTH0.1
#=GS A2DSX3_TRIVA/20-103         AC A2DSX3.1
#=GS A0A7F5RAL1_AGRPL/231-315    AC A0A7F5RAL1.1
#=GS A0A1E4TGS9_9ASCO/16-108     AC A0A1E4TGS9.1
#=GS R4WA47_9EURY/16-114         AC R4WA47.1
#=GS A0A0D2RBU4_GOSRA/17-112     AC A0A0D2RBU4.1
#=GS A0A5M3MJ41_CONPW/17-111     AC A0A5M3MJ41.1
#=GS A0A0D3GKH0_9ORYZ/61-118     AC A0A0D3GKH0.1
#=GS N4U857_FUSC1/21-108         AC N4U857.1
#=GS A0A0A2VZW8_BEABA/229-311    AC A0A0A2VZW8.1
#=GS A0A0D2QDP7_GOSRA/21-111     AC A0A0D2QDP7.1
#=GS T1GDU0_MEGSC/22-110         AC T1GDU0.1
#=GS A0A1Y2DSW1_9PEZI/17-112     AC A0A1Y2DSW1.1
#=GS G0QAR6_NANSJ/1-84           AC G0QAR6.1
#=GS A0A316YQI3_9BASI/21-111     AC A0A316YQI3.1
#=GS A0A5E3WLY6_9AGAM/229-312    AC A0A5E3WLY6.1
#=GS A0A6H5G042_9HEMI/231-314    AC A0A6H5G042.1
#=GS A0A1J1H5I5_PLARL/231-315    AC A0A1J1H5I5.1
#=GS U1HW83_ENDPU/229-313        AC U1HW83.1
#=GS G3P155_GASAC/231-289        AC G3P155.1
#=GS G0V665_NAUCC/20-106         AC G0V665.1
#=GS B8BAG5_ORYSI/131-215        AC B8BAG5.1
#=GS A0A0A1NHV7_RHIZD/228-309    AC A0A0A1NHV7.1
#=GS A0A420I865_9PEZI/230-309    AC A0A420I865.1
#=GS A0A4S8JCB5_MUSBA/17-114     AC A0A4S8JCB5.1
#=GS A0A194WT18_9HELO/17-112     AC A0A194WT18.1
#=GS A0A7M6USA7_APIME/22-110     AC A0A7M6USA7.1
#=GS A0A091IMG1_EGRGA/17-114     AC A0A091IMG1.1
#=GS A0A2G5D6V2_AQUCA/17-114     AC A0A2G5D6V2.1
#=GS B6T361_MAIZE/21-108         AC B6T361.1
#=GS G7E8R9_MIXOS/66-160         AC G7E8R9.1
#=GS K2RHF1_MACPH/229-314        AC K2RHF1.1
#=GS A0A2P6VBR3_9CHLO/233-312    AC A0A2P6VBR3.1
#=GS A0A3N4MCY8_9PEZI/229-312    AC A0A3N4MCY8.1
#=GS C1HAX7_PARBA/21-110         AC C1HAX7.1
#=GS A0A0B0PKP6_GOSAR/234-320    AC A0A0B0PKP6.1
#=GS A0A6P3VZU6_CLUHA/231-315    AC A0A6P3VZU6.1
#=GS A0A397Y8G4_BRACM/22-112     AC A0A397Y8G4.1
#=GS A0A433TGI5_ELYCH/66-161     AC A0A433TGI5.1
#=GS C4Y3A1_CLAL4/17-109         AC C4Y3A1.1
#=GS J4WBR8_BEAB2/21-107         AC J4WBR8.1
#=GS S8BAH7_DACHA/229-312        AC S8BAH7.1
#=GS A0A0W8BZE9_PHYNI/231-311    AC A0A0W8BZE9.1
#=GS A0A0W4ZEM8_PNEJ7/17-106     AC A0A0W4ZEM8.1
#=GS A0A1D8PQS0_CANAL/229-311    AC A0A1D8PQS0.1
#=GS A0A0E0AHQ1_9ORYZ/17-86      AC A0A0E0AHQ1.1
#=GS A0A3Q7EBE5_SOLLC/21-109     AC A0A3Q7EBE5.1
#=GS A0A3B5ZWM4_WHEAT/17-111     AC A0A3B5ZWM4.1
#=GS A0A452IDJ1_9SAUR/10-77      AC A0A452IDJ1.1
#=GS E4XMZ9_OIKDI/17-107         AC E4XMZ9.1
#=GS A0A2G3BKE4_CAPCH/19-100     AC A0A2G3BKE4.1
#=GS A0A452GJW1_9SAUR/22-112     AC A0A452GJW1.1
#=GS A0A4U1FJT0_MONMO/36-117     AC A0A4U1FJT0.1
#=GS A0A179FQN2_METCM/17-110     AC A0A179FQN2.1
#=GS A0A5N5DIY2_9PEZI/17-110     AC A0A5N5DIY2.1
#=GS A0A024WER9_PLAFA/19-111     AC A0A024WER9.1
#=GS A0A0E0MC60_ORYPU/213-287    AC A0A0E0MC60.1
#=GS S8DY94_FOMPI/229-314        AC S8DY94.1
#=GS A0A2H6K9W8_9APIC/231-312    AC A0A2H6K9W8.1
#=GS A0A6I9RWI5_ELAGV/16-121     AC A0A6I9RWI5.1
#=GS A0A2G3BXJ2_CAPCH/17-113     AC A0A2G3BXJ2.1
#=GS A0A5N5JXU5_PANHP/231-315    AC A0A5N5JXU5.1
#=GS A0A0J8RTS2_COCIT/21-110     AC A0A0J8RTS2.1
#=GS A0A699YKQ7_HAELA/130-181    AC A0A699YKQ7.1
#=GS H9J1M5_BOMMO/22-111         AC H9J1M5.1
#=GS M2SSE6_COCSN/21-111         AC M2SSE6.1
#=GS M1BB70_SOLTU/21-110         AC M1BB70.1
#=GS A0A165GVM3_9APHY/56-145     AC A0A165GVM3.1
#=GS A0A226EJ17_FOLCA/526-620    AC A0A226EJ17.1
#=GS A0A0G2FEG5_9PEZI/21-108     AC A0A0G2FEG5.1
#=GS A0DCV4_PARTE/34-121         AC A0DCV4.1
#=GS L0PHG7_PNEJ8/192-270        AC L0PHG7.1
#=GS Q2RAW0_ORYSJ/234-319        AC Q2RAW0.1
#=GS F6I2S7_VITVI/21-112         AC F6I2S7.1
#=GS A0A437AID5_9MICR/16-100     AC A0A437AID5.1
#=GS S8DIA1_9LAMI/1-52           AC S8DIA1.1
#=GS A0A1V4JRE0_PATFA/231-316    AC A0A1V4JRE0.1
#=GS A0A3Q7UDG4_URSAR/22-113     AC A0A3Q7UDG4.1
#=GS A0A1J4J3L2_9EUKA/1-75       AC A0A1J4J3L2.1
#=GS A0A6A4VHR2_AMPAM/22-107     AC A0A6A4VHR2.1
#=GS G8ZXR8_TORDC/20-105         AC G8ZXR8.1
#=GS A0A067NM16_PLEOS/229-310    AC A0A067NM16.1
#=GS A0A4Y7LAG2_PAPSO/17-108     AC A0A4Y7LAG2.1
#=GS A0A059F175_9MICR/9-94       AC A0A059F175.1
#=GS A0A087GBM9_ARAAL/60-119     AC A0A087GBM9.1
#=GS A0A1M2V2Y2_TRAPU/17-110     AC A0A1M2V2Y2.1
#=GS A0A6P4I7F5_DROKI/17-112     AC A0A6P4I7F5.1
#=GS A0A024GL08_9STRA/420-510    AC A0A024GL08.1
#=GS A0A177UG12_9BASI/17-111     AC A0A177UG12.1
#=GS B6K7X3_SCHJY/229-310        AC B6K7X3.1
#=GS A0A094CIH1_9PEZI/54-141     AC A0A094CIH1.1
#=GS A0A3Q3GI94_9LABR/17-113     AC A0A3Q3GI94.1
#=GS A0A6P9B4N5_PANGU/231-314    AC A0A6P9B4N5.1
#=GS A0A0R3X8C1_HYDTA/22-85      AC A0A0R3X8C1.1
#=GS A0A5N5WW65_9EURO/21-108     AC A0A5N5WW65.1
#=GS E2A1L0_CAMFO/22-112         AC E2A1L0.1
#=GS A0A6P9EKB2_JUGRE/17-93      AC A0A6P9EKB2.1
#=GS M0S0G8_MUSAM/22-114         AC M0S0G8.1
#=GS A0A0D9SB36_CHLSB/22-113     AC A0A0D9SB36.1
#=GS A0A5N6TP82_9EURO/21-107     AC A0A5N6TP82.1
#=GS A0A6P6KI31_CARAU/17-113     AC A0A6P6KI31.1
#=GS A0A6A2W9K0_HIBSY/22-112     AC A0A6A2W9K0.1
#=GS A0A2P8YFE7_BLAGE/17-113     AC A0A2P8YFE7.1
#=GS A0A444FGD4_ENSVE/1-88       AC A0A444FGD4.1
#=GS A0A5D2TRG2_GOSMU/22-113     AC A0A5D2TRG2.1
#=GS A0A6J0ZVL2_9ROSI/17-111     AC A0A6J0ZVL2.1
#=GS A2DI06_TRIVA/17-103         AC A2DI06.1
#=GS B8C818_THAPS/27-114         AC B8C818.1
#=GS D8LXI8_BLAHO/1-64           AC D8LXI8.1
#=GS G0W7P6_NAUDC/17-110         AC G0W7P6.1
#=GS A0A4S3TNQ1_9EURY/16-113     AC A0A4S3TNQ1.1
#=GS M4AVA7_XIPMA/169-251        AC M4AVA7.2
#=GS A0A2U9CY05_SCOMX/22-112     AC A0A2U9CY05.1
#=GS A0A166DJ68_DAUCS/17-112     AC A0A166DJ68.1
#=GS A0A6S7NHW7_LACSI/84-176     AC A0A6S7NHW7.1
#=GS A0A1Y2B2M4_9TREE/17-113     AC A0A1Y2B2M4.1
#=GS A0A7M7R7K5_APIME/231-316    AC A0A7M7R7K5.1
#=GS A0A401Q300_SCYTO/22-115     AC A0A401Q300.1
#=GS U7Q1K0_SPOS1/21-109         AC U7Q1K0.1
#=GS A0A3B5Y2A7_WHEAT/17-112     AC A0A3B5Y2A7.1
#=GS A0A2G5VL84_9PELO/17-107     AC A0A2G5VL84.1
#=GS A0A6I9RHQ3_ELAGV/234-319    AC A0A6I9RHQ3.1
#=GS S7NBP8_MYOBR/23-113         AC S7NBP8.1
#=GS S7ZG64_PENO1/21-108         AC S7ZG64.1
#=GS A0A498HLF4_MALDO/18-120     AC A0A498HLF4.1
#=GS A0A1G4ANV7_9PEZI/21-108     AC A0A1G4ANV7.1
#=GS A0A1G8V0B5_9EURY/16-111     AC A0A1G8V0B5.1
#=GS A0A098VQZ2_9MICR/228-307    AC A0A098VQZ2.1
#=GS A0A7I4BBL0_PHYPA/21-105     AC A0A7I4BBL0.1
#=GS H3FJL9_PRIPA/298-370        AC H3FJL9.2
#=GS A0A6P5JNP6_PHACI/17-115     AC A0A6P5JNP6.1
#=GS A0A5P1F1E7_ASPOF/128-174    AC A0A5P1F1E7.1
#=GS A0A2S4UHZ0_9BASI/14-109     AC A0A2S4UHZ0.1
#=GS E0VFW6_PEDHC/231-320        AC E0VFW6.1
#=GS A0A6J1HYE9_CUCMA/17-114     AC A0A6J1HYE9.1
#=GS A0A0P1AWW6_PLAHL/379-467    AC A0A0P1AWW6.1
#=GS A0A0A0KM27_CUCSA/234-319    AC A0A0A0KM27.1
#=GS A0A1U7EYL6_NATPD/16-115     AC A0A1U7EYL6.1
#=GS G5BH66_HETGA/159-244        AC G5BH66.1
#=GS A5E756_LODEL/229-313        AC A5E756.1
#=GS A0A176VN31_MARPO/21-109     AC A0A176VN31.1
#=GS G1SC28_NOMLE/17-114         AC G1SC28.1
#=GS A1BQ85_STRRB/231-312        AC A1BQ85.1
#=GS A0A1S9DM63_ASPOZ/229-312    AC A0A1S9DM63.1
#=GS A0A135LYP5_PENPA/17-108     AC A0A135LYP5.1
#=GS A0A391NP73_9EUKA/17-104     AC A0A391NP73.1
#=GS A0A4T0X1F9_9ASCO/20-104     AC A0A4T0X1F9.1
#=GS A0A074Z284_AURSE/21-107     AC A0A074Z284.1
#=GS A0A091JE59_EGRGA/205-291    AC A0A091JE59.1
#=GS A0A0E0G7N6_ORYNI/535-630    AC A0A0E0G7N6.1
#=GS A0A3Q0DRM7_CARSF/131-206    AC A0A3Q0DRM7.1
#=GS A0A3P7YTF9_HAEPC/68-160     AC A0A3P7YTF9.1
#=GS A0A448YIF7_BRENA/17-106     AC A0A448YIF7.1
#=GS A0A1Y1ZSD9_9FUNG/28-119     AC A0A1Y1ZSD9.1
#=GS I2FMZ5_USTH4/17-110         AC I2FMZ5.1
#=GS A0A507EPE1_9FUNG/1-86       AC A0A507EPE1.1
#=GS A0A6J1CS45_MOMCH/21-112     AC A0A6J1CS45.1
#=GS K0IF01_NITGG/16-103         AC K0IF01.1
#=GS A0A6J0XKI1_ODOVR/3-85       AC A0A6J0XKI1.1
#=GS A0A484DNN8_PERFV/17-112     AC A0A484DNN8.1
#=GS A0A1B7NS26_9EURO/21-110     AC A0A1B7NS26.1
#=GS A0A5D2TLW4_GOSMU/21-111     AC A0A5D2TLW4.1
#=GS A0A673TLE7_SURSU/32-123     AC A0A673TLE7.1
#=GS A0A1S8VQ04_9FUNG/231-316    AC A0A1S8VQ04.1
#=GS G0N3U9_CAEBE/22-110         AC G0N3U9.1
#=GS A0A4W4DYD8_ELEEL/169-254    AC A0A4W4DYD8.1
#=GS A0A5J9VET6_9POAL/234-319    AC A0A5J9VET6.1
#=GS U1Q0N4_9EURY/1-91           AC U1Q0N4.1
#=GS A0A4W4FTX5_ELEEL/22-110     AC A0A4W4FTX5.1
#=GS A0A7H9B946_ZYGMR/19-105     AC A0A7H9B946.1
#=GS A0A1V6RLF6_9EURO/229-310    AC A0A1V6RLF6.1
#=GS I1C561_RHIO9/17-107         AC I1C561.1
#=GS A0A421JBR0_9ASCO/32-121     AC A0A421JBR0.1
#=GS A0A166VKM2_9HYPO/229-312    AC A0A166VKM2.1
#=GS A0A346PQQ2_9EURY/16-109     AC A0A346PQQ2.1
#=GS A0A6P8S0D7_GEOSA/231-313    AC A0A6P8S0D7.1
#=GS W2TJN6_NECAM/227-317        AC W2TJN6.1
#=GS C5FTI4_ARTOC/229-311        AC C5FTI4.1
#=GS A0A6P3FGF3_OCTDE/22-113     AC A0A6P3FGF3.1
#=GS F9VP34_SULTO/16-104         AC F9VP34.1
#=GS A0A6P6KCL1_CARAU/17-115     AC A0A6P6KCL1.1
#=GS A0A059IXM0_TRIIM/17-112     AC A0A059IXM0.1
#=GS A0A662Y380_9STRA/27-109     AC A0A662Y380.1
#=GS F7B587_CIOIN/43-107         AC F7B587.2
#=GS A0A4P9XYP8_9FUNG/17-107     AC A0A4P9XYP8.1
#=GS A0A0D3HR31_9ORYZ/795-880    AC A0A0D3HR31.1
#=GS A0A5N5FAH1_9ROSA/428-524    AC A0A5N5FAH1.1
#=GS A0A1G4JLZ5_9SACH/19-105     AC A0A1G4JLZ5.1
#=GS A0A317XKU3_9BASI/230-314    AC A0A317XKU3.1
#=GS A0A6I9JU06_CHRAS/169-254    AC A0A6I9JU06.1
#=GS A0A6H5L359_9PHAE/10-102     AC A0A6H5L359.1
#=GS A0A4Z1SPV3_GIAMU/21-104     AC A0A4Z1SPV3.1
#=GS A0A090LCS1_STRRB/22-110     AC A0A090LCS1.1
#=GS A0A2H9ZWM8_9ASPA/21-112     AC A0A2H9ZWM8.1
#=GS A0A094BPA1_9PEZI/66-153     AC A0A094BPA1.1
#=GS A0A3B5KFJ9_TAKRU/207-289    AC A0A3B5KFJ9.2
#=GS A0A2K6FJQ2_PROCO/22-113     AC A0A2K6FJQ2.1
#=GS M1WH55_CLAP2/21-108         AC M1WH55.1
#=GS A0A420YNW1_9PEZI/21-109     AC A0A420YNW1.1
#=GS A0A673UI77_SURSU/221-306    AC A0A673UI77.1
#=GS A0A673WWI6_SALTR/231-314    AC A0A673WWI6.1
#=GS U6MLN7_9EIME/32-121         AC U6MLN7.1
#=GS A0A5N6DVH5_ASPPA/21-107     AC A0A5N6DVH5.1
#=GS A0A091PTH3_LEPDC/17-58      AC A0A091PTH3.1
#=GS A0A6J0LXT5_RAPSA/17-111     AC A0A6J0LXT5.1
#=GS A0A267EF72_9PLAT/26-114     AC A0A267EF72.1
#=GS W4HAU7_9STRA/16-106         AC W4HAU7.1
#=GS F7B9X0_MONDO/231-316        AC F7B9X0.2
#=GS A0A2F0BIB5_ESCRO/12-84      AC A0A2F0BIB5.1
#=GS A0A1Z5SV74_HORWE/21-110     AC A0A1Z5SV74.1
#=GS A0A671F6R1_RHIFE/169-254    AC A0A671F6R1.1
#=GS A0A3L6T6Y8_PANMI/17-111     AC A0A3L6T6Y8.1
#=GS A0A367KT32_RHIST/17-106     AC A0A367KT32.1
#=GS D8TVT6_VOLCA/17-105         AC D8TVT6.1
#=GS A0A0A7LDB7_9ARCH/231-336    AC A0A0A7LDB7.1
#=GS V7BVP3_PHAVU/17-111         AC V7BVP3.1
#=GS A0A2S7NNU1_9HELO/21-110     AC A0A2S7NNU1.1
#=GS A0A067TBL1_GALM3/17-130     AC A0A067TBL1.1
#=GS I2K068_DEKBR/17-108         AC I2K068.1
#=GS U6KE79_9EIME/32-123         AC U6KE79.1
#=GS A0A2H9TNQ7_9FUNG/22-109     AC A0A2H9TNQ7.1
#=GS A0A0R3PUL8_ANGCS/170-261    AC A0A0R3PUL8.1
#=GS A0A2K5YEA2_MANLE/26-116     AC A0A2K5YEA2.1
#=GS A0A1F5LKH8_9EURO/17-108     AC A0A1F5LKH8.1
#=GS A0A0J0XYL4_9TREE/229-312    AC A0A0J0XYL4.1
#=GS S2JH09_MUCC1/17-106         AC S2JH09.1
#=GS A0A1U8P2M3_GOSHI/22-113     AC A0A1U8P2M3.1
#=GS A0A1V6SCH3_9EURO/229-312    AC A0A1V6SCH3.1
#=GS A0A2P6QAK8_ROSCH/21-107     AC A0A2P6QAK8.1
#=GS A0A1S3VST7_VIGRR/234-319    AC A0A1S3VST7.1
#=GS A0A0L0HTW5_SPIPD/17-110     AC A0A0L0HTW5.1
#=GS G2Q8N2_MYCTT/21-110         AC G2Q8N2.1
#=GS A0A401GZM6_9APHY/21-109     AC A0A401GZM6.1
#=GS A0A1Z5JYP7_FISSO/33-120     AC A0A1Z5JYP7.1
#=GS A0A2A4IY56_HELVI/17-111     AC A0A2A4IY56.1
#=GS F7FX28_MACMU/22-113         AC F7FX28.1
#=GS A0A0D2MCW1_HYPSF/27-116     AC A0A0D2MCW1.1
#=GS X0D2L5_FUSOX/21-108         AC X0D2L5.1
#=GS A0A1B9GN79_9TREE/17-112     AC A0A1B9GN79.1
#=GS A0A2K5PQI6_CEBIM/231-316    AC A0A2K5PQI6.1
#=GS A0A2K5X6Z8_MACFA/22-113     AC A0A2K5X6Z8.1
#=GS A0A267FR75_9PLAT/260-343    AC A0A267FR75.1
#=GS A0A367K7X0_RHIAZ/20-105     AC A0A367K7X0.1
#=GS A0A4Z0A2D6_9AGAM/17-110     AC A0A4Z0A2D6.1
#=GS A0A421EU73_9STRA/17-103     AC A0A421EU73.1
#=GS A0A2G2W8Q0_CAPBA/21-111     AC A0A2G2W8Q0.1
#=GS B4LTL2_DROVI/22-111         AC B4LTL2.1
#=GS A0A2U1QDM6_ARTAN/21-109     AC A0A2U1QDM6.1
#=GS A0A3S3QSQ2_9MAGN/17-114     AC A0A3S3QSQ2.1
#=GS A0A443P6X0_9MAGN/21-110     AC A0A443P6X0.1
#=GS A0A1Z5R3Y1_SORBI/25-119     AC A0A1Z5R3Y1.1
#=GS A0A4U0TMK2_9PEZI/259-337    AC A0A4U0TMK2.1
#=GS A0A084VRD1_ANOSI/17-112     AC A0A084VRD1.1
#=GS A0A5D2Y4D0_GOSMU/17-112     AC A0A5D2Y4D0.1
#=GS A0A2K6CSY7_MACNE/186-268    AC A0A2K6CSY7.1
#=GS A0A183BGJ4_9TREM/17-114     AC A0A183BGJ4.1
#=GS A0A6P6AIJ7_DURZI/17-115     AC A0A6P6AIJ7.1
#=GS A0A498H5X6_9EURY/16-101     AC A0A498H5X6.1
#=GS G3ILE6_CRIGR/22-107         AC G3ILE6.1
#=GS A0A402FKV0_9SAUR/247-330    AC A0A402FKV0.1
#=GS A0A0M3QVW7_DROBS/231-318    AC A0A0M3QVW7.1
#=GS A2BJV6_HYPBU/34-125         AC A2BJV6.1
#=GS A0A0D8XQZ1_DICVI/3-87       AC A0A0D8XQZ1.1
#=GS A0A2H1BUI8_FASHE/21-113     AC A0A2H1BUI8.1
#=GS A0A4S8JQM1_MUSBA/22-111     AC A0A4S8JQM1.1
#=GS A0A1E3NPS2_9ASCO/229-311    AC A0A1E3NPS2.1
#=GS A0A2J6PVI9_9HELO/230-314    AC A0A2J6PVI9.1
#=GS A9T572_PHYPA/25-119         AC A9T572.1
#=GS A0A3B6TNZ4_WHEAT/35-119     AC A0A3B6TNZ4.1
#=GS RL12_ARCFU/16-105           AC O28780.1
#=GS A0A0G4EUV7_VITBC/32-126     AC A0A0G4EUV7.1
#=GS A0A2P5HLA4_9PEZI/25-112     AC A0A2P5HLA4.1
#=GS A0A2S4VMD3_9BASI/18-112     AC A0A2S4VMD3.1
#=GS A0A6P5D3C6_BOSIN/231-317    AC A0A6P5D3C6.1
#=GS A0A444D776_ENSVE/17-114     AC A0A444D776.1
#=GS A0A6A3TN79_9STRA/29-112     AC A0A6A3TN79.1
#=GS A0A446YR31_TRITD/16-119     AC A0A446YR31.1
#=GS R0EU65_9BRAS/22-112         AC R0EU65.1
#=GS A8XGJ1_CAEBR/17-107         AC A8XGJ1.1
#=GS A0A3Q7WY24_CICAR/21-99      AC A0A3Q7WY24.1
#=GS M1VBF0_CYAM1/17-116         AC M1VBF0.1
#=GS A0A0L0VRN3_9BASI/19-106     AC A0A0L0VRN3.1
#=GS S4RZ84_PETMA/19-117         AC S4RZ84.1
#=GS E4Y051_OIKDI/232-310        AC E4Y051.1
#=GS U6LJP1_9EIME/49-140         AC U6LJP1.1
#=GS A0A0H5CK00_CYBJN/229-311    AC A0A0H5CK00.1
#=GS A0A2K6RBK7_RHIRO/169-255    AC A0A2K6RBK7.1
#=GS A0A087H441_ARAAL/234-317    AC A0A087H441.1
#=GS A0A2I4F7S8_JUGRE/17-95      AC A0A2I4F7S8.1
#=GS A0A444SFT1_ARMVU/22-68      AC A0A444SFT1.1
#=GS A0A421J6L5_9ASCO/254-338    AC A0A421J6L5.1
#=GS A0A0F8B892_CERFI/229-311    AC A0A0F8B892.1
#=GS A0A094DC69_9PEZI/66-153     AC A0A094DC69.1
#=GS K0KQI6_WICCF/20-107         AC K0KQI6.1
#=GS A0A643C2J4_BALPH/22-92      AC A0A643C2J4.1
#=GS A0A2G5CDK6_AQUCA/17-112     AC A0A2G5CDK6.1
#=GS A0A4P2VGA3_9ARCH/16-104     AC A0A4P2VGA3.1
#=GS A0A4Q9PMR9_9APHY/229-310    AC A0A4Q9PMR9.1
#=GS E4X7T3_OIKDI/17-108         AC E4X7T3.1
#=GS A0A0A0KGP6_CUCSA/17-114     AC A0A0A0KGP6.1
#=GS A0A6P6WJ27_COFAR/21-101     AC A0A6P6WJ27.1
#=GS L8FQZ3_PSED2/17-108         AC L8FQZ3.1
#=GS W4IUC6_PLAFP/231-315        AC W4IUC6.1
#=GS A0A132AE91_SARSC/63-106     AC A0A132AE91.1
#=GS L5MAJ1_MYODS/22-83          AC L5MAJ1.1
#=GS M1AS83_SOLTU/17-111         AC M1AS83.1
#=GS A0A6P3Q4S8_PTEVA/231-316    AC A0A6P3Q4S8.1
#=GS A0A498JWK3_MALDO/44-116     AC A0A498JWK3.1
#=GS A0A3Q1EGM1_9TELE/169-251    AC A0A3Q1EGM1.1
#=GS A0A1Q3ATX3_CEPFO/17-116     AC A0A1Q3ATX3.1
#=GS B6U9H1_MAIZE/88-171         AC B6U9H1.1
#=GS A0A0C3NRG8_PHLGI/21-109     AC A0A0C3NRG8.1
#=GS A0A4Z1HEN8_9HELO/229-313    AC A0A4Z1HEN8.1
#=GS A0A2G5DPY7_AQUCA/34-116     AC A0A2G5DPY7.1
#=GS K3WA32_GLOUD/17-106         AC K3WA32.1
#=GS A0A0A1TIA0_9HYPO/17-109     AC A0A0A1TIA0.1
#=GS A0A1X1BI63_9APIC/231-310    AC A0A1X1BI63.1
#=GS A0A2K6NU43_RHIRO/18-88      AC A0A2K6NU43.1
#=GS A0A0D9NSQ2_METAN/17-109     AC A0A0D9NSQ2.1
#=GS K3Y023_SETIT/59-119         AC K3Y023.1
#=GS A0A0E0ADY9_9ORYZ/57-118     AC A0A0E0ADY9.1
#=GS A0A5D2VMP2_GOSMU/234-320    AC A0A5D2VMP2.1
#=GS W1P0E4_AMBTC/21-112         AC W1P0E4.1
#=GS S8D2Z2_9LAMI/19-120         AC S8D2Z2.1
#=GS A0A2C6A941_9HYPO/229-312    AC A0A2C6A941.1
#=GS A0A2R9AKQ4_PANPA/189-273    AC A0A2R9AKQ4.1
#=GS A0A5N6EF12_9EURO/21-107     AC A0A5N6EF12.1
#=GS B4ICW8_DROSE/22-111         AC B4ICW8.1
#=GS R7YQN4_CONA1/250-335        AC R7YQN4.1
#=GS A8MQK8_ARATH/22-95          AC A8MQK8.1
#=GS A0A1S4BZQ0_TOBAC/234-321    AC A0A1S4BZQ0.1
#=GS A0A1Y2GEW6_9FUNG/17-108     AC A0A1Y2GEW6.1
#=GS A0A5N5SY26_9CRUS/16-101     AC A0A5N5SY26.1
#=GS K0KRG8_WICCF/229-311        AC K0KRG8.1
#=GS A0A1U7SB06_ALLSI/17-114     AC A0A1U7SB06.1
#=GS D8LYJ5_BLAHO/230-312        AC D8LYJ5.1
#=GS N6WJT7_9ARCH/16-107         AC N6WJT7.1
#=GS A0A1V6NSY4_9EURO/17-107     AC A0A1V6NSY4.1
#=GS A0A4U6W4I1_SETVI/234-318    AC A0A4U6W4I1.1
#=GS A0A164RK41_9AGAM/21-112     AC A0A164RK41.1
#=GS A0A384DJ19_URSMA/22-113     AC A0A384DJ19.1
#=GS A0A1Y1ZB16_9FUNG/17-108     AC A0A1Y1ZB16.1
#=GS A0A1S7H959_9SACH/229-311    AC A0A1S7H959.1
#=GS A0A6J0KYS6_RAPSA/22-112     AC A0A6J0KYS6.1
#=GS A0A5E8BE92_9ASCO/20-104     AC A0A5E8BE92.1
#=GS A0A2P6N6P3_9EUKA/169-261    AC A0A2P6N6P3.1
#=GS G9P7V9_HYPAI/229-312        AC G9P7V9.1
#=GS A0A2G2X7U2_CAPBA/21-109     AC A0A2G2X7U2.1
#=GS A0A1J9R3B3_9PEZI/56-143     AC A0A1J9R3B3.1
#=GS A0A2G3BY02_CAPCH/17-114     AC A0A2G3BY02.1
#=GS F0ZYT9_DICPU/317-405        AC F0ZYT9.1
#=GS A0A1Q9CEK3_SYMMI/542-625    AC A0A1Q9CEK3.1
#=GS A0A7D8YY20_9HELO/229-314    AC A0A7D8YY20.1
#=GS A0A6I9JID8_CHRAS/232-309    AC A0A6I9JID8.1
#=GS A0A091NRI7_APAVI/17-114     AC A0A091NRI7.1
#=GS A0A167JMG3_PHYB8/20-105     AC A0A167JMG3.1
#=GS A0A2P6QRD2_ROSCH/261-346    AC A0A2P6QRD2.1
#=GS A0A3P8Z9B9_ESOLU/169-252    AC A0A3P8Z9B9.1
#=GS A0A6P4CUR9_ARADU/23-118     AC A0A6P4CUR9.1
#=GS RL12_HALSA/16-113           AC P05768.1
#=GS A0A166E125_9AGAM/229-313    AC A0A166E125.1
#=GS A0A0K3C9A2_RHOTO/229-298    AC A0A0K3C9A2.1
#=GS A0A261Y2Y0_9FUNG/231-308    AC A0A261Y2Y0.1
#=GS A0A0W0FZB5_9AGAR/17-112     AC A0A0W0FZB5.1
#=GS A0A225X3C5_9STRA/29-111     AC A0A225X3C5.1
#=GS A0A4Q4VDY5_9PEZI/17-111     AC A0A4Q4VDY5.1
#=GS A0A151R1T8_CAJCA/23-119     AC A0A151R1T8.1
#=GS A0A166HTJ9_DAUCS/21-119     AC A0A166HTJ9.1
#=GS A2FPV1_TRIVA/17-104         AC A2FPV1.1
#=GS A0A3B5KET0_TAKRU/169-251    AC A0A3B5KET0.1
#=GS A0A6A4QAG8_LUPAL/16-117     AC A0A6A4QAG8.1
#=GS A0A3A2ZY67_9EURO/21-106     AC A0A3A2ZY67.1
#=GS A0A1Z5SS47_HORWE/83-172     AC A0A1Z5SS47.1
#=GS A0A7E5VDW5_TRINI/22-111     AC A0A7E5VDW5.1
#=GS A0A1S3C6N6_CUCME/234-319    AC A0A1S3C6N6.1
#=GS A0A673TLE4_SURSU/18-88      AC A0A673TLE4.1
#=GS A0A340WVF0_LIPVE/18-80      AC A0A340WVF0.1
#=GS A0A5C2SKR8_9APHY/17-110     AC A0A5C2SKR8.1
#=GS H8ZE01_NEMS1/54-137         AC H8ZE01.1
#=GS B0XBM1_CULQU/64-135         AC B0XBM1.1
#=GS A0A1S3IUH7_LINUN/17-112     AC A0A1S3IUH7.1
#=GS H0V6G7_CAVPO/17-114         AC H0V6G7.1
#=GS A0A433D2N4_9FUNG/17-111     AC A0A433D2N4.1
#=GS D9Q016_ACIS3/21-112         AC D9Q016.1
#=GS A0A1E3Q8R5_LIPST/19-105     AC A0A1E3Q8R5.1
#=GS A0A063ZSC1_9EURY/16-114     AC A0A063ZSC1.1
#=GS A0A0D2IPJ3_9EURO/21-113     AC A0A0D2IPJ3.1
#=GS A0A163KTI0_DIDRA/17-111     AC A0A163KTI0.1
#=GS H0V2W3_CAVPO/22-113         AC H0V2W3.1
#=GS A0A1B8B9G7_FUSPO/21-108     AC A0A1B8B9G7.1
#=GS A0A0C3FIH5_PILCF/229-312    AC A0A0C3FIH5.1
#=GS A0A6P5JY45_PHACI/21-114     AC A0A6P5JY45.1
#=GS A0A058ZEL2_FONAL/20-105     AC A0A058ZEL2.1
#=GS Q4RIG8_TETNG/17-114         AC Q4RIG8.1
#=GS A0A286UJ81_9AGAM/17-109     AC A0A286UJ81.1
#=GS H2YYU3_CIOSA/171-248        AC H2YYU3.1
#=GS A0A0N4V6B8_ENTVE/249-333    AC A0A0N4V6B8.1
#=GS A0A6I9K8G2_CHRAS/22-113     AC A0A6I9K8G2.1
#=GS A0A078H2W0_BRANA/17-113     AC A0A078H2W0.1
#=GS D7L9V8_ARALL/233-320        AC D7L9V8.1
#=GS A0A5C3ENE1_9BASI/230-312    AC A0A5C3ENE1.1
#=GS A9SXV6_PHYPA/21-109         AC A9SXV6.1
#=GS K9FKX6_PEND2/21-106         AC K9FKX6.1
#=GS A0A5A7PIP3_STRAF/46-135     AC A0A5A7PIP3.1
#=GS A0A5A7QNE2_STRAF/234-323    AC A0A5A7QNE2.1
#=GS A0A6P7HPK7_9TELE/17-115     AC A0A6P7HPK7.1
#=GS A0A540MRI3_MALBA/1-64       AC A0A540MRI3.1
#=GS A0A1R3HI83_9ROSI/17-114     AC A0A1R3HI83.1
#=GS A0A3S3NZ19_9MAGN/21-110     AC A0A3S3NZ19.1
#=GS W0C2P7_DROGU/22-111         AC W0C2P7.1
#=GS A0A4W4DST3_ELEEL/17-114     AC A0A4W4DST3.1
#=GS G3R5E5_GORGO/17-114         AC G3R5E5.1
#=GS A0A251RU43_HELAN/233-317    AC A0A251RU43.1
#=GS A0A6P7S727_OCTVU/231-320    AC A0A6P7S727.1
#=GS K0KHG3_WICCF/19-105         AC K0KHG3.1
#=GS A0A5N5LDJ7_9ROSI/21-122     AC A0A5N5LDJ7.1
#=GS G7XPB2_ASPKW/229-311        AC G7XPB2.1
#=GS A9P9N6_POPTR/21-109         AC A9P9N6.1
#=GS A0A067EC78_CITSI/20-107     AC A0A067EC78.1
#=GS A0A5C7GUQ0_9ROSI/21-108     AC A0A5C7GUQ0.1
#=GS A0A5D2Y508_GOSMU/22-113     AC A0A5D2Y508.1
#=GS A0A4T0FQ06_9BASI/20-106     AC A0A4T0FQ06.1
#=GS A0A2I1GT95_9GLOM/231-313    AC A0A2I1GT95.1
#=GS A0A445EEZ2_ARAHY/280-365    AC A0A445EEZ2.1
#=GS W2S4K1_9EURO/229-315        AC W2S4K1.1
#=GS A0A316WB18_9BASI/17-114     AC A0A316WB18.1
#=GS A0A4S2LDV5_OPIFE/21-112     AC A0A4S2LDV5.1
#=GS A0A183LU12_9TREM/231-310    AC A0A183LU12.1
#=GS A0A1V6SLD5_9EURO/229-311    AC A0A1V6SLD5.1
#=GS A0A7C8M9W1_9PLEO/17-113     AC A0A7C8M9W1.1
#=GS A0A6J2VF59_CHACN/231-315    AC A0A6J2VF59.1
#=GS F0UE72_AJEC8/17-110         AC F0UE72.1
#=GS A0A6A3BVV5_HIBSY/22-101     AC A0A6A3BVV5.1
#=GS S9V7D6_9TRYP/21-107         AC S9V7D6.1
#=GS A0A225AE68_9EURO/21-109     AC A0A225AE68.1
#=GS A0A4P9VZL2_9FUNG/17-111     AC A0A4P9VZL2.1
#=GS A0A317XXF7_9BASI/21-109     AC A0A317XXF7.1
#=GS A0A2K3QNU8_9HYPO/17-107     AC A0A2K3QNU8.1
#=GS A0A6D2KVV3_9BRAS/22-112     AC A0A6D2KVV3.1
#=GS Q4E3A4_TRYCC/238-323        AC Q4E3A4.1
#=GS A0A445LHF0_GLYSO/21-102     AC A0A445LHF0.1
#=GS A0A0N4WCN0_HAEPC/231-313    AC A0A0N4WCN0.1
#=GS A0A072P935_9EURO/21-112     AC A0A072P935.1
#=GS A0A024WQ46_PLAFA/231-315    AC A0A024WQ46.1
#=GS A0A0E0KG80_ORYPU/159-239    AC A0A0E0KG80.1
#=GS M0S9B9_MUSAM/203-287        AC M0S9B9.1
#=GS A0A5Q0UEU0_9ARCH/16-102     AC A0A5Q0UEU0.1
#=GS A0A200PZI0_9MAGN/2-94       AC A0A200PZI0.1
#=GS B4QI10_DROSI/17-112         AC B4QI10.1
#=GS A0A1R2B4C1_9CILI/17-111     AC A0A1R2B4C1.1
#=GS A0A093RM18_PYGAD/210-293    AC A0A093RM18.1
#=GS A0A7N5KPM7_AILME/55-137     AC A0A7N5KPM7.1
#=GS A0A0D2PJU5_GOSRA/22-113     AC A0A0D2PJU5.1
#=GS A0A6P5XPH6_DURZI/17-113     AC A0A6P5XPH6.1
#=GS A0A2G3CAN9_CAPCH/38-127     AC A0A2G3CAN9.1
#=GS A0A4P9Z683_9FUNG/22-107     AC A0A4P9Z683.1
#=GS A0A0P5Z754_9CRUS/231-317    AC A0A0P5Z754.1
#=GS A0A2B4S384_STYPI/17-114     AC A0A2B4S384.1
#=GS A0A367IXZ5_RHIAZ/20-105     AC A0A367IXZ5.1
#=GS H3CUW7_TETNG/22-110         AC H3CUW7.1
#=GS A1D3U2_NEOFI/21-109         AC A1D3U2.1
#=GS A0A0L0H618_SPIPD/25-112     AC A0A0L0H618.1
#=GS A0A1U7T6G5_CARSF/64-124     AC A0A1U7T6G5.1
#=GS A0A1V9ZML5_9STRA/16-106     AC A0A1V9ZML5.1
#=GS N1PML4_DOTSN/229-314        AC N1PML4.1
#=GS M1C6Y7_SOLTU/21-111         AC M1C6Y7.1
#=GS A0A098VSC5_9MICR/22-111     AC A0A098VSC5.1
#=GS A0A1X2IS40_9FUNG/20-105     AC A0A1X2IS40.1
#=GS A9RV72_PHYPA/17-113         AC A9RV72.1
#=GS A0A6P7NSK7_BETSP/22-112     AC A0A6P7NSK7.1
#=GS A0A1X6MRT4_9APHY/229-313    AC A0A1X6MRT4.1
#=GS A0A059C2A0_EUCGR/96-184     AC A0A059C2A0.1
#=GS A0A0L6U6V8_9BASI/253-335    AC A0A0L6U6V8.1
#=GS A0A1V8USC0_9PEZI/21-111     AC A0A1V8USC0.1
#=GS A0A6P6XRL8_DERPT/231-317    AC A0A6P6XRL8.1
#=GS A0A4U1ESW1_MONMO/22-107     AC A0A4U1ESW1.1
#=GS A0A0B2RPH2_GLYSO/234-320    AC A0A0B2RPH2.1
#=GS A0A2K6BA59_MACNE/16-101     AC A0A2K6BA59.1
#=GS A0A540KCR2_MALBA/17-113     AC A0A540KCR2.1
#=GS A0A2I4HWL0_JUGRE/34-120     AC A0A2I4HWL0.1
#=GS A0A068UJN1_COFCA/21-101     AC A0A068UJN1.1
#=GS A0A565BIY4_9BRAS/234-318    AC A0A565BIY4.1
#=GS A0A420HB47_9PEZI/17-109     AC A0A420HB47.1
#=GS A0A443HVR0_BYSSP/229-313    AC A0A443HVR0.1
#=GS A0A367YMX2_9ASCO/27-117     AC A0A367YMX2.1
#=GS RLA1_MAIZE/21-108           AC P52855.1
#=GS A0A5B1R0E9_9AGAM/21-108     AC A0A5B1R0E9.1
#=GS A0A6G1AXG9_CROCR/22-111     AC A0A6G1AXG9.1
#=GS A0A2G9HZH6_9LAMI/21-112     AC A0A2G9HZH6.1
#=GS A0A395NSS3_TRIAR/229-312    AC A0A395NSS3.1
#=GS A0A212C6W7_CEREH/7-84       AC A0A212C6W7.1
#=GS A0A1B9IGU8_9TREE/39-127     AC A0A1B9IGU8.1
#=GS V4L5J2_EUTSA/17-111         AC V4L5J2.1
#=GS B5DH20_SALSA/22-110         AC B5DH20.1
#=GS A0A0C2YHB7_HEBCY/229-310    AC A0A0C2YHB7.1
#=GS A0A2K6KGV9_RHIBE/21-112     AC A0A2K6KGV9.1
#=GS A0A6J3QPT1_TURTR/34-125     AC A0A6J3QPT1.1
#=GS A0A3D8SWZ1_9EURO/17-109     AC A0A3D8SWZ1.1
#=GS A0A1R2C0Q4_9CILI/32-116     AC A0A1R2C0Q4.1
#=GS A0A0D2QPN4_GOSRA/17-113     AC A0A0D2QPN4.1
#=GS M9SEY1_METAX/9-95           AC M9SEY1.1
#=GS A0A1U7WXR3_NICSY/17-110     AC A0A1U7WXR3.1
#=GS A0A6J2TT30_DROLE/23-117     AC A0A6J2TT30.1
#=GS A0A4D9DZ62_9SAUR/22-111     AC A0A4D9DZ62.1
#=GS A0A673GQC1_9TELE/23-107     AC A0A673GQC1.1
#=GS A0A0W4ZX23_PNEMU/17-105     AC A0A0W4ZX23.1
#=GS A0A0L7KHB6_PLAFX/32-117     AC A0A0L7KHB6.1
#=GS M7ZWX9_TRIUA/36-119         AC M7ZWX9.1
#=GS A0A178F0L3_TRIRU/17-112     AC A0A178F0L3.1
#=GS A0A150UR69_9PEZI/229-315    AC A0A150UR69.1
#=GS A0A094G164_9PEZI/69-156     AC A0A094G164.1
#=GS A0A4T0M8U7_9BASI/20-105     AC A0A4T0M8U7.1
#=GS G5ATB4_HETGA/6-101          AC G5ATB4.1
#=GS A0A6P5Y931_DURZI/21-111     AC A0A6P5Y931.1
#=GS A0A200Q6A6_9MAGN/17-115     AC A0A200Q6A6.1
#=GS A0A1V6V7G4_9EURO/21-107     AC A0A1V6V7G4.1
#=GS A0A5N5NNZ9_9ROSI/69-157     AC A0A5N5NNZ9.1
#=GS A0A2I0AQD8_9ASPA/17-119     AC A0A2I0AQD8.1
#=GS A0A3Q3FM12_9LABR/231-313    AC A0A3Q3FM12.1
#=GS A0A0L0HT86_SPIPD/23-109     AC A0A0L0HT86.1
#=GS A0A1X1BPC4_9APIC/19-110     AC A0A1X1BPC4.1
#=GS A0A0C2D1V7_9BILA/521-609    AC A0A0C2D1V7.1
#=GS A0A1D6PWJ9_MAIZE/11-94      AC A0A1D6PWJ9.1
#=GS A0A2G2XWM0_CAPAN/21-94      AC A0A2G2XWM0.1
#=GS A0A6J2G493_9PASS/231-317    AC A0A6J2G493.1
#=GS A0A367KE53_RHIAZ/17-107     AC A0A367KE53.1
#=GS A0A446L3P8_TRITD/17-113     AC A0A446L3P8.1
#=GS A0A2H3DDC1_ARMGA/590-678    AC A0A2H3DDC1.1
#=GS A0A452QNR5_URSAM/31-110     AC A0A452QNR5.1
#=GS A0A401L0Q2_ASPAW/17-109     AC A0A401L0Q2.1
#=GS A0A1U7W541_NICSY/22-113     AC A0A1U7W541.1
#=GS S9XUS4_CAMFR/126-205        AC S9XUS4.1
#=GS A0A6I9KMW0_CHRAS/17-114     AC A0A6I9KMW0.1
#=GS A0A0U3E822_9CREN/16-105     AC A0A0U3E822.1
#=GS A0A6P7MHU7_BETSP/231-314    AC A0A6P7MHU7.1
#=GS A0A0L0D452_THETB/21-104     AC A0A0L0D452.1
#=GS A0A0D7A1T2_9AGAR/21-110     AC A0A0D7A1T2.1
#=GS A0A1S3Y124_TOBAC/17-112     AC A0A1S3Y124.1
#=GS A0A2K1QWK8_9PEZI/21-110     AC A0A2K1QWK8.1
#=GS A0A6J2U210_DROLE/17-113     AC A0A6J2U210.1
#=GS A0A2R5GVA9_9STRA/55-143     AC A0A2R5GVA9.1
#=GS B4IXN3_DROGR/231-317        AC B4IXN3.1
#=GS A0A2G7GBF4_9EURO/21-107     AC A0A2G7GBF4.1
#=GS A0A1C7NMK8_9FUNG/228-308    AC A0A1C7NMK8.1
#=GS A0A0L6VF94_9BASI/17-112     AC A0A0L6VF94.1
#=GS A0A1J9R4Q5_9EURO/49-132     AC A0A1J9R4Q5.1
#=GS A0A0E0Q688_ORYRU/17-107     AC A0A0E0Q688.1
#=GS A0A2I0KBJ8_PUNGR/21-112     AC A0A2I0KBJ8.1
#=GS Q6FTP0_CANGA/229-310        AC Q6FTP0.1
#=GS D8LVH9_BLAHO/7-98           AC D8LVH9.1
#=GS D7LSI9_ARALL/22-110         AC D7LSI9.1
#=GS A0A6A4LIH0_9ERIC/251-319    AC A0A6A4LIH0.1
#=GS A0A5N5L7X7_9ROSI/234-319    AC A0A5N5L7X7.1
#=GS A0A4D9AXF7_SALSN/21-101     AC A0A4D9AXF7.1
#=GS M4YMN1_THEXX/230-333        AC M4YMN1.1
#=GS J4H2Y0_9APHY/35-123         AC J4H2Y0.1
#=GS W5MLX5_LEPOC/22-111         AC W5MLX5.1
#=GS A0A663E2N1_AQUCH/22-113     AC A0A663E2N1.1
#=GS Q4QFE2_LEIMA/20-107         AC Q4QFE2.1
#=GS J3MPV4_ORYBR/21-109         AC J3MPV4.1
#=GS F9WF02_TRYCI/70-158         AC F9WF02.1
#=GS A0A653GWY1_9APIC/19-111     AC A0A653GWY1.1
#=GS A0A6J1A267_9ROSI/22-113     AC A0A6J1A267.1
#=GS A0A427Y3U3_9TREE/229-314    AC A0A427Y3U3.1
#=GS A0A087GV40_ARAAL/17-112     AC A0A087GV40.1
#=GS A0A2S7NYC4_9HELO/17-54      AC A0A2S7NYC4.1
#=GS A0A328CYP2_9ASTE/21-111     AC A0A328CYP2.1
#=GS A0A421JPM9_9ASCO/20-105     AC A0A421JPM9.1
#=GS C1EEH7_MICCC/17-106         AC C1EEH7.1
#=GS A0A0F7ZQ65_9HYPO/229-312    AC A0A0F7ZQ65.1
#=GS B8NB77_ASPFN/17-108         AC B8NB77.1
#=GS B5XCI0_SALSA/17-113         AC B5XCI0.1
#=GS R9AGY5_WALI9/20-104         AC R9AGY5.1
#=GS A0A0C3B442_9AGAM/21-114     AC A0A0C3B442.1
#=GS B0DZY2_LACBS/21-110         AC B0DZY2.1
#=GS S9V7H5_9TRYP/238-326        AC S9V7H5.1
#=GS A0A0N4UCC8_DRAME/231-316    AC A0A0N4UCC8.1
#=GS A0A4U5U7T2_COLLU/17-112     AC A0A4U5U7T2.1
#=GS A0A195FVY1_9HYME/22-109     AC A0A195FVY1.1
#=GS A0A0L0DD06_THETB/234-318    AC A0A0L0DD06.1
#=GS A0A5N6NSW5_9ASTR/21-111     AC A0A5N6NSW5.1
#=GS G4YJT9_PHYSP/231-311        AC G4YJT9.1
#=GS A0A420JBK9_9PEZI/230-312    AC A0A420JBK9.1
#=GS A0A1Z5SYM6_HORWE/17-111     AC A0A1Z5SYM6.1
#=GS A0A329S9R6_9STRA/378-466    AC A0A329S9R6.1
#=GS A0A2A3EIP3_APICC/25-121     AC A0A2A3EIP3.1
#=GS A0A2Z7AY42_9LAMI/7-120      AC A0A2Z7AY42.1
#=GS A0A0D3B910_BRAOL/22-112     AC A0A0D3B910.1
#=GS A0A5N4D8M5_CAMDR/13-86      AC A0A5N4D8M5.1
#=GS A0A7H9HVA3_9SACH/16-105     AC A0A7H9HVA3.1
#=GS A0A1Y2XCC5_9PEZI/17-111     AC A0A1Y2XCC5.1
#=GS A0A2A9MCC8_9APIC/19-111     AC A0A2A9MCC8.1
#=GS A0A4X2KGT8_VOMUR/169-254    AC A0A4X2KGT8.1
#=GS U4UHM3_DENPD/231-317        AC U4UHM3.1
#=GS A0A2K5HZR4_COLAP/230-310    AC A0A2K5HZR4.1
#=GS A0A1B7MTV8_9AGAM/229-312    AC A0A1B7MTV8.1
#=GS A0A261XUE5_9FUNG/21-108     AC A0A261XUE5.1
#=GS A0A452FL04_CAPHI/15-92      AC A0A452FL04.1
#=GS R0KAF4_SETT2/17-112         AC R0KAF4.1
#=GS A0A2A9M4E3_9APIC/32-117     AC A0A2A9M4E3.1
#=GS A0A6A3CZV9_HIBSY/17-113     AC A0A6A3CZV9.1
#=GS A0A6A3BPX7_HIBSY/17-107     AC A0A6A3BPX7.1
#=GS R9ADY9_WALI9/229-309        AC R9ADY9.1
#=GS A0A5N5G1U0_9ROSA/17-113     AC A0A5N5G1U0.1
#=GS A0A4V5ZY15_POPAL/21-108     AC A0A4V5ZY15.1
#=GS C6HL32_AJECH/17-110         AC C6HL32.1
#=GS B0XA03_CULQU/2-78           AC B0XA03.1
#=GS A0A553QRW7_9TELE/21-117     AC A0A553QRW7.1
#=GS A0A2Y9F0K9_PHYMC/16-86      AC A0A2Y9F0K9.1
#=GS A0A2P5F475_TREOI/33-119     AC A0A2P5F475.1
#=GS A0A022QCQ2_ERYGU/7-121      AC A0A022QCQ2.1
#=GS A0A1E3IMS7_9TREE/24-111     AC A0A1E3IMS7.1
#=GS Q4UGN6_THEAN/231-308        AC Q4UGN6.1
#=GS A0A068V019_COFCA/17-112     AC A0A068V019.1
#=GS A0A287B7U0_PIG/17-114       AC A0A287B7U0.2
#=GS A0A0W0G2B2_9AGAR/84-173     AC A0A0W0G2B2.1
#=GS A0A669PAV8_PHACC/18-88      AC A0A669PAV8.1
#=GS A0A024VK18_PLAFA/231-315    AC A0A024VK18.1
#=GS A0A559M9F0_9HELO/727-809    AC A0A559M9F0.1
#=GS A0A218ZFI2_9HELO/21-109     AC A0A218ZFI2.1
#=GS Q18G92_HALWD/16-113         AC Q18G92.1
#=GS W7LZJ0_GIBM7/21-108         AC W7LZJ0.1
#=GS C4JIF9_UNCRE/17-110         AC C4JIF9.1
#=GS A0A0W7VFH5_9HYPO/17-109     AC A0A0W7VFH5.1
#=GS A0A151TYE0_CAJCA/21-111     AC A0A151TYE0.1
#=GS A0A565ASZ4_9BRAS/17-113     AC A0A565ASZ4.1
#=GS A0A1B9GXS2_9TREE/229-313    AC A0A1B9GXS2.1
#=GS RLA5_SCHPO/21-108           AC Q9UU78.1
#=GS A0A328EAN2_9ASTE/234-318    AC A0A328EAN2.1
#=GS A0A1D2R131_9ARCH/16-98      AC A0A1D2R131.1
#=GS A0A2V1E0R2_9PLEO/229-312    AC A0A2V1E0R2.1
#=GS A0A2P4SZ46_BAMTH/231-315    AC A0A2P4SZ46.1
#=GS M7BGH9_CHEMY/41-136         AC M7BGH9.1
#=GS A0A2I3SN62_PANTR/22-106     AC A0A2I3SN62.1
#=GS A0A6J1IQJ8_CUCMA/21-111     AC A0A6J1IQJ8.1
#=GS W5QBE7_SHEEP/22-113         AC W5QBE7.1
#=GS A0A0E0AQ57_9ORYZ/21-109     AC A0A0E0AQ57.1
#=GS A0A5J9U7Q3_9POAL/48-143     AC A0A5J9U7Q3.1
#=GS A0A0K0IYX6_BRUMA/231-319    AC A0A0K0IYX6.1
#=GS A0A0K0FW12_STRVS/231-313    AC A0A0K0FW12.1
#=GS A0A0C9M241_9FUNG/17-56      AC A0A0C9M241.1
#=GS A0A401NFZ1_SCYTO/17-110     AC A0A401NFZ1.1
#=GS A0A6P8WU24_DROAB/231-316    AC A0A6P8WU24.1
#=GS A0A5J4NFD9_9TREM/17-116     AC A0A5J4NFD9.1
#=GS A0A0M9FSD6_9TRYP/18-111     AC A0A0M9FSD6.1
#=GS A0A6J3LTA3_9PEZI/229-314    AC A0A6J3LTA3.1
#=GS A0A2U9BGW9_SCOMX/192-275    AC A0A2U9BGW9.1
#=GS A0A668T6M3_OREAU/17-113     AC A0A668T6M3.1
#=GS G3QMD7_GORGO/22-106         AC G3QMD7.2
#=GS A0A392PE46_9FABA/8-94       AC A0A392PE46.1
#=GS A0A5D2TQ47_GOSMU/17-113     AC A0A5D2TQ47.1
#=GS A0A197KAR2_9FUNG/17-108     AC A0A197KAR2.1
#=GS A0A1D1VVY6_RAMVA/17-115     AC A0A1D1VVY6.1
#=GS A0A2I2F6E3_9EURO/229-310    AC A0A2I2F6E3.1
#=GS C4JJY9_UNCRE/76-144         AC C4JJY9.1
#=GS A0A177AWT0_9BILA/236-314    AC A0A177AWT0.1
#=GS H2YYU2_CIOSA/231-308        AC H2YYU2.1
#=GS A0A4W2C6X9_BOBOX/231-317    AC A0A4W2C6X9.1
#=GS M1C5E6_SOLTU/234-319        AC M1C5E6.1
#=GS A0A151XCU5_9HYME/17-113     AC A0A151XCU5.1
#=GS A0A6A5MW96_LUPAL/57-154     AC A0A6A5MW96.1
#=GS A0A3P6TIE1_LITSI/231-319    AC A0A3P6TIE1.1
#=GS A0A6P9EDC1_JUGRE/24-121     AC A0A6P9EDC1.1
#=GS A0A2J6RZN0_9HELO/21-110     AC A0A2J6RZN0.1
#=GS A0A0C9LUF4_9FUNG/55-134     AC A0A0C9LUF4.1
#=GS A0A5D2XYC0_GOSMU/17-112     AC A0A5D2XYC0.1
#=GS G3B7H6_CANTC/20-106         AC G3B7H6.1
#=GS A0A341CG30_NEOAA/22-111     AC A0A341CG30.1
#=GS Q1HRP7_AEDAE/23-111         AC Q1HRP7.1
#=GS A0A0L1KUE0_9EUGL/20-101     AC A0A0L1KUE0.1
#=GS K5WCW6_PHACS/61-152         AC K5WCW6.1
#=GS A0A3S2NXW6_CHISP/17-93      AC A0A3S2NXW6.1
#=GS A0A287XBP0_HORVV/107-201    AC A0A287XBP0.1
#=GS A0A504YGJ5_FASGI/21-113     AC A0A504YGJ5.1
#=GS N1JE38_BLUG1/230-313        AC N1JE38.1
#=GS E2BUN1_HARSA/17-105         AC E2BUN1.1
#=GS Q28IH1_XENTR/17-114         AC Q28IH1.1
#=GS H0XX20_OTOGA/17-114         AC H0XX20.1
#=GS A0A4Z1JVH4_9HELO/17-110     AC A0A4Z1JVH4.1
#=GS A0A3D8SDI3_9HELO/17-110     AC A0A3D8SDI3.1
#=GS A0A4V6S168_9AGAM/229-311    AC A0A4V6S168.1
#=GS A0A1V8SJT8_9PEZI/229-312    AC A0A1V8SJT8.1
#=GS A0A3Q1EBS5_9TELE/17-114     AC A0A3Q1EBS5.1
#=GS A0A168J6P8_CORDF/17-109     AC A0A168J6P8.1
#=GS D8J2Z0_HALJB/16-112         AC D8J2Z0.1
#=GS W9IYL8_FUSOX/229-312        AC W9IYL8.1
#=GS A0A540LHI3_MALBA/21-89      AC A0A540LHI3.1
#=GS A0A5P1E3H3_ASPOF/17-112     AC A0A5P1E3H3.1
#=GS A0A6S7M6A4_LACSI/110-197    AC A0A6S7M6A4.1
#=GS T5AEQ2_OPHSC/17-93          AC T5AEQ2.1
#=GS A2ZB54_ORYSI/234-319        AC A2ZB54.1
#=GS A0A4Y9XKW1_9AGAM/21-106     AC A0A4Y9XKW1.1
#=GS A0A565B5L6_9BRAS/233-320    AC A0A565B5L6.1
#=GS A0A1X2IHL1_9FUNG/20-105     AC A0A1X2IHL1.1
#=GS A0A1D2VMG0_9ASCO/19-107     AC A0A1D2VMG0.1
#=GS A0A2V1AN49_9ASCO/229-309    AC A0A2V1AN49.1
#=GS A0A2I2G5B9_9EURO/17-107     AC A0A2I2G5B9.1
#=GS A0A420HXF0_9PEZI/21-108     AC A0A420HXF0.1
#=GS A0A0E0E9N3_9ORYZ/17-108     AC A0A0E0E9N3.1
#=GS A0A0F9WII3_9MICR/16-105     AC A0A0F9WII3.1
#=GS G2PZU8_MYCTT/229-310        AC G2PZU8.1
#=GS A0A1F7ZLE4_9EURO/17-108     AC A0A1F7ZLE4.1
#=GS J9IL70_9SPIT/139-223        AC J9IL70.1
#=GS A0A183DJF5_9BILA/22-64      AC A0A183DJF5.1
#=GS A0A2B7WUI2_9EURO/85-173     AC A0A2B7WUI2.1
#=GS A0A540KGJ6_MALBA/126-211    AC A0A540KGJ6.1
#=GS B4G1B3_MAIZE/61-119         AC B4G1B3.1
#=GS T0Q9U0_SAPDV/231-313        AC T0Q9U0.1
#=GS A0A3M6U316_POCDA/22-115     AC A0A3M6U316.1
#=GS F1RYZ0_PIG/17-113           AC F1RYZ0.2
#=GS Q2GYG9_CHAGB/21-109         AC Q2GYG9.1
#=GS A0A0R3R6H6_9BILA/21-116     AC A0A0R3R6H6.1
#=GS A0A6A3A754_HIBSY/17-113     AC A0A6A3A754.1
#=GS A0A0N5CX80_THECL/48-138     AC A0A0N5CX80.1
#=GS A0A2T7EL83_9POAL/17-111     AC A0A2T7EL83.1
#=GS A0A6A7LAU3_9ARCH/16-100     AC A0A6A7LAU3.1
#=GS A0A2P4ZBX4_9HYPO/229-312    AC A0A2P4ZBX4.1
#=GS A0A4S4LL24_9AGAM/21-109     AC A0A4S4LL24.1
#=GS R0HVP3_9BRAS/17-113         AC R0HVP3.1
#=GS A0A443SKI0_9ACAR/231-312    AC A0A443SKI0.1
#=GS A0A0C9U4Y9_PAXIN/229-311    AC A0A0C9U4Y9.1
#=GS L0HCF4_METFS/9-101          AC L0HCF4.1
#=GS A0A0D3GP76_9ORYZ/10-102     AC A0A0D3GP76.1
#=GS A0A5N5SWQ9_9CRUS/22-116     AC A0A5N5SWQ9.1
#=GS A0A3Q1C546_AMPOC/17-114     AC A0A3Q1C546.1
#=GS RLA0_BOVIN/231-317          AC Q95140.3
#=GS A0A034WRS4_BACDO/17-112     AC A0A034WRS4.1
#=GS A0A2K2CY93_BRADI/287-371    AC A0A2K2CY93.1
#=GS A0A642UFA9_DIURU/17-108     AC A0A642UFA9.1
#=GS A0A078HK83_BRANA/35-120     AC A0A078HK83.1
#=GS A0A316ZI09_9BASI/21-109     AC A0A316ZI09.1
#=GS W7JMJ7_PLAFA/32-117         AC W7JMJ7.1
#=GS A0A060WPZ4_ONCMY/231-314    AC A0A060WPZ4.1
#=GS A0A445KQA3_GLYSO/33-119     AC A0A445KQA3.1
#=GS RLA2_DROME/17-112           AC P05389.1
#=GS N4VJZ7_COLOR/229-310        AC N4VJZ7.1
#=GS A0A6G1E1Y5_9ORYZ/21-109     AC A0A6G1E1Y5.1
#=GS A0A0D1ZPN2_EXOME/21-111     AC A0A0D1ZPN2.1
#=GS A0A1R1X1C3_9FUNG/17-108     AC A0A1R1X1C3.1
#=GS A0A0C9MJ73_9FUNG/17-105     AC A0A0C9MJ73.1
#=GS A0A2P7YXL4_9ASCO/20-106     AC A0A2P7YXL4.1
#=GS A0A6P6H7B9_PUMCO/17-114     AC A0A6P6H7B9.1
#=GS A0A3N6RQG2_BRACR/96-180     AC A0A3N6RQG2.1
#=GS A0A5M9JT62_MONFR/51-139     AC A0A5M9JT62.1
#=GS A0A4S4D6Z0_CAMSI/33-116     AC A0A4S4D6Z0.1
#=GS M1AUE9_SOLTU/17-110         AC M1AUE9.1
#=GS A0A1V8T1S8_9PEZI/21-111     AC A0A1V8T1S8.1
#=GS A0A507AV18_9PEZI/17-111     AC A0A507AV18.1
#=GS A0A015LLK6_RHIIW/231-313    AC A0A015LLK6.1
#=GS A0A3Q1CI16_AMPOC/17-114     AC A0A3Q1CI16.1
#=GS M0WXK1_HORVV/235-320        AC M0WXK1.1
#=GS A0A2H2IDR4_CAEJA/17-110     AC A0A2H2IDR4.1
#=GS B6AE73_CRYMR/19-108         AC B6AE73.1
#=GS A0A1N6X6Q2_9EURY/16-108     AC A0A1N6X6Q2.1
#=GS A0A329CXZ0_9ARCH/16-100     AC A0A329CXZ0.1
#=GS A0A091WMN6_NIPNI/17-114     AC A0A091WMN6.1
#=GS A0A1B9GLE1_9TREE/75-164     AC A0A1B9GLE1.1
#=GS A0A177DM66_ALTAL/18-66      AC A0A177DM66.1
#=GS N1RLX3_FUSC4/21-108         AC N1RLX3.1
#=GS A0A2I4HB20_JUGRE/17-114     AC A0A2I4HB20.1
#=GS A0A6A6LJS0_HEVBR/17-104     AC A0A6A6LJS0.1
#=GS A0A074YN14_AURSE/229-312    AC A0A074YN14.1
#=GS A0A6P4EF86_DRORH/17-112     AC A0A6P4EF86.1
#=GS S9WDQ7_CAMFR/158-235        AC S9WDQ7.1
#=GS A0A5N6Z3S1_9EURO/229-312    AC A0A5N6Z3S1.1
#=GS F7W3Y8_SORMK/21-108         AC F7W3Y8.1
#=GS D8M2N0_BLAHO/9-100          AC D8M2N0.1
#=GS A0A177BU15_9PLEO/17-110     AC A0A177BU15.1
#=GS A0A6J0DDI8_PERMB/192-277    AC A0A6J0DDI8.1
#=GS A0A1E5RAT4_9ASCO/20-106     AC A0A1E5RAT4.1
#=GS A0A444YVI6_ARAHY/234-320    AC A0A444YVI6.1
#=GS A0A177D8H0_ALTAL/17-112     AC A0A177D8H0.1
#=GS W7I7H3_9PEZI/229-313        AC W7I7H3.1
#=GS A0A0D9UYR2_9ORYZ/53-119     AC A0A0D9UYR2.1
#=GS A0A5F8MPY2_MOUSE/17-114     AC A0A5F8MPY2.1
#=GS C5DG63_LACTC/17-106         AC C5DG63.1
#=GS W9CSE3_SCLBF/21-109         AC W9CSE3.1
#=GS A0A670ZM23_PSETE/17-99      AC A0A670ZM23.1
#=GS R0KPT7_NOSB1/25-106         AC R0KPT7.1
#=GS RLA0_DICDI/227-304          AC P22685.2
#=GS A0A0L6WGI7_9AGAR/17-104     AC A0A0L6WGI7.1
#=GS A0A1E3ICQ3_9TREE/229-310    AC A0A1E3ICQ3.1
#=GS A0A165HN39_XYLHT/17-109     AC A0A165HN39.1
#=GS A0A177WPZ1_BATDL/55-142     AC A0A177WPZ1.1
#=GS A0A0F7TE12_PENBI/229-312    AC A0A0F7TE12.1
#=GS F6WAG2_CALJA/231-317        AC F6WAG2.2
#=GS A0A4S2L412_9HYME/22-111     AC A0A4S2L412.1
#=GS A0A5F4CQW4_CANLF/20-105     AC A0A5F4CQW4.1
#=GS A0A6J2H706_9PASS/17-114     AC A0A6J2H706.1
#=GS G1Q120_MYOLU/19-86          AC G1Q120.1
#=GS A0A428R0L3_9HYPO/17-109     AC A0A428R0L3.1
#=GS A0A367J7I0_RHIAZ/17-107     AC A0A367J7I0.1
#=GS A0A1I0MP63_9EURY/16-112     AC A0A1I0MP63.1
#=GS A0A1X7UQX3_AMPQE/18-116     AC A0A1X7UQX3.1
#=GS A0A4U6VR57_SETVI/29-125     AC A0A4U6VR57.1
#=GS A0A1G4JRZ0_9SACH/17-110     AC A0A1G4JRZ0.1
#=GS A0A2U3ZSQ8_ODORO/18-88      AC A0A2U3ZSQ8.1
#=GS V9ERE7_PHYPR/29-111         AC V9ERE7.1
#=GS A0A0J8QUZ6_COCIT/17-110     AC A0A0J8QUZ6.1
#=GS A0A6P6PMP5_CARAU/17-115     AC A0A6P6PMP5.1
#=GS A0A1M2YH05_9ARCH/9-99       AC A0A1M2YH05.1
#=GS A0A6P4E9Q1_DRORH/231-316    AC A0A6P4E9Q1.1
#=GS A0A445EUK7_ARAHY/17-112     AC A0A445EUK7.1
#=GS A0A6I9TKV1_SESIN/234-314    AC A0A6I9TKV1.1
#=GS A0A448YMU2_BRENA/49-137     AC A0A448YMU2.1
#=GS A0A2K6NU46_RHIRO/22-113     AC A0A2K6NU46.1
#=GS V7CQS4_PHAVU/25-118         AC V7CQS4.1
#=GS A0A2C5X2N9_9PEZI/21-107     AC A0A2C5X2N9.1
#=GS A0A395HW65_ASPHC/17-108     AC A0A395HW65.1
#=GS A6QZ96_AJECN/6-79           AC A6QZ96.1
#=GS A0A6J0ZUK9_9ROSI/17-112     AC A0A6J0ZUK9.1
#=GS RLA0_RAT/231-316            AC P19945.2
#=GS A0A132AJ25_SARSC/21-116     AC A0A132AJ25.1
#=GS A0A559M631_9HELO/33-120     AC A0A559M631.1
#=GS M7T6W1_EUTLA/17-110         AC M7T6W1.1
#=GS A0A316U7A0_9BASI/17-112     AC A0A316U7A0.1
#=GS Q29DM5_DROPS/231-316        AC Q29DM5.1
#=GS A0A5N6T709_ASPPS/21-108     AC A0A5N6T709.1
#=GS A0A0L0HP25_SPIPD/231-310    AC A0A0L0HP25.1
#=GS A0A2P6VRH1_9CHLO/17-106     AC A0A2P6VRH1.1
#=GS A0A6J2PTE5_COTGO/192-276    AC A0A6J2PTE5.1
#=GS A0A4Q4ZXD3_9PEZI/229-311    AC A0A4Q4ZXD3.1
#=GS A0A3S2PRW3_ORYJA/20-117     AC A0A3S2PRW3.1
#=GS A0A369GZW1_9HYPO/229-311    AC A0A369GZW1.1
#=GS A7XLX5_PERFV/231-313        AC A7XLX5.1
#=GS H2LMY7_ORYLA/34-131         AC H2LMY7.2
#=GS A0A2Z6QYX8_9GLOM/16-111     AC A0A2Z6QYX8.1
#=GS A0A2R6NKQ1_9APHY/17-110     AC A0A2R6NKQ1.1
#=GS A0A4U5U8M2_COLLU/17-114     AC A0A4U5U8M2.1
#=GS A0A200R4P0_9MAGN/234-321    AC A0A200R4P0.1
#=GS A0A167ZBA7_9PEZI/21-108     AC A0A167ZBA7.1
#=GS C9SI72_VERA1/229-312        AC C9SI72.1
#=GS A0A197JYN2_9FUNG/20-104     AC A0A197JYN2.1
#=GS A0A369HGR3_9HYPO/229-311    AC A0A369HGR3.1
#=GS A0A2K5KPV0_CERAT/147-233    AC A0A2K5KPV0.1
#=GS A0A3N4LU41_9PEZI/17-111     AC A0A3N4LU41.1
#=GS A0A0D3DZC1_BRAOL/22-113     AC A0A0D3DZC1.1
#=GS A0A392PG25_9FABA/21-93      AC A0A392PG25.1
#=GS A0A2T9WMG2_9CREN/21-112     AC A0A2T9WMG2.1
#=GS A0A3R7NQ88_9TRYP/18-110     AC A0A3R7NQ88.1
#=GS G1NJV2_MELGA/22-113         AC G1NJV2.2
#=GS L8X335_THACA/2-62           AC L8X335.1
#=GS A0A443QTX7_9ACAR/1-98       AC A0A443QTX7.1
#=GS A0A7D8UUR4_9HELO/33-120     AC A0A7D8UUR4.1
#=GS A0A6S7N2I6_LACSI/4-90       AC A0A6S7N2I6.1
#=GS D8PXJ4_SCHCM/21-109         AC D8PXJ4.1
#=GS D8TME7_VOLCA/21-107         AC D8TME7.1
#=GS A0A395IP76_9HELO/50-144     AC A0A395IP76.1
#=GS A0A2T3AI03_9PEZI/21-110     AC A0A2T3AI03.1
#=GS A0A498J093_MALDO/21-111     AC A0A498J093.1
#=GS A0A1S3UMK4_VIGRR/31-118     AC A0A1S3UMK4.1
#=GS A0A5D2X886_GOSMU/21-84      AC A0A5D2X886.1
#=GS A0A484EA35_BRELC/17-105     AC A0A484EA35.1
#=GS A0A2G4T462_RHIZD/17-107     AC A0A2G4T462.1
#=GS W5HPC1_WHEAT/234-318        AC W5HPC1.1
#=GS A0A6I9N200_9TELE/22-111     AC A0A6I9N200.1
#=GS A0A1U8LXT3_GOSHI/17-112     AC A0A1U8LXT3.1
#=GS A0A2I1ECX6_9GLOM/16-110     AC A0A2I1ECX6.1
#=GS A0A0V0SLJ9_9BILA/22-119     AC A0A0V0SLJ9.1
#=GS A0A5D2X5M1_GOSMU/22-113     AC A0A5D2X5M1.1
#=GS A0A4U6VP74_SETVI/17-111     AC A0A4U6VP74.1
#=GS D8LZP4_BLAHO/9-100          AC D8LZP4.1
#=GS A0A5F8H564_MONDO/17-89      AC A0A5F8H564.1
#=GS A0A4P9Z356_9FUNG/17-108     AC A0A4P9Z356.1
#=GS A0A1I8IMU8_9PLAT/231-314    AC A0A1I8IMU8.1
#=GS A0A0K6G3C3_9AGAM/21-110     AC A0A0K6G3C3.1
#=GS Q4D4B8_TRYCC/26-114         AC Q4D4B8.1
#=GS A0A665WYN3_ECHNA/17-114     AC A0A665WYN3.1
#=GS A0A6P3IP00_BISBI/78-159     AC A0A6P3IP00.1
#=GS A0A1L9UGJ4_ASPBC/21-106     AC A0A1L9UGJ4.1
#=GS A0A0S7E926_9EURO/229-313    AC A0A0S7E926.1
#=GS A1DGU0_NEOFI/17-110         AC A1DGU0.1
#=GS A0A0L9UT00_PHAAN/268-353    AC A0A0L9UT00.1
#=GS M4DVB2_BRARP/3-58           AC M4DVB2.1
#=GS A0A058Z761_FONAL/16-106     AC A0A058Z761.1
#=GS A0A4R8RN03_COLTR/21-108     AC A0A4R8RN03.1
#=GS G8ZZG6_TORDC/19-105         AC G8ZZG6.1
#=GS A0A1M2V838_TRAPU/229-311    AC A0A1M2V838.1
#=GS A0A4W2DTY6_BOBOX/17-114     AC A0A4W2DTY6.1
#=GS A0A0C3S3D4_PHLGI/17-111     AC A0A0C3S3D4.1
#=GS W9XX76_9EURO/229-313        AC W9XX76.1
#=GS A0A2H5VCM6_9ARCH/18-104     AC A0A2H5VCM6.1
#=GS M0ZJ60_SOLTU/22-110         AC M0ZJ60.1
#=GS T1FMU8_HELRO/23-115         AC T1FMU8.1
#=GS A0A0D2TZQ0_GOSRA/17-111     AC A0A0D2TZQ0.1
#=GS A0A6A9T863_9EURY/16-111     AC A0A6A9T863.1
#=GS A0A218ZDK6_9HELO/229-312    AC A0A218ZDK6.1
#=GS A0A139AUK3_GONPJ/17-116     AC A0A139AUK3.1
#=GS A0A068VGL1_COFCA/21-111     AC A0A068VGL1.1
#=GS A0A7I4BXF0_PHYPA/54-140     AC A0A7I4BXF0.1
#=GS F4R503_MELLP/12-105         AC F4R503.1
#=GS A0A2I4EM61_JUGRE/17-114     AC A0A2I4EM61.1
#=GS G3I5T8_CRIGR/21-79          AC G3I5T8.1
#=GS M0RH88_MUSAM/17-115         AC M0RH88.1
#=GS R0GM52_9BRAS/17-112         AC R0GM52.1
#=GS A0A6P8BET9_MAGGR/17-108     AC A0A6P8BET9.1
#=GS A0A0V0U7G0_9BILA/22-119     AC A0A0V0U7G0.1
#=GS B4HT63_DROSE/17-112         AC B4HT63.1
#=GS A0A0F8VV15_9EURO/17-108     AC A0A0F8VV15.1
#=GS A0A6P8BBW5_MAGGR/229-311    AC A0A6P8BBW5.1
#=GS L5KVT7_PTEAL/231-316        AC L5KVT7.1
#=GS A0A3D8QEW2_9EURO/21-108     AC A0A3D8QEW2.1
#=GS A0A3P9DNI5_9CICH/22-113     AC A0A3P9DNI5.1
#=GS A0A1R3JSG7_9ROSI/21-109     AC A0A1R3JSG7.1
#=GS A0A383Z8L5_BALAS/17-114     AC A0A383Z8L5.1
#=GS A0A6J0N3D2_RAPSA/17-113     AC A0A6J0N3D2.1
#=GS W7THJ8_9STRA/36-130         AC W7THJ8.1
#=GS A0A162ZL98_DIDRA/21-111     AC A0A162ZL98.1
#=GS L0P9H0_PNEJ8/20-104         AC L0P9H0.1
#=GS A0A553P256_TIGCA/21-107     AC A0A553P256.1
#=GS A0A674IB77_TERCA/21-94      AC A0A674IB77.1
#=GS A0A0D2C4U9_9EURO/21-111     AC A0A0D2C4U9.1
#=GS A0A3M9Y3H4_9PEZI/229-312    AC A0A3M9Y3H4.1
#=GS A0A1V8SV28_9PEZI/21-111     AC A0A1V8SV28.1
#=GS A0A6J1ADW2_9ROSI/21-110     AC A0A6J1ADW2.1
#=GS A0A436ZV63_9PEZI/51-144     AC A0A436ZV63.1
#=GS A0A6P8ZFQ1_DROAB/17-113     AC A0A6P8ZFQ1.1
#=GS A0A2K6L8Z0_RHIBE/142-200    AC A0A2K6L8Z0.1
#=GS A0A367YHV7_9ASCO/20-107     AC A0A367YHV7.1
#=GS A0A5E4N4G2_9HEMI/16-110     AC A0A5E4N4G2.1
#=GS W6Y8M7_COCCA/17-112         AC W6Y8M7.1
#=GS A0A328CY21_9ASTE/234-320    AC A0A328CY21.1
#=GS A0A6H5I9B8_9HYME/17-91      AC A0A6H5I9B8.1
#=GS A0A0E0RDD2_ORYRU/233-318    AC A0A0E0RDD2.1
#=GS G0V5M2_NAUCC/229-312        AC G0V5M2.1
#=GS A8N9R6_COPC7/55-149         AC A8N9R6.2
#=GS A0A1S3U9A6_VIGRR/234-319    AC A0A1S3U9A6.1
#=GS A0A197JGX4_9FUNG/228-307    AC A0A197JGX4.1
#=GS A0A3P4MT82_GULGU/231-316    AC A0A3P4MT82.1
#=GS A0A642UE19_DIURU/20-106     AC A0A642UE19.1
#=GS A0A2T2NET5_CORCC/21-112     AC A0A2T2NET5.1
#=GS A0A177T4Z2_9BASI/59-152     AC A0A177T4Z2.1
#=GS A0A0C3P3Y2_PISTI/21-99      AC A0A0C3P3Y2.1
#=GS A0A1Y1ZMF8_9PLEO/18-111     AC A0A1Y1ZMF8.1
#=GS A0A485LVA4_9STRA/26-111     AC A0A485LVA4.1
#=GS L5K402_PTEAL/22-113         AC L5K402.1
#=GS A0A4Q4XTQ1_9PEZI/229-311    AC A0A4Q4XTQ1.1
#=GS A0A484E372_BRELC/17-106     AC A0A484E372.1
#=GS A0A6P6AQS7_DURZI/18-114     AC A0A6P6AQS7.1
#=GS A0A6J3RS10_TURTR/17-114     AC A0A6J3RS10.1
#=GS A0A1X2IV67_9FUNG/20-105     AC A0A1X2IV67.1
#=GS A0A7G2CSB0_9TRYP/21-107     AC A0A7G2CSB0.1
#=GS A0A2Y9EA72_TRIMA/17-114     AC A0A2Y9EA72.1
#=GS A0A5B6UIX6_9ROSI/234-320    AC A0A5B6UIX6.1
#=GS A0A0D7ADL2_9AGAR/17-108     AC A0A0D7ADL2.1
#=GS A0A369HB19_9HYPO/22-113     AC A0A369HB19.1
#=GS A0A165CXZ6_EXIGL/681-774    AC A0A165CXZ6.1
#=GS A0A086T6U9_ACRC1/21-108     AC A0A086T6U9.1
#=GS A0A218WRP2_PUNGR/21-109     AC A0A218WRP2.1
#=GS V4ME23_EUTSA/130-195        AC V4ME23.1
#=GS A0A1B8DV33_9PEZI/229-311    AC A0A1B8DV33.1
#=GS A0A1E3IPK3_9TREE/17-110     AC A0A1E3IPK3.1
#=GS A0A162MTL1_CORDF/21-107     AC A0A162MTL1.1
#=GS A0A1G4JFZ6_9SACH/20-105     AC A0A1G4JFZ6.1
#=GS A0A2C5Y3Y0_9HYPO/17-110     AC A0A2C5Y3Y0.1
#=GS A0A0D9X5V0_9ORYZ/17-91      AC A0A0D9X5V0.1
#=GS A0A6J8AA36_MYTCO/100-194    AC A0A6J8AA36.1
#=GS A0A369SB23_9METZ/231-313    AC A0A369SB23.1
#=GS A0A4Z0YRQ2_9PEZI/21-109     AC A0A4Z0YRQ2.1
#=GS D8SB36_SELML/36-119         AC D8SB36.1
#=GS A0A0L9UWG8_PHAAN/234-319    AC A0A0L9UWG8.1
#=GS A0A397GCF6_9EURO/229-312    AC A0A397GCF6.1
#=GS A0A2C9VL08_MANES/234-320    AC A0A2C9VL08.1
#=GS A0A0E0ASW2_9ORYZ/81-179     AC A0A0E0ASW2.1
#=GS A0A094F184_9PEZI/17-109     AC A0A094F184.1
#=GS A0A200PU80_9MAGN/490-584    AC A0A200PU80.1
#=GS D8M0D4_BLAHO/24-108         AC D8M0D4.1
#=GS A0A1E4T7A2_9ASCO/19-105     AC A0A1E4T7A2.1
#=GS A0A091EZZ7_CORBR/17-114     AC A0A091EZZ7.1
#=GS A0A2H5Q1V6_CITUN/25-120     AC A0A2H5Q1V6.1
#=GS A0A0L9UMI0_PHAAN/17-112     AC A0A0L9UMI0.1
#=GS A0A6J0VPR1_ODOVR/78-167     AC A0A6J0VPR1.1
#=GS A0A0B1PB52_UNCNE/21-110     AC A0A0B1PB52.1
#=GS A0A163HEG0_DIDRA/37-129     AC A0A163HEG0.1
#=GS A0A0N4WCR4_HAEPC/17-95      AC A0A0N4WCR4.1
#=GS A0A016VL35_9BILA/22-113     AC A0A016VL35.1
#=GS A0A1U8PL37_GOSHI/17-113     AC A0A1U8PL37.1
#=GS A0A023B201_GRENI/235-315    AC A0A023B201.1
#=GS A0A3N0XKC3_ANAGA/17-113     AC A0A3N0XKC3.1
#=GS A0A1J1ACQ7_9EURY/16-110     AC A0A1J1ACQ7.1
#=GS A0A3R7CBW9_CLOSI/409-498    AC A0A3R7CBW9.1
#=GS A0A5N5DMD2_9PEZI/21-109     AC A0A5N5DMD2.1
#=GS A0A2P5CPT8_PARAD/234-323    AC A0A2P5CPT8.1
#=GS A0A3L6TEA7_PANMI/17-111     AC A0A3L6TEA7.1
#=GS A0A061FME5_THECC/235-320    AC A0A061FME5.1
#=GS M0TKN6_MUSAM/17-114         AC M0TKN6.1
#=GS C4M649_ENTHI/16-105         AC C4M649.1
#=GS A0A452IND6_9SAUR/15-102     AC A0A452IND6.1
#=GS A0A376B8A2_9ASCO/19-97      AC A0A376B8A2.1
#=GS A0A084QFU7_STAC4/17-109     AC A0A084QFU7.1
#=GS A0A5J5MQF6_MUNRE/11-102     AC A0A5J5MQF6.1
#=GS A0A484H1Z6_SOUCH/22-113     AC A0A484H1Z6.1
#=GS A0A5J5MRE5_MUNRE/22-100     AC A0A5J5MRE5.1
#=GS A0A182Y4B9_ANOST/17-112     AC A0A182Y4B9.1
#=GS A0A0L0W289_9BASI/229-309    AC A0A0L0W289.1
#=GS A0A2G9G7N5_9LAMI/60-156     AC A0A2G9G7N5.1
#=GS K6UK77_PLACD/231-311        AC K6UK77.1
#=GS A0A507CCD2_9FUNG/262-343    AC A0A507CCD2.1
#=GS Q57ZQ1_TRYB2/19-106         AC Q57ZQ1.1
#=GS A0A2K6QGC2_RHIRO/197-284    AC A0A2K6QGC2.1
#=GS A0A4X2KGT2_VOMUR/231-316    AC A0A4X2KGT2.1
#=GS B5DGW9_SALSA/17-111         AC B5DGW9.1
#=GS G0VJP0_NAUCC/16-106         AC G0VJP0.1
#=GS A0A1J7I2R1_LUPAN/144-237    AC A0A1J7I2R1.1
#=GS A0A4T0VPN1_9PEZI/17-109     AC A0A4T0VPN1.1
#=GS A0A2Y9H468_NEOSC/19-87      AC A0A2Y9H468.1
#=GS A0A4W3HL00_CALMI/49-142     AC A0A4W3HL00.1
#=GS A0A1Y1YDK7_9FUNG/229-309    AC A0A1Y1YDK7.1
#=GS A0A183JVK6_9TREM/141-227    AC A0A183JVK6.1
#=GS A0A1J4KJI3_9EUKA/17-104     AC A0A1J4KJI3.1
#=GS A0A3Q7EWT4_SOLLC/5-73       AC A0A3Q7EWT4.1
#=GS F2X229_AILME/231-316        AC F2X229.1
#=GS M4YIX9_THEXX/21-107         AC M4YIX9.1
#=GS V4SDK1_CITCL/25-120         AC V4SDK1.1
#=GS A0A1S3AUG9_CUCME/21-112     AC A0A1S3AUG9.1
#=GS A0A1V6NIU9_9EURO/229-311    AC A0A1V6NIU9.1
#=GS A0A166JY05_9AGAM/23-111     AC A0A166JY05.1
#=GS A0A6P6TD78_COFAR/17-112     AC A0A6P6TD78.1
#=GS A0A2U3VT56_ODORO/18-88      AC A0A2U3VT56.1
#=GS W4H7I1_9STRA/231-313        AC W4H7I1.1
#=GS A0A4U0XIN6_9PEZI/17-115     AC A0A4U0XIN6.1
#=GS A0A5C3L1U2_9AGAR/17-109     AC A0A5C3L1U2.1
#=GS A0A3R7T0I1_PENVA/231-315    AC A0A3R7T0I1.1
#=GS A0A1B8D439_9PEZI/17-109     AC A0A1B8D439.1
#=GS A0A1X2G2I0_9FUNG/228-306    AC A0A1X2G2I0.1
#=GS A0A452E917_CAPHI/13-91      AC A0A452E917.1
#=GS A0A6P5Z204_DURZI/17-110     AC A0A6P5Z204.1
#=GS V4ZTD8_9ARCH/16-116         AC V4ZTD8.1
#=GS A0A2J7QLB8_9NEOP/231-316    AC A0A2J7QLB8.1
#=GS A0A2K5PQH1_CEBIM/169-254    AC A0A2K5PQH1.1
#=GS J9P5Q4_CANLF/207-292        AC J9P5Q4.2
#=GS A0A0M3JRP9_ANISI/240-325    AC A0A0M3JRP9.1
#=GS A0A1J7IL70_LUPAN/60-148     AC A0A1J7IL70.1
#=GS A0A6J3RVQ5_TURTR/22-113     AC A0A6J3RVQ5.1
#=GS A0A1Y2MBU4_EPING/35-127     AC A0A1Y2MBU4.1
#=GS A0A388MB53_CHABU/17-115     AC A0A388MB53.1
#=GS M4EZ12_BRARP/233-320        AC M4EZ12.1
#=GS A0A3N2PS11_9PEZI/229-312    AC A0A3N2PS11.1
#=GS A0A1A6H7H1_NEOLE/23-112     AC A0A1A6H7H1.1
#=GS K3YLC1_SETIT/34-121         AC K3YLC1.1
#=GS A0A2K5N276_CERAT/191-278    AC A0A2K5N276.1
#=GS A0A2N5TS53_9BASI/229-311    AC A0A2N5TS53.1
#=GS U5HHH9_USTV1/17-110         AC U5HHH9.1
#=GS A0A6A9SS70_9EURY/16-112     AC A0A6A9SS70.1
#=GS A0A067BQ39_SAPPC/17-107     AC A0A067BQ39.1
#=GS A0A5N6SL08_ASPPS/229-312    AC A0A5N6SL08.1
#=GS A0A5N6N8M6_9ASTR/336-426    AC A0A5N6N8M6.1
#=GS A0A286U9I6_9AGAM/192-275    AC A0A286U9I6.1
#=GS A0A7M7G7A1_APIME/17-113     AC A0A7M7G7A1.1
#=GS A0A2G4SZH7_RHIZD/20-106     AC A0A2G4SZH7.1
#=GS A0A2J6K5Z7_LACSA/17-112     AC A0A2J6K5Z7.1
#=GS A0A6P8WJH2_DROAB/22-111     AC A0A6P8WJH2.1
#=GS A0A2G5EUA5_AQUCA/234-319    AC A0A2G5EUA5.1
#=GS M4ELT2_BRARP/233-320        AC M4ELT2.1
#=GS A0A6A6YEE1_9PEZI/17-111     AC A0A6A6YEE1.1
#=GS A0A6S7PIU0_LACSI/199-286    AC A0A6S7PIU0.1
#=GS A0A340Y3D0_LIPVE/17-114     AC A0A340Y3D0.1
#=GS A0A165J9K2_XYLHT/229-310    AC A0A165J9K2.1
#=GS A0A6P5JUC2_PHACI/22-113     AC A0A6P5JUC2.1
#=GS A0A445B6A4_ARAHY/21-111     AC A0A445B6A4.1
#=GS B6A9I4_CRYMR/32-116         AC B6A9I4.1
#=GS A0A1A6HV91_NEOLE/108-184    AC A0A1A6HV91.1
#=GS RLA02_ARATH/233-317         AC Q42112.2
#=GS A0A2A2KUW1_9BILA/22-110     AC A0A2A2KUW1.1
#=GS A0A7E4RX23_CIMLE/17-115     AC A0A7E4RX23.1
#=GS A0A2A2LN30_9BILA/17-113     AC A0A2A2LN30.1
#=GS S8AHA7_DACHA/17-111         AC S8AHA7.1
#=GS A0A427XL06_9TREE/229-311    AC A0A427XL06.1
#=GS A0A0G4MVT6_9PEZI/21-108     AC A0A0G4MVT6.1
#=GS A0A151Z747_9MYCE/20-83      AC A0A151Z747.1
#=GS A0A0C3QLC4_9AGAM/229-310    AC A0A0C3QLC4.1
#=GS A0A7N4PWF7_SARHA/22-91      AC A0A7N4PWF7.1
#=GS J3PCZ0_GAET3/17-109         AC J3PCZ0.1
#=GS A0A1Z5KF03_FISSO/18-110     AC A0A1Z5KF03.1
#=GS A0A364NC22_9PLEO/21-110     AC A0A364NC22.1
#=GS A0A068RL98_9FUNG/33-119     AC A0A068RL98.1
#=GS A0A1S4G002_AEDAE/24-103     AC A0A1S4G002.1
#=GS A0A0D3DZT9_BRAOL/22-112     AC A0A0D3DZT9.1
#=GS A0A1E4SJR3_9ASCO/20-104     AC A0A1E4SJR3.1
#=GS A0A4W2D4V4_BOBOX/32-129     AC A0A4W2D4V4.1
#=GS A0A022Q0G0_ERYGU/125-212    AC A0A022Q0G0.1
#=GS A0A2A3E1Z2_APICC/34-121     AC A0A2A3E1Z2.1
#=GS A0A6G1QXF0_9TELE/22-112     AC A0A6G1QXF0.1
#=GS A0A3Q7UEN6_VULVU/231-316    AC A0A3Q7UEN6.1
#=GS A0A6J1C9A3_MOMCH/21-111     AC A0A6J1C9A3.1
#=GS A0A3L8SVF6_CHLGU/17-114     AC A0A3L8SVF6.1
#=GS T5ANZ8_OPHSC/21-107         AC T5ANZ8.1
#=GS A0A166V5S3_9HYPO/21-109     AC A0A166V5S3.1
#=GS A0A329SCR1_9STRA/17-107     AC A0A329SCR1.1
#=GS A0A2U9BFX8_SCOMX/17-116     AC A0A2U9BFX8.1
#=GS A0A6G1DUB7_9ORYZ/38-93      AC A0A6G1DUB7.1
#=GS A0A2J6M273_LACSA/261-347    AC A0A2J6M273.1
#=GS A0A261AVL4_9PELO/22-110     AC A0A261AVL4.1
#=GS Q5KNI7_CRYNJ/20-108         AC Q5KNI7.1
#=GS A0A4U0TKA5_9PEZI/17-111     AC A0A4U0TKA5.1
#=GS A0A6A2ZAW0_HIBSY/17-110     AC A0A6A2ZAW0.1
#=GS A0A166VKV9_9PEZI/21-109     AC A0A166VKV9.1
#=GS A0A060SLG7_PYCCI/17-117     AC A0A060SLG7.1
#=GS A0A1S4C2M6_TOBAC/22-114     AC A0A1S4C2M6.1
#=GS A0A1L9SHQ9_9EURO/17-109     AC A0A1L9SHQ9.1
#=GS A0A5N5EZS8_9ROSA/234-324    AC A0A5N5EZS8.1
#=GS A0A1B8EKG9_9PEZI/17-109     AC A0A1B8EKG9.1
#=GS A0A2K5NV19_CERAT/17-114     AC A0A2K5NV19.1
#=GS A0A6P6GCX8_ZIZJJ/17-113     AC A0A6P6GCX8.1
#=GS G3HSN7_CRIGR/22-101         AC G3HSN7.1
#=GS A0A0C2XBA0_AMAMU/21-111     AC A0A0C2XBA0.1
#=GS F6HC03_VITVI/234-319        AC F6HC03.1
#=GS A0A1S4CPG9_TOBAC/33-120     AC A0A1S4CPG9.1
#=GS A0A200Q2L6_9MAGN/344-434    AC A0A200Q2L6.1
#=GS A0A2R6PY82_ACTCC/5-99       AC A0A2R6PY82.1
#=GS A0A1X2HCW0_SYNRA/228-309    AC A0A1X2HCW0.1
#=GS R7S9H0_TREMS/229-314        AC R7S9H0.1
#=GS A0A212C1E3_CEREH/112-205    AC A0A212C1E3.1
#=GS RLA0_DANRE/234-318          AC Q9PV90.1
#=GS A0A5B8MFR0_9CHLO/17-105     AC A0A5B8MFR0.1
#=GS A0A485NDC0_LYNPA/2-92       AC A0A485NDC0.1
#=GS A0A341CSH6_NEOAA/27-99      AC A0A341CSH6.1
#=GS A0A2K6RBK4_RHIRO/20-106     AC A0A2K6RBK4.1
#=GS A0A341CVK6_NEOAA/20-88      AC A0A341CVK6.1
#=GS A0A402EU11_9SAUR/11-96      AC A0A402EU11.1
#=GS A0A6A1Q1A6_BALPH/1-64       AC A0A6A1Q1A6.1
#=GS A0A0R3S9M9_HYMDI/17-118     AC A0A0R3S9M9.1
#=GS A0A2R9B7M5_PANPA/20-101     AC A0A2R9B7M5.1
#=GS G9N846_HYPVG/17-110         AC G9N846.1
#=GS A0A3Q3KL74_9TELE/17-113     AC A0A3Q3KL74.1
#=GS A0A163J7D7_ABSGL/160-241    AC A0A163J7D7.1
#=GS A0A5N3ULT0_MUNRE/14-107     AC A0A5N3ULT0.1
#=GS A0A3Q0D509_MESAU/231-317    AC A0A3Q0D509.1
#=GS A0A2T9YUK4_9FUNG/21-70      AC A0A2T9YUK4.1
#=GS D1Z0C5_METPS/11-102         AC D1Z0C5.1
#=GS A0A422NZB2_9TRYP/120-207    AC A0A422NZB2.1
#=GS A0A067PQ73_9AGAM/229-313    AC A0A067PQ73.1
#=GS A0A2I3HBT0_NOMLE/22-113     AC A0A2I3HBT0.1
#=GS A0A177CP33_9PLEO/229-314    AC A0A177CP33.1
#=GS A0A0D0AT00_9AGAM/21-110     AC A0A0D0AT00.1
#=GS A0A094NDZ2_PODCR/17-58      AC A0A094NDZ2.1
#=GS RLA0_CAEEL/231-311          AC Q93572.3
#=GS H2AVX1_KAZAF/17-108         AC H2AVX1.1
#=GS M0SKK8_MUSAM/17-113         AC M0SKK8.1
#=GS G7DUM8_MIXOS/1-63           AC G7DUM8.1
#=GS A0A4P9ZGV2_9ASCO/20-105     AC A0A4P9ZGV2.1
#=GS A0A674AK75_SALTR/17-113     AC A0A674AK75.1
#=GS A0A0K0J056_BRUMA/18-113     AC A0A0K0J056.1
#=GS A0A135LX23_PENPA/229-311    AC A0A135LX23.1
#=GS H2P7Y2_PONAB/22-113         AC H2P7Y2.1
#=GS V5EYL1_KALBG/17-110         AC V5EYL1.1
#=GS A0A452FWS6_CAPHI/22-104     AC A0A452FWS6.1
#=GS A0A3E2GR45_SCYLI/1-36       AC A0A3E2GR45.1
#=GS A0A1E5WK14_9POAL/51-136     AC A0A1E5WK14.1
#=GS A0A423WDA3_9PEZI/17-109     AC A0A423WDA3.1
#=GS A7AQJ6_BABBO/231-311        AC A7AQJ6.1
#=GS A0A421F0N0_9STRA/17-105     AC A0A421F0N0.1
#=GS A0A1Y2X3S7_9PEZI/21-109     AC A0A1Y2X3S7.1
#=GS Q6GQC6_XENLA/17-114         AC Q6GQC6.1
#=GS A0A1V8UPT0_9PEZI/229-312    AC A0A1V8UPT0.1
#=GS A0A397VN77_9GLOM/16-115     AC A0A397VN77.1
#=GS I1HIY0_BRADI/17-112         AC I1HIY0.1
#=GS A0A010Q8L5_9PEZI/17-110     AC A0A010Q8L5.1
#=GS M4EW65_BRARP/17-113         AC M4EW65.1
#=GS A0A5N5KMJ4_9ROSI/420-493    AC A0A5N5KMJ4.1
#=GS A0A284R4C0_ARMOS/17-111     AC A0A284R4C0.1
#=GS A0A7G2CT41_9TRYP/21-107     AC A0A7G2CT41.1
#=GS A0A1Q5T154_9EURO/21-107     AC A0A1Q5T154.1
#=GS A0A183MT24_9TREM/21-113     AC A0A183MT24.1
#=GS A0A2K3M4V5_TRIPR/17-109     AC A0A2K3M4V5.1
#=GS A0A1D6LEZ7_MAIZE/11-94      AC A0A1D6LEZ7.1
#=GS A0A2P4Y422_9STRA/17-105     AC A0A2P4Y422.1
#=GS A0A1E3PMC4_9ASCO/21-94      AC A0A1E3PMC4.1
#=GS A0A398A8G8_BRACM/35-119     AC A0A398A8G8.1
#=GS A0A1S3A366_ERIEU/169-254    AC A0A1S3A366.1
#=GS M5BZB3_THACB/21-109         AC M5BZB3.1
#=GS A0A150GT33_GONPE/239-319    AC A0A150GT33.1
#=GS A0A2S7QDT9_9HELO/17-59      AC A0A2S7QDT9.1
#=GS A0A1Y2EXI6_9FUNG/21-104     AC A0A1Y2EXI6.1
#=GS A0A3G2S793_9BASI/21-109     AC A0A3G2S793.1
#=GS A0A340WUU4_LIPVE/22-105     AC A0A340WUU4.1
#=GS A0A383ZL33_BALAS/22-113     AC A0A383ZL33.1
#=GS A0A0D0E5B5_9AGAM/17-112     AC A0A0D0E5B5.1
#=GS I1HYI5_BRADI/17-112         AC I1HYI5.1
#=GS RLA01_ARATH/234-316         AC O04204.1
#=GS A0A061F117_THECC/17-112     AC A0A061F117.1
#=GS A0A2K5D7H5_AOTNA/22-113     AC A0A2K5D7H5.1
#=GS A0A1S7HH83_9SACH/17-108     AC A0A1S7HH83.1
#=GS A0A4D9AWJ6_SALSN/21-111     AC A0A4D9AWJ6.1
#=GS A0A6J1NZM2_BICAN/17-110     AC A0A6J1NZM2.1
#=GS A0A6A4KWL4_9ERIC/16-102     AC A0A6A4KWL4.1
#=GS A0A2K5HIV6_COLAP/18-88      AC A0A2K5HIV6.1
#=GS A0A1S4E0L6_CUCME/21-93      AC A0A1S4E0L6.1
#=GS A0A0E0NFU0_ORYRU/17-112     AC A0A0E0NFU0.1
#=GS A0A1L9PNC1_ASPVE/21-108     AC A0A1L9PNC1.1
#=GS A0A200Q499_9MAGN/21-108     AC A0A200Q499.1
#=GS F9XNW3_ZYMTI/21-109         AC F9XNW3.1
#=GS A0A7N4P8U9_SARHA/17-114     AC A0A7N4P8U9.1
#=GS A0A1U7VHH1_NICSY/21-111     AC A0A1U7VHH1.1
#=GS A0A4Z2IRZ5_9TELE/17-117     AC A0A4Z2IRZ5.1
#=GS A0A016SL67_9BILA/17-111     AC A0A016SL67.1
#=GS T1JHI0_STRMM/22-115         AC T1JHI0.1
#=GS A0A5C3M406_9AGAR/229-310    AC A0A5C3M406.1
#=GS K1VNF7_TRIAC/229-311        AC K1VNF7.1
#=GS A0A077YWM4_TRITR/231-314    AC A0A077YWM4.1
#=GS A0A2U1MF61_ARTAN/4-68       AC A0A2U1MF61.1
#=GS D5E968_METMS/16-102         AC D5E968.1
#=GS A0A4W6CQR9_LATCA/170-242    AC A0A4W6CQR9.1
#=GS A0A0T6AXZ8_9SCAR/22-113     AC A0A0T6AXZ8.1
#=GS A0A165MGL6_9APHY/17-111     AC A0A165MGL6.1
#=GS A0A6I8NC25_ORNAN/22-113     AC A0A6I8NC25.1
#=GS A0A2G2XDL1_CAPBA/234-319    AC A0A2G2XDL1.1
#=GS A0A0C9WLA7_9AGAR/21-107     AC A0A0C9WLA7.1
#=GS A0A4D9DYG7_9SAUR/50-146     AC A0A4D9DYG7.1
#=GS A0A3Q3AKM6_KRYMA/22-112     AC A0A3Q3AKM6.1
#=GS A0A6F9CYB1_9TELE/209-292    AC A0A6F9CYB1.1
#=GS A0A1Y3ARV0_EURMA/17-117     AC A0A1Y3ARV0.1
#=GS A3BR69_ORYSJ/17-113         AC A3BR69.1
#=GS A0A395NMP9_TRIAR/21-108     AC A0A395NMP9.1
#=GS A0A4Z0Z5J9_9PEZI/17-110     AC A0A4Z0Z5J9.1
#=GS A0A1Y1UJG7_9TREE/229-314    AC A0A1Y1UJG7.1
#=GS Q2FQ36_METHJ/16-102         AC Q2FQ36.1
#=GS A0A674BCS9_SALTR/21-117     AC A0A674BCS9.1
#=GS A0A540NFG2_MALBA/21-111     AC A0A540NFG2.1
#=GS A0A1B9FZ44_9TREE/229-312    AC A0A1B9FZ44.1
#=GS A0A328S1L3_9EURY/13-99      AC A0A328S1L3.1
#=GS A0A453BXQ8_AEGTS/17-112     AC A0A453BXQ8.1
#=GS A0A372QVY0_9GLOM/231-313    AC A0A372QVY0.1
#=GS A0A3Q1JI07_ANATE/169-253    AC A0A3Q1JI07.1
#=GS A0A6J1PWP8_9HYME/17-112     AC A0A6J1PWP8.1
#=GS A0A022Q722_ERYGU/128-201    AC A0A022Q722.1
#=GS F0YML5_AURAN/231-314        AC F0YML5.1
#=GS A0A3M9YCM4_9PEZI/21-108     AC A0A3M9YCM4.1
#=GS A0A0L0GDQ9_9EUKA/32-116     AC A0A0L0GDQ9.1
#=GS A0A2K6N8K3_RHIRO/17-112     AC A0A2K6N8K3.1
#=GS G8YDF1_PICSO/61-144         AC G8YDF1.1
#=GS A0A2T4CJ55_TRILO/229-314    AC A0A2T4CJ55.1
#=GS A0A376BAG1_9ASCO/16-104     AC A0A376BAG1.1
#=GS A0A0E0Q800_ORYRU/17-106     AC A0A0E0Q800.1
#=GS A0A072VJD3_MEDTR/21-109     AC A0A072VJD3.1
#=GS Q0CUQ8_ASPTN/229-311        AC Q0CUQ8.1
#=GS A0A2U3YNM2_LEPWE/22-113     AC A0A2U3YNM2.1
#=GS A0A5N6P086_9ASTR/17-114     AC A0A5N6P086.1
#=GS V4MFC6_EUTSA/17-114         AC V4MFC6.1
#=GS S4S171_PETMA/231-313        AC S4S171.1
#=GS A0A482XSW9_LAOST/192-275    AC A0A482XSW9.1
#=GS A0A6A4WRM1_AMPAM/231-311    AC A0A6A4WRM1.1
#=GS A0A2A9NXK8_9AGAR/229-334    AC A0A2A9NXK8.1
#=GS U6LVG6_9EIME/1-68           AC U6LVG6.1
#=GS A0A1U8LXY9_GOSHI/17-111     AC A0A1U8LXY9.1
#=GS B9HVZ3_POPTR/17-109         AC B9HVZ3.1
#=GS A0A178BD65_9PLEO/17-110     AC A0A178BD65.1
#=GS A0A2I8VKD6_9EURY/16-112     AC A0A2I8VKD6.1
#=GS A0A1S4D3Y1_TOBAC/21-111     AC A0A1S4D3Y1.1
#=GS A0A1W0W320_SORBI/34-132     AC A0A1W0W320.1
#=GS A0A1Q9ECN2_SYMMI/36-128     AC A0A1Q9ECN2.1
#=GS I7GJM4_MACFA/17-114         AC I7GJM4.1
#=GS A0A0N4YHX7_NIPBR/26-121     AC A0A0N4YHX7.1
#=GS A0A6A2ZUC2_HIBSY/234-319    AC A0A6A2ZUC2.1
#=GS G3Y658_ASPNA/17-109         AC G3Y658.1
#=GS A0A6A6L804_HEVBR/234-319    AC A0A6A6L804.1
#=GS A0A402FF19_9SAUR/104-200    AC A0A402FF19.1
#=GS F4NW78_BATDJ/231-316        AC F4NW78.1
#=GS Q4N3J3_THEPA/32-116         AC Q4N3J3.1
#=GS A0A6P6XM73_DERPT/262-307    AC A0A6P6XM73.1
#=GS A0A2G2XQ88_CAPBA/1-86       AC A0A2G2XQ88.1
#=GS I1C523_RHIO9/17-107         AC I1C523.1
#=GS A0A401PDU9_SCYTO/22-108     AC A0A401PDU9.1
#=GS A2X5K7_ORYSI/17-112         AC A2X5K7.1
#=GS A0A3A2ZBH8_9EURO/17-108     AC A0A3A2ZBH8.1
#=GS A0A0D2FCJ8_9EURO/17-113     AC A0A0D2FCJ8.1
#=GS A0A2X0MAI6_9BASI/20-106     AC A0A2X0MAI6.1
#=GS U1MYU6_9EURY/16-112         AC U1MYU6.1
#=GS A0A0C3GNV0_9PEZI/17-113     AC A0A0C3GNV0.1
#=GS D8QQ15_SELML/17-112         AC D8QQ15.1
#=GS A0A2K5M046_CERAT/231-317    AC A0A2K5M046.1
#=GS A1RYJ9_THEPD/16-106         AC A1RYJ9.1
#=GS A0A0D2S6N8_GOSRA/234-320    AC A0A0D2S6N8.1
#=GS A0A093XSX9_9PEZI/17-109     AC A0A093XSX9.1
#=GS A0A7J6JP43_COLFN/229-311    AC A0A7J6JP43.1
#=GS A0A2P5FBN1_TREOI/233-318    AC A0A2P5FBN1.1
#=GS K8EQA9_9CHLO/36-121         AC K8EQA9.1
#=GS A0A0P0WMY2_ORYSJ/43-138     AC A0A0P0WMY2.1
#=GS A0A2U1NKV9_ARTAN/233-319    AC A0A2U1NKV9.1
#=GS A0A016VKC4_9BILA/107-165    AC A0A016VKC4.1
#=GS K7FUA9_PELSI/17-114         AC K7FUA9.1
#=GS A0A6J3RSL5_TURTR/17-113     AC A0A6J3RSL5.1
#=GS A0A0D2QNS5_GOSRA/22-101     AC A0A0D2QNS5.1
#=GS G3HSW6_CRIGR/72-152         AC G3HSW6.1
#=GS A0A397ZZ89_BRACM/22-107     AC A0A397ZZ89.1
#=GS A0A196S7Q6_BLAHN/149-233    AC A0A196S7Q6.1
#=GS A0A3Q7T9B3_VULVU/176-261    AC A0A3Q7T9B3.1
#=GS Q5B9P6_EMENI/229-311        AC Q5B9P6.1
#=GS A0A5P1FUR2_ASPOF/17-111     AC A0A5P1FUR2.1
#=GS A0A397GYZ5_9EURO/17-110     AC A0A397GYZ5.1
#=GS A0A0G2HNV7_9PEZI/229-312    AC A0A0G2HNV7.1
#=GS RLA1_PIG/22-113             AC A1XQU7.1
#=GS A0A2K6PFT1_RHIRO/22-119     AC A0A2K6PFT1.1
#=GS A0A5M9JYP9_MONFR/99-191     AC A0A5M9JYP9.1
#=GS A0A2N1J7F9_9BASI/229-312    AC A0A2N1J7F9.1
#=GS U6E9V8_9EURY/16-101         AC U6E9V8.1
#=GS A0A433CWL3_9FUNG/20-109     AC A0A433CWL3.1
#=GS A0A672THJ1_STRHB/22-114     AC A0A672THJ1.1
#=GS C5KZG5_PERM5/32-119         AC C5KZG5.1
#=GS A0A7N4NHE6_SARHA/169-254    AC A0A7N4NHE6.1
#=GS A0A5D2SRE5_GOSMU/22-113     AC A0A5D2SRE5.1
#=GS A0A0J8R1Q4_COCIT/229-311    AC A0A0J8R1Q4.1
#=GS A0A0D3GW13_9ORYZ/234-318    AC A0A0D3GW13.1
#=GS A0A5G2QST0_PIG/12-103       AC A0A5G2QST0.1
#=GS A1CQX8_ASPCL/21-107         AC A1CQX8.1
#=GS K9FP11_PEND2/229-311        AC K9FP11.1
#=GS A0A6A5P8W9_LUPAL/60-148     AC A0A6A5P8W9.1
#=GS A0A067KLI6_JATCU/21-111     AC A0A067KLI6.1
#=GS A0A2S7P7E4_9HELO/21-110     AC A0A2S7P7E4.1
#=GS V8P782_OPHHA/30-117         AC V8P782.1
#=GS A0A166CN91_9EURY/16-99      AC A0A166CN91.1
#=GS A0A2T7A9C6_TUBBO/17-110     AC A0A2T7A9C6.1
#=GS A0A6P6AQG2_DURZI/71-166     AC A0A6P6AQG2.1
#=GS A0A3P4NJE7_GULGU/23-113     AC A0A3P4NJE7.1
#=GS A0A024UJC7_9STRA/231-311    AC A0A024UJC7.1
#=GS A0A2I4EF58_JUGRE/17-114     AC A0A2I4EF58.2
#=GS E9HA44_DAPPU/17-114         AC E9HA44.1
#=GS A0A5N5N1Z4_9ROSI/17-112     AC A0A5N5N1Z4.1
#=GS G0WA99_NAUDC/229-311        AC G0WA99.1
#=GS H2N9R0_PONAB/13-98          AC H2N9R0.1
#=GS A0A3M2SPV5_9HYPO/21-108     AC A0A3M2SPV5.1
#=GS A0A183IHS0_9BILA/204-294    AC A0A183IHS0.1
#=GS A0A6J0L6M8_RAPSA/23-119     AC A0A6J0L6M8.1
#=GS F6GYV5_VITVI/14-97          AC F6GYV5.1
#=GS A0A2Y9FT57_PHYMC/231-319    AC A0A2Y9FT57.1
#=GS A0A2B7YCD4_9EURO/229-313    AC A0A2B7YCD4.1
#=GS A2DXP9_TRIVA/17-105         AC A2DXP9.1
#=GS A0A540MXV8_MALBA/16-120     AC A0A540MXV8.1
#=GS A0A436ZR22_9PEZI/229-311    AC A0A436ZR22.1
#=GS A0A1R2ANU2_9CILI/17-111     AC A0A1R2ANU2.1
#=GS K1Y1J6_MARBU/17-111         AC K1Y1J6.1
#=GS A0A565C6Y8_9BRAS/17-98      AC A0A565C6Y8.1
#=GS V4SKD3_CITCL/17-111         AC V4SKD3.1
#=GS A0A5C3DNU7_9BASI/21-108     AC A0A5C3DNU7.1
#=GS A0A5B6U9U0_9ROSI/234-320    AC A0A5B6U9U0.1
#=GS E9E4Z7_METAQ/21-108         AC E9E4Z7.1
#=GS A0A1S7UI78_ROSNE/17-110     AC A0A1S7UI78.1
#=GS A0A6P6DHW7_OCTDE/22-103     AC A0A6P6DHW7.1
#=GS A0A317VL68_9EURO/17-108     AC A0A317VL68.1
#=GS A0A0L8FF90_OCTBM/22-114     AC A0A0L8FF90.1
#=GS RL12_METTH/16-100           AC P05394.2
#=GS A0A669QSR6_PHACC/17-66      AC A0A669QSR6.1
#=GS G4VFI4_SCHMA/17-113         AC G4VFI4.1
#=GS Q0CPE0_ASPTN/17-109         AC Q0CPE0.1
#=GS A0A024W6I0_PLAFA/32-117     AC A0A024W6I0.1
#=GS V7CZG7_PHAVU/234-316        AC V7CZG7.1
#=GS A0A2G3AUJ0_CAPCH/21-111     AC A0A2G3AUJ0.1
#=GS A0A2U3V1Y9_TURTR/231-317    AC A0A2U3V1Y9.2
#=GS A0A6J0YU01_ODOVR/55-141     AC A0A6J0YU01.1
#=GS A0A2G9FZC7_9LAMI/21-112     AC A0A2G9FZC7.1
#=GS A0A2R8ZFB2_PANPA/22-106     AC A0A2R8ZFB2.1
#=GS A0A428R7P8_9HYPO/21-108     AC A0A428R7P8.1
#=GS A0A498KQU4_MALDO/234-319    AC A0A498KQU4.1
#=GS A0A6J1DJB9_MOMCH/17-114     AC A0A6J1DJB9.1
#=GS A0A2J6JR87_LACSA/234-320    AC A0A2J6JR87.1
#=GS D3STY1_NATMM/16-112         AC D3STY1.1
#=GS G3UAL3_LOXAF/21-110         AC G3UAL3.1
#=GS A0A5N6MAR8_9ASTR/26-116     AC A0A5N6MAR8.1
#=GS A0A2K6MLS0_RHIBE/9-101      AC A0A2K6MLS0.1
#=GS A0A166UGE7_9AGAM/229-311    AC A0A166UGE7.1
#=GS M4F610_BRARP/22-110         AC M4F610.1
#=GS A0A2K5PQI8_CEBIM/20-105     AC A0A2K5PQI8.1
#=GS A0A5J4YQQ1_PORPP/23-87      AC A0A5J4YQQ1.1
#=GS A0A1S4C503_TOBAC/17-111     AC A0A1S4C503.1
#=GS L5K8L8_PTEAL/26-97          AC L5K8L8.1
#=GS A0A2H5NJP1_CITUN/547-630    AC A0A2H5NJP1.1
#=GS A0A409VGW6_9AGAR/17-111     AC A0A409VGW6.1
#=GS A0A078HJF4_BRANA/22-113     AC A0A078HJF4.1
#=GS A0A4U1EK34_MONMO/22-113     AC A0A4U1EK34.1
#=GS A0A5N5KJP9_9PEZI/17-111     AC A0A5N5KJP9.1
#=GS A0A4P9X1I2_9FUNG/17-106     AC A0A4P9X1I2.1
#=GS A0A0E0MJB8_ORYPU/614-697    AC A0A0E0MJB8.1
#=GS S9UX97_9TRYP/16-105         AC S9UX97.1
#=GS A0A498I8W0_MALDO/16-121     AC A0A498I8W0.1
#=GS A0A1A0H9M1_9ASCO/20-104     AC A0A1A0H9M1.1
#=GS D0NS77_PHYIT/27-114         AC D0NS77.1
#=GS M4B8B5_HYAAE/231-312        AC M4B8B5.1
#=GS A0A1V9ZQH7_9STRA/26-113     AC A0A1V9ZQH7.1
#=GS A0A1E3B9V7_9EURO/17-107     AC A0A1E3B9V7.1
#=GS A0A2P6TIB0_CHLSO/196-287    AC A0A2P6TIB0.1
#=GS A7SQ36_NEMVE/231-312        AC A7SQ36.1
#=GS A0A446J463_TRITD/17-110     AC A0A446J463.1
#=GS A0A2K1LB52_PHYPA/54-141     AC A0A2K1LB52.1
#=GS M0V315_HORVV/17-112         AC M0V315.1
#=GS A0A3Q3VU80_MOLML/169-253    AC A0A3Q3VU80.1
#=GS A0A6I9L778_PERMB/14-79      AC A0A6I9L778.1
#=GS A0A4Y8D754_9HELO/21-109     AC A0A4Y8D754.1
#=GS W9DX87_METTI/16-101         AC W9DX87.1
#=GS A0A1S3TNW5_VIGRR/17-112     AC A0A1S3TNW5.1
#=GS A0A1L7WN06_9HELO/17-111     AC A0A1L7WN06.1
#=GS A0A6P3GT59_BISBI/22-113     AC A0A6P3GT59.1
#=GS A0A6A4VBA2_AMPAM/28-121     AC A0A6A4VBA2.1
#=GS G9PCD3_HYPAI/21-107         AC G9PCD3.1
#=GS A0A6P8HDX6_ACTTE/17-111     AC A0A6P8HDX6.1
#=GS W9CY22_SCLBF/229-312        AC W9CY22.1
#=GS A0A6F8ZU59_9TELE/17-111     AC A0A6F8ZU59.1
#=GS W9WVT8_9EURO/221-305        AC W9WVT8.1
#=GS B6DDU4_ANODA/17-112         AC B6DDU4.1
#=GS A0A0W8CIM8_PHYNI/17-107     AC A0A0W8CIM8.1
#=GS A0A1E4RTA6_9ASCO/20-103     AC A0A1E4RTA6.1
#=GS A0A367YKM7_9ASCO/229-312    AC A0A367YKM7.1
#=GS W7J9R5_PLAFA/231-315        AC W7J9R5.1
#=GS A0A058ZB71_FONAL/231-311    AC A0A058ZB71.1
#=GS A0A4C1TXS6_EUMVA/17-111     AC A0A4C1TXS6.1
#=GS A0A2G5B599_COERN/229-311    AC A0A2G5B599.1
#=GS A0A091WYW6_OPIHO/17-114     AC A0A091WYW6.1
#=GS C7NWT7_HALMD/16-115         AC C7NWT7.1
#=GS A0A507E595_9FUNG/231-313    AC A0A507E595.1
#=GS A0A5A7REY7_STRAF/17-113     AC A0A5A7REY7.1
#=GS R1D1Z4_EMIHU/25-114         AC R1D1Z4.1
#=GS A0A286XGV1_CAVPO/20-96      AC A0A286XGV1.1
#=GS A0DAN7_PARTE/34-121         AC A0DAN7.1
#=GS A0A168LAW7_ABSGL/102-160    AC A0A168LAW7.1
#=GS A0A2U1LG96_ARTAN/42-137     AC A0A2U1LG96.1
#=GS A0A6P3RCJ9_PTEVA/17-114     AC A0A6P3RCJ9.1
#=GS A0A1X2IJJ0_9FUNG/20-105     AC A0A1X2IJJ0.1
#=GS G0SEG9_CHATD/21-110         AC G0SEG9.1
#=GS A0A1U8LF15_GOSHI/17-84      AC A0A1U8LF15.1
#=GS A0A167X9V0_9EURO/17-109     AC A0A167X9V0.1
#=GS A0A4P1R379_LUPAN/23-117     AC A0A4P1R379.1
#=GS A0A0G4PLX6_PENCA/21-106     AC A0A0G4PLX6.1
#=GS A0A337SK71_FELCA/169-254    AC A0A337SK71.1
#=GS A0A0K8LN86_9EURO/229-312    AC A0A0K8LN86.1
#=GS R0FRV7_9BRAS/17-111         AC R0FRV7.1
#=GS A0A1S4C8V9_TOBAC/22-111     AC A0A1S4C8V9.1
#=GS E2AYQ2_CAMFO/829-925        AC E2AYQ2.1
#=GS A0A1H0Z415_9EURY/16-109     AC A0A1H0Z415.1
#=GS A0A3P8VYT2_CYNSE/22-88      AC A0A3P8VYT2.1
#=GS A0A6A4KCH0_APOLU/4-50       AC A0A6A4KCH0.1
#=GS G0VG13_NAUCC/19-105         AC G0VG13.1
#=GS A0A384CSL2_URSMA/17-114     AC A0A384CSL2.1
#=GS A0A1A6A1V3_9TREE/229-312    AC A0A1A6A1V3.1
#=GS E2R9Y9_CANLF/17-114         AC E2R9Y9.1
#=GS A0A2V3J3G6_9FLOR/244-327    AC A0A2V3J3G6.1
#=GS A0A6J0MR63_RAPSA/22-112     AC A0A6J0MR63.1
#=GS A0A421CWY0_9EURO/229-312    AC A0A421CWY0.1
#=GS A0A328PH47_9EURY/16-102     AC A0A328PH47.1
#=GS F4Q2X4_CAVFA/24-112         AC F4Q2X4.1
#=GS A0A5E3WUA4_9AGAM/2-78       AC A0A5E3WUA4.1
#=GS A0A2G5DPW2_AQUCA/35-117     AC A0A2G5DPW2.1
#=GS A0A4P1R7P3_LUPAN/234-321    AC A0A4P1R7P3.1
#=GS A0A2I3G707_NOMLE/22-72      AC A0A2I3G707.1
#=GS A0A372QWS1_9GLOM/24-113     AC A0A372QWS1.1
#=GS A0A423SWS8_PENVA/60-92      AC A0A423SWS8.1
#=GS A0A0C7MUR7_9SACH/20-106     AC A0A0C7MUR7.1
#=GS W1PR36_AMBTC/17-119         AC W1PR36.1
#=GS A0A232FK66_9HYME/22-111     AC A0A232FK66.1
#=GS A0A4Y7QKE8_9AGAM/44-111     AC A0A4Y7QKE8.1
#=GS A0A4E0RD46_FASHE/17-115     AC A0A4E0RD46.1
#=GS W5M0N0_LEPOC/231-315        AC W5M0N0.1
#=GS A0A1A0H9S1_9ASCO/17-109     AC A0A1A0H9S1.1
#=GS A0A5M3MZ18_CONPW/229-311    AC A0A5M3MZ18.1
#=GS A0A433TNU4_ELYCH/22-112     AC A0A433TNU4.1
#=GS A0A328RYA8_9EURY/16-102     AC A0A328RYA8.1
#=GS E5R4R3_LEPMJ/21-110         AC E5R4R3.1
#=GS A0A5C2S8E7_9APHY/229-310    AC A0A5C2S8E7.1
#=GS A0A2G3ANC5_CAPAN/91-162     AC A0A2G3ANC5.1
#=GS W7TV03_9STRA/27-112         AC W7TV03.1
#=GS A0A0D3HR32_9ORYZ/795-880    AC A0A0D3HR32.1
#=GS G2QTI9_THETT/21-110         AC G2QTI9.1
#=GS A0A6P4F5J3_DRORH/22-111     AC A0A6P4F5J3.1
#=GS A0A2K6R8P7_RHIRO/22-112     AC A0A2K6R8P7.1
#=GS C1LW72_SCHJA/21-115         AC C1LW72.1
#=GS E9D178_COCPS/21-110         AC E9D178.1
#=GS A0A6J3DYP7_AYTFU/231-317    AC A0A6J3DYP7.1
#=GS A0A2S4Q025_9PEZI/230-309    AC A0A2S4Q025.1
#=GS B6DDT3_ANODA/23-114         AC B6DDT3.1
#=GS A0A168CFM8_CORFA/17-110     AC A0A168CFM8.1
#=GS F0XS22_GROCL/229-311        AC F0XS22.1
#=GS A0A1Y1WV99_9FUNG/20-105     AC A0A1Y1WV99.1
#=GS A0A4U1FHX1_MONMO/67-157     AC A0A4U1FHX1.1
#=GS E0CVC0_VITVI/21-110         AC E0CVC0.1
#=GS I3MH39_ICTTR/231-316        AC I3MH39.1
#=GS A0A0F8DMJ7_CERFI/21-107     AC A0A0F8DMJ7.1
#=GS A0A6F8ZV64_9TELE/231-314    AC A0A6F8ZV64.1
#=GS A0A6I9NV76_9TELE/17-112     AC A0A6I9NV76.1
#=GS A0A1R3RS31_ASPC5/229-311    AC A0A1R3RS31.1
#=GS A0A6F9AYA1_9TELE/17-104     AC A0A6F9AYA1.1
#=GS A0A7C8MYZ8_9PEZI/17-110     AC A0A7C8MYZ8.1
#=GS D4AJZ8_ARTBC/229-307        AC D4AJZ8.1
#=GS G9A019_TORDC/16-105         AC G9A019.1
#=GS RLA0_HUMAN/231-316          AC P05388.1
#=GS A0A178Z6L0_9EURO/221-305    AC A0A178Z6L0.1
#=GS A0A0J7LAD7_LASNI/17-113     AC A0A0J7LAD7.1
#=GS A0A2K6ELK7_PROCO/22-113     AC A0A2K6ELK7.1
#=GS A0A395T9S8_9HYPO/17-109     AC A0A395T9S8.1
#=GS A0A6A5P8B1_LUPAL/21-109     AC A0A6A5P8B1.1
#=GS A0A0C4ESN6_PUCT1/19-107     AC A0A0C4ESN6.1
#=GS A0A0E0IXV5_ORYNI/327-412    AC A0A0E0IXV5.1
#=GS A0A183BB09_9TREM/21-116     AC A0A183BB09.1
#=GS A0A2K5LZX8_CERAT/18-88      AC A0A2K5LZX8.1
#=GS W7U6S0_9STRA/333-416        AC W7U6S0.1
#=GS A0A4Y7T3B6_9AGAR/22-108     AC A0A4Y7T3B6.1
#=GS A0A401H1R0_9APHY/229-312    AC A0A401H1R0.1
#=GS A0A3L6T8L3_PANMI/17-111     AC A0A3L6T8L3.1
#=GS A0A6G0Z603_APHCR/16-111     AC A0A6G0Z603.1
#=GS A0A4X2LSS5_VOMUR/22-113     AC A0A4X2LSS5.1
#=GS A0A4T0GSS1_WALIC/229-309    AC A0A4T0GSS1.1
#=GS A0A078GIA9_BRANA/234-318    AC A0A078GIA9.1
#=GS A0A2K5E837_AOTNA/169-254    AC A0A2K5E837.1
#=GS A0A337RWW7_FELCA/18-88      AC A0A337RWW7.1
#=GS A0A6P6STU3_COFAR/16-123     AC A0A6P6STU3.1
#=GS A0A023B2U7_GRENI/17-106     AC A0A023B2U7.1
#=GS A0A2U1MFC3_ARTAN/45-107     AC A0A2U1MFC3.1
#=GS Q6C2R2_YARLI/17-107         AC Q6C2R2.1
#=GS A0A4S8IRC3_MUSBA/17-114     AC A0A4S8IRC3.1
#=GS A0A267EGM8_9PLAT/35-127     AC A0A267EGM8.1
#=GS J8TXQ1_SACK1/17-110         AC J8TXQ1.1
#=GS A0A484EFW9_BRELC/27-115     AC A0A484EFW9.1
#=GS A0A5N3XEW3_MUNRE/59-118     AC A0A5N3XEW3.1
#=GS A0A212EXT2_DANPL/22-111     AC A0A212EXT2.1
#=GS A0A517LLG5_9PEZI/21-109     AC A0A517LLG5.1
#=GS N1Q5J3_PSEFD/17-112         AC N1Q5J3.1
#=GS A0A674MT46_TAKRU/22-90      AC A0A674MT46.1
#=GS A0A6A2ZH70_HIBSY/17-113     AC A0A6A2ZH70.1
#=GS M3Z4Z1_MUSPF/17-108         AC M3Z4Z1.1
#=GS G2X1X0_VERDV/229-311        AC G2X1X0.1
#=GS A0A022R574_ERYGU/17-111     AC A0A022R574.1
#=GS A0A371DXM3_9APHY/18-81      AC A0A371DXM3.1
#=GS A0A194RK76_PAPMA/231-315    AC A0A194RK76.1
#=GS A0A066WRE5_TILAU/17-111     AC A0A066WRE5.1
#=GS A0A672TLD8_STRHB/17-114     AC A0A672TLD8.1
#=GS A0A484GZB9_SOUCH/22-113     AC A0A484GZB9.1
#=GS J9IG69_9SPIT/256-331        AC J9IG69.1
#=GS A0A0K3CKG0_RHOTO/17-109     AC A0A0K3CKG0.1
#=GS A0A4U1F393_MONMO/345-434    AC A0A4U1F393.1
#=GS W4G6T9_9STRA/50-136         AC W4G6T9.1
#=GS A0A452EA01_CAPHI/13-108     AC A0A452EA01.1
#=GS A0A1L9PNT8_ASPVE/229-311    AC A0A1L9PNT8.1
#=GS A0A1A6HMR5_NEOLE/22-113     AC A0A1A6HMR5.1
#=GS A0A315UTP8_GAMAF/42-132     AC A0A315UTP8.1
#=GS N1RTW5_FUSC4/17-109         AC N1RTW5.1
#=GS A0A2I3LW88_PAPAN/18-88      AC A0A2I3LW88.1
#=GS A0A369J8X7_HYPMA/21-108     AC A0A369J8X7.1
#=GS J7RV13_KAZNA/19-105         AC J7RV13.1
#=GS L8IWX6_9CETA/13-87          AC L8IWX6.1
#=GS A0A5J4YX36_PORPP/21-106     AC A0A5J4YX36.1
#=GS A0A2K5XBL3_MANLE/22-113     AC A0A2K5XBL3.1
#=GS A0A1R1PSB6_ZANCU/17-108     AC A0A1R1PSB6.1
#=GS B9SGY2_RICCO/17-101         AC B9SGY2.1
#=GS A0A168R8Y6_ABSGL/17-108     AC A0A168R8Y6.1
#=GS A0A0N0VFM7_9TRYP/238-325    AC A0A0N0VFM7.1
#=GS A0A1U8CQN0_MESAU/17-113     AC A0A1U8CQN0.1
#=GS A0A1S3YY25_TOBAC/17-113     AC A0A1S3YY25.1
#=GS Q0US67_PHANO/108-198        AC Q0US67.2
#=GS A0A3Q3LCQ7_9TELE/17-114     AC A0A3Q3LCQ7.1
#=GS A0A1B7TBP1_9ASCO/20-104     AC A0A1B7TBP1.1
#=GS A0A397VIL3_9GLOM/16-71      AC A0A397VIL3.1
#=GS A0A7M7G3F8_NASVI/22-111     AC A0A7M7G3F8.1
#=GS B6H209_PENRW/21-106         AC B6H209.1
#=GS A0A0B1SD63_OESDE/17-68      AC A0A0B1SD63.1
#=GS A0A2K5DFH6_AOTNA/16-93      AC A0A2K5DFH6.1
#=GS A0A066WL39_TILAU/229-312    AC A0A066WL39.1
#=GS A0A2R6PLH6_ACTCC/234-320    AC A0A2R6PLH6.1
#=GS E9H1X6_DAPPU/231-319        AC E9H1X6.1
#=GS C5LYE6_PERM5/234-317        AC C5LYE6.1
#=GS A0A674EG88_SALTR/22-110     AC A0A674EG88.1
#=GS A0A5J9W882_9POAL/21-108     AC A0A5J9W882.1
#=GS A0D341_PARTE/34-121         AC A0D341.1
#=GS A0A319E6U9_ASPSB/17-108     AC A0A319E6U9.1
#=GS A0A4Z1L4B7_9HELO/229-311    AC A0A4Z1L4B7.1
#=GS A0A0D8XSZ0_DICVI/231-313    AC A0A0D8XSZ0.1
#=GS A0A196SAQ9_BLAHN/30-113     AC A0A196SAQ9.1
#=GS S9VTU9_SCHCR/17-108         AC S9VTU9.1
#=GS C4QV50_KOMPG/229-311        AC C4QV50.1
#=GS A0A662YQP7_ACIRT/22-113     AC A0A662YQP7.1
#=GS A0A6P3GBB8_BISBI/231-317    AC A0A6P3GBB8.1
#=GS A0A7H9B4B7_ZYGMR/16-106     AC A0A7H9B4B7.1
#=GS A0A6A4PI54_LUPAL/18-116     AC A0A6A4PI54.1
#=GS A0A2I2YBK1_GORGO/169-254    AC A0A2I2YBK1.1
#=GS A0A6P3W7E8_CLUHA/17-117     AC A0A6P3W7E8.1
#=GS A0A199W7M9_ANACO/22-114     AC A0A199W7M9.1
#=GS A0A370TSA2_9HELO/17-110     AC A0A370TSA2.1
#=GS A0A4V5NAX0_9BASI/34-126     AC A0A4V5NAX0.1
#=GS A0A251UDA8_HELAN/65-161     AC A0A251UDA8.1
#=GS A0A0R3U6A1_9CEST/22-121     AC A0A0R3U6A1.1
#=GS A0A1G4M7Y2_LACFM/19-104     AC A0A1G4M7Y2.1
#=GS A0A5J5BNM4_9ASTE/1-49       AC A0A5J5BNM4.1
#=GS D3BRR6_POLPP/17-108         AC D3BRR6.1
#=GS A0A0E0CYT0_9ORYZ/171-218    AC A0A0E0CYT0.1
#=GS A0A2S4PQE4_9PEZI/17-110     AC A0A2S4PQE4.1
#=GS A0A643CI14_BALPH/22-79      AC A0A643CI14.1
#=GS A0A5E4NBL7_9HEMI/231-313    AC A0A5E4NBL7.1
#=GS Q4CVQ4_TRYCC/16-106         AC Q4CVQ4.1
#=GS A0A1Y3B0U3_EURMA/231-314    AC A0A1Y3B0U3.1
#=GS A0A1Y1VPF2_9FUNG/21-106     AC A0A1Y1VPF2.1
#=GS A0A133U3M1_9EURY/16-100     AC A0A133U3M1.1
#=GS A0A5N5ID53_9ROSA/30-119     AC A0A5N5ID53.1
#=GS A0A5N5SWB9_9CRUS/231-314    AC A0A5N5SWB9.1
#=GS A0A078JC78_BRANA/28-120     AC A0A078JC78.1
#=GS M0MLX5_9EURY/16-114         AC M0MLX5.1
#=GS A0A2X0LK74_9BASI/17-110     AC A0A2X0LK74.1
#=GS A0A0D2EXT4_9EURO/21-112     AC A0A0D2EXT4.1
#=GS A0A433DMT5_9FUNG/286-370    AC A0A433DMT5.1
#=GS A0A672PDZ3_SINGR/17-85      AC A0A672PDZ3.1
#=GS RL12_HALMA/16-114           AC P15772.1
#=GS E3Q6B4_COLGM/229-312        AC E3Q6B4.1
#=GS A0A6I9QAM1_ELAGV/21-112     AC A0A6I9QAM1.1
#=GS A0A1R2BE00_9CILI/2-88       AC A0A1R2BE00.1
#=GS A0A2I3MNA4_PAPAN/17-114     AC A0A2I3MNA4.1
#=GS A0A0M4EIW7_DROBS/17-113     AC A0A0M4EIW7.1
#=GS K5VTU5_PHACS/17-114         AC K5VTU5.1
#=GS A0A540KI42_MALBA/98-183     AC A0A540KI42.1
#=GS A0A364KKU8_9EURO/21-109     AC A0A364KKU8.1
#=GS A0A0E0BZJ0_9ORYZ/147-214    AC A0A0E0BZJ0.1
#=GS A0A4U5QGJ7_POPAL/18-122     AC A0A4U5QGJ7.1
#=GS A0A177W7W3_BATDL/52-144     AC A0A177W7W3.1
#=GS A0A1V9ZZ19_9STRA/16-107     AC A0A1V9ZZ19.1
#=GS L5LFB4_MYODS/446-521        AC L5LFB4.1
#=GS A0A2K1L9W1_PHYPA/17-112     AC A0A2K1L9W1.1
#=GS A0A2A4AT00_9PSED/5-99       AC A0A2A4AT00.1
#=GS T1FN66_HELRO/17-113         AC T1FN66.1
#=GS A0A397UIU6_9GLOM/16-114     AC A0A397UIU6.1
#=GS A0A093H1E3_GAVST/17-77      AC A0A093H1E3.1
#=GS A0A2K3L412_TRIPR/1-84       AC A0A2K3L412.1
#=GS A0A3S3N148_9MAGN/81-174     AC A0A3S3N148.1
#=GS A0A250X644_9CHLO/21-106     AC A0A250X644.1
#=GS A0A1U8A4W2_NELNU/5-118      AC A0A1U8A4W2.1
#=GS RLA0_DROME/231-316          AC P19889.1
#=GS M2R003_CERS8/21-109         AC M2R003.1
#=GS A0A484GM14_SOUCH/50-147     AC A0A484GM14.1
#=GS A0A397TGF6_9GLOM/16-111     AC A0A397TGF6.1
#=GS A0A1Y2A9Z4_9FUNG/24-113     AC A0A1Y2A9Z4.1
#=GS A0A0D3GVS3_9ORYZ/21-109     AC A0A0D3GVS3.1
#=GS A0A319DV88_9EURO/229-311    AC A0A319DV88.1
#=GS A0A2I4B8R5_9TELE/17-115     AC A0A2I4B8R5.1
#=GS A0A2K5KEW3_COLAP/20-106     AC A0A2K5KEW3.1
#=GS A0A367YBM5_9ASCO/24-114     AC A0A367YBM5.1
#=GS D3E155_METRM/16-102         AC D3E155.1
#=GS A0A1J7ITX5_LUPAN/17-116     AC A0A1J7ITX5.1
#=GS A0A165YUL9_DAUCS/17-108     AC A0A165YUL9.1
#=GS A0A1E5RTX9_HANUV/16-106     AC A0A1E5RTX9.1
#=GS A0A1Y1S3N7_9MICR/16-96      AC A0A1Y1S3N7.1
#=GS A0A0E0HF90_ORYNI/17-112     AC A0A0E0HF90.1
#=GS A0A6P8IEL0_ACTTE/231-316    AC A0A6P8IEL0.1
#=GS A0A1Y3N451_PIRSE/237-328    AC A0A1Y3N451.1
#=GS D7UBL2_VITVI/36-120         AC D7UBL2.1
#=GS J4HWK7_9APHY/17-112         AC J4HWK7.1
#=GS A0A1Y1UMV1_9TREE/17-115     AC A0A1Y1UMV1.1
#=GS G4MYX0_MAGO7/17-108         AC G4MYX0.1
#=GS M2U5Z5_COCH5/17-112         AC M2U5Z5.1
#=GS S3CXU0_OPHP1/21-107         AC S3CXU0.1
#=GS B7PQC5_IXOSC/22-72          AC B7PQC5.1
#=GS A0A2P6SPF6_ROSCH/21-108     AC A0A2P6SPF6.1
#=GS A0A7N5JDA9_AILME/231-316    AC A0A7N5JDA9.1
#=GS A0A6G1FY30_9PEZI/17-110     AC A0A6G1FY30.1
#=GS A0A2P5DQE8_PARAD/21-112     AC A0A2P5DQE8.1
#=GS D0MSA9_PHYIT/17-107         AC D0MSA9.1
#=GS A0A0C9MW68_9FUNG/20-104     AC A0A0C9MW68.1
#=GS A0A2K5ZG24_MANLE/17-114     AC A0A2K5ZG24.1
#=GS A0A0B7MWH9_9FUNG/228-307    AC A0A0B7MWH9.1
#=GS C5L0N1_PERM5/19-109         AC C5L0N1.1
#=GS RLA2_RAT/17-114             AC P02401.2
#=GS A0A445FNB3_GLYSO/171-237    AC A0A445FNB3.1
#=GS A0A2R5GBZ4_9STRA/29-114     AC A0A2R5GBZ4.1
#=GS A0A2K5HDI7_COLAP/21-109     AC A0A2K5HDI7.1
#=GS A0A1S3A373_ERIEU/231-316    AC A0A1S3A373.1
#=GS A0A1Y2WGK2_9PEZI/229-312    AC A0A1Y2WGK2.1
#=GS E3QDB1_COLGM/17-109         AC E3QDB1.1
#=GS Q5UAU1_BOMMO/231-315        AC Q5UAU1.1
#=GS K1QN55_CRAGI/22-99          AC K1QN55.1
#=GS A0A2N6NFL0_BEABA/229-312    AC A0A2N6NFL0.1
#=GS A0A4P9ZZP0_9FUNG/21-109     AC A0A4P9ZZP0.1
#=GS A0A166B8M7_9AGAM/21-112     AC A0A166B8M7.1
#=GS A0A409VQS0_PSICY/17-111     AC A0A409VQS0.1
#=GS A0A1S3TTT5_VIGRR/17-112     AC A0A1S3TTT5.1
#=GS M1V544_CYAM1/24-116         AC M1V544.1
#=GS D8UHH8_VOLCA/239-320        AC D8UHH8.1
#=GS A0A074YD77_AURSE/17-108     AC A0A074YD77.1
#=GS A0A6J1XFR9_ACIJB/47-129     AC A0A6J1XFR9.1
#=GS R0LN63_ANAPL/19-116         AC R0LN63.1
#=GS A0A2K5XYW1_MANLE/231-317    AC A0A2K5XYW1.1
#=GS A0A544ZV27_9PEZI/229-311    AC A0A544ZV27.1
#=GS F7XKV6_METZD/16-102         AC F7XKV6.1
#=GS A0A6P6SHQ0_COFAR/28-115     AC A0A6P6SHQ0.1
#=GS A0A251RX55_HELAN/8-95       AC A0A251RX55.1
#=GS A0A2K5QBD4_CEBIM/22-113     AC A0A2K5QBD4.1
#=GS A0A6J1U8A0_9SAUR/17-113     AC A0A6J1U8A0.1
#=GS A0A6A2WWJ0_HIBSY/17-74      AC A0A6A2WWJ0.1
#=GS A0A1W4WRT8_AGRPL/17-112     AC A0A1W4WRT8.1
#=GS A0A1J6IDY2_NICAT/17-113     AC A0A1J6IDY2.1
#=GS A0A3B6SPX8_WHEAT/17-111     AC A0A3B6SPX8.1
#=GS A0A4D8ZNZ0_SALSN/38-118     AC A0A4D8ZNZ0.1
#=GS A0A6A2XUM8_HIBSY/234-320    AC A0A6A2XUM8.1
#=GS L1IA35_GUITC/24-115         AC L1IA35.1
#=GS A0A6I9T697_SESIN/28-119     AC A0A6I9T697.1
#=GS A2Q8G3_ASPNC/229-311        AC A2Q8G3.1
#=GS A0A2S7QYG7_9HELO/229-314    AC A0A2S7QYG7.1
#=GS F7CQ43_HORSE/27-116         AC F7CQ43.2
#=GS A0A2U1KYD5_ARTAN/21-95      AC A0A2U1KYD5.1
#=GS A0A4P1RJC6_LUPAN/17-114     AC A0A4P1RJC6.1
#=GS A0A2R4X1Y1_9EURY/16-108     AC A0A2R4X1Y1.1
#=GS A0A1B7T9D6_9ASCO/229-313    AC A0A1B7T9D6.1
#=GS A0A3N6S1S2_BRACR/17-112     AC A0A3N6S1S2.1
#=GS A0A165N3E6_9AGAM/229-311    AC A0A165N3E6.1
#=GS A0A6J0Z0W0_ODOVR/17-114     AC A0A6J0Z0W0.1
#=GS A0A4Z2IGZ2_9TELE/17-116     AC A0A4Z2IGZ2.1
#=GS A0A398A7Q5_BRACM/233-320    AC A0A398A7Q5.1
#=GS A0A0X8V2P8_9ARCH/230-331    AC A0A0X8V2P8.1
#=GS A0E0I4_PARTE/17-109         AC A0E0I4.1
#=GS Q4CSS8_TRYCC/18-111         AC Q4CSS8.1
#=GS A0A395RPQ0_FUSSP/228-310    AC A0A395RPQ0.1
#=GS J7S3K6_KAZNA/16-106         AC J7S3K6.1
#=GS A0A5N7C9G1_PETAA/17-108     AC A0A5N7C9G1.1
#=GS G1T8P4_RABIT/22-113         AC G1T8P4.1
#=GS A0A384AZ84_BALAS/18-88      AC A0A384AZ84.1
#=GS A0A0D8Y5N2_DICVI/23-117     AC A0A0D8Y5N2.1
#=GS A0A2K5YEA9_MANLE/191-281    AC A0A2K5YEA9.1
#=GS A0A0D2P417_GOSRA/22-102     AC A0A0D2P417.1
#=GS I7MJ34_TETTS/26-108         AC I7MJ34.1
#=GS A0A017SR48_9EURO/21-106     AC A0A017SR48.1
#=GS A0A0P1AZQ4_PLAHL/29-111     AC A0A0P1AZQ4.1
#=GS A0A0L8FR32_OCTBM/17-111     AC A0A0L8FR32.1
#=GS A0A444UEL3_ACIRT/128-225    AC A0A444UEL3.1
#=GS A0A6P3ZF93_ZIZJJ/17-113     AC A0A6P3ZF93.1
#=GS T1HH04_RHOPR/192-274        AC T1HH04.2
#=GS A0A2K5VKF8_MACFA/216-302    AC A0A2K5VKF8.2
#=GS A0A4U0UNG6_9PEZI/17-116     AC A0A4U0UNG6.1
#=GS A0A1R2C178_9CILI/17-111     AC A0A1R2C178.1
#=GS A0A6J3RTQ6_TURTR/22-113     AC A0A6J3RTQ6.1
#=GS A0A0E0LQX6_ORYPU/234-318    AC A0A0E0LQX6.1
#=GS J3M7N9_ORYBR/17-112         AC J3M7N9.1
#=GS A0A168L262_ABSGL/17-108     AC A0A168L262.1
#=GS A0A673G9Z1_9TELE/22-113     AC A0A673G9Z1.1
#=GS S2JHE3_MUCC1/17-105         AC S2JHE3.1
#=GS A0A5N6F058_9EURO/17-108     AC A0A5N6F058.1
#=GS A0A421JG73_9ASCO/17-109     AC A0A421JG73.1
#=GS A0A3N4K4K2_9PEZI/228-313    AC A0A3N4K4K2.1
#=GS A0A1S8W929_9FUNG/17-111     AC A0A1S8W929.1
#=GS V6LLG8_9EUKA/17-110         AC V6LLG8.1
#=GS A0A2G5U6T4_9PELO/17-110     AC A0A2G5U6T4.1
#=GS A0A1C1CUP7_9EURO/21-112     AC A0A1C1CUP7.1
#=GS A0A507C1V5_9FUNG/23-117     AC A0A507C1V5.1
#=GS A0A0N5CW45_THECL/17-115     AC A0A0N5CW45.1
#=GS A0A3S2MD22_ORYJA/17-113     AC A0A3S2MD22.1
#=GS A0A669P7I1_PHACC/22-113     AC A0A669P7I1.1
#=GS A0A2J6KEP3_LACSA/233-320    AC A0A2J6KEP3.1
#=GS A0A1I7VQ04_LOALO/231-319    AC A0A1I7VQ04.1
#=GS A0A1S3DWF6_CICAR/21-108     AC A0A1S3DWF6.1
#=GS A0A397H1H2_9EURO/21-109     AC A0A397H1H2.1
#=GS B4G8A2_DROPE/22-111         AC B4G8A2.1
#=GS RLA0_PIG/231-317            AC Q29214.2
#=GS A0A1A6FTK6_NEOLE/138-221    AC A0A1A6FTK6.1
#=GS M3Z525_MUSPF/6-90           AC M3Z525.1
#=GS B9SLK4_RICCO/234-319        AC B9SLK4.1
#=GS W5AP46_WHEAT/17-112         AC W5AP46.1
#=GS A0A554N920_9EURY/16-118     AC A0A554N920.1
#=GS A0A484CJS7_PERFV/22-111     AC A0A484CJS7.1
#=GS A0A3B6TIA0_WHEAT/17-111     AC A0A3B6TIA0.1
#=GS A0A6J1P9Y6_BICAN/231-315    AC A0A6J1P9Y6.1
#=GS A0A060YR98_ONCMY/17-113     AC A0A060YR98.1
#=GS A0A1U8HXU8_GOSHI/21-111     AC A0A1U8HXU8.1
#=GS G1PDJ8_MYOLU/19-105         AC G1PDJ8.1
#=GS A0A6G0YGQ3_APHCR/16-111     AC A0A6G0YGQ3.1
#=GS A0A444ERN7_ENSVE/49-139     AC A0A444ERN7.1
#=GS A0A1U8L7D0_GOSHI/22-113     AC A0A1U8L7D0.1
#=GS A0A0L9U8A2_PHAAN/17-112     AC A0A0L9U8A2.1
#=GS A0A6J1I3W8_CUCMA/234-321    AC A0A6J1I3W8.1
#=GS B8MH37_TALSN/229-312        AC B8MH37.1
#=GS A0A137QH46_9AGAR/17-109     AC A0A137QH46.1
#=GS A0A444ZTV6_ARAHY/23-118     AC A0A444ZTV6.1
#=GS G8ZM14_TORDC/17-109         AC G8ZM14.1
#=GS A0A0D9WUU4_9ORYZ/21-109     AC A0A0D9WUU4.1
#=GS S3DT21_GLAL2/229-313        AC S3DT21.1
#=GS A0A328E2M4_9ASTE/17-115     AC A0A328E2M4.1
#=GS A0A1E4STP8_9ASCO/229-309    AC A0A1E4STP8.1
#=GS A0A7N6BKE8_ANATE/231-315    AC A0A7N6BKE8.1
#=GS A0A3Q0H1D4_ALLSI/40-137     AC A0A3Q0H1D4.1
#=GS A0A1U8NNX7_GOSHI/234-319    AC A0A1U8NNX7.1
#=GS C5LFG0_PERM5/17-109         AC C5LFG0.1
#=GS A0A2T9X517_9CREN/16-103     AC A0A2T9X517.1
#=GS A0A5F4DEW8_CANLF/169-254    AC A0A5F4DEW8.1
#=GS A0A316UEK3_9BASI/229-312    AC A0A316UEK3.1
#=GS A0A2C9VTW4_MANES/21-112     AC A0A2C9VTW4.1
#=GS A0A1Y2G4L1_9BASI/17-105     AC A0A1Y2G4L1.1
#=GS I1CPV0_RHIO9/20-106         AC I1CPV0.1
#=GS A0A1Y1VI18_9FUNG/228-311    AC A0A1Y1VI18.1
#=GS A0A212DCB0_CEREH/1-89       AC A0A212DCB0.1
#=GS Q7RKJ6_PLAYO/19-110         AC Q7RKJ6.1
#=GS A0A2K6F6X5_PROCO/14-94      AC A0A2K6F6X5.1
#=GS A0A1Y1YCH5_9FUNG/228-309    AC A0A1Y1YCH5.1
#=GS M5E8M3_MALS4/229-312        AC M5E8M3.1
#=GS A0A0B2X5A0_METAS/17-109     AC A0A0B2X5A0.1
#=GS A2RB85_ASPNC/21-107         AC A2RB85.1
#=GS D3ZN03_RAT/17-114           AC D3ZN03.1
#=GS A0A2L2T4U8_9HYPO/228-310    AC A0A2L2T4U8.1
#=GS B8BTG2_THAPS/17-97          AC B8BTG2.1
#=GS A0A3G2S796_9BASI/229-311    AC A0A3G2S796.1
#=GS A0A087H854_ARAAL/233-320    AC A0A087H854.1
#=GS A0A060XU76_ONCMY/1-82       AC A0A060XU76.1
#=GS A0A179ILC7_CORDF/229-312    AC A0A179ILC7.1
#=GS A0A4U5PAY1_STECR/22-110     AC A0A4U5PAY1.1
#=GS A0A507R2G9_MONPU/21-108     AC A0A507R2G9.1
#=GS A0A316UWW8_9BASI/21-109     AC A0A316UWW8.1
#=GS A0A097C2Z0_CAPHI/231-317    AC A0A097C2Z0.1
#=GS A0A2Y9H443_NEOSC/22-112     AC A0A2Y9H443.1
#=GS D8M4Q3_BLAHO/230-313        AC D8M4Q3.1
#=GS A0A2I3GJP1_NOMLE/169-254    AC A0A2I3GJP1.1
#=GS A0A6A4KCB3_APOLU/187-269    AC A0A6A4KCB3.1
#=GS A0A0E0AQG8_9ORYZ/234-318    AC A0A0E0AQG8.1
#=GS G2WRQ1_VERDV/21-108         AC G2WRQ1.1
#=GS A0A1S4ATY9_TOBAC/39-131     AC A0A1S4ATY9.1
#=GS A0A5N7DDE8_9EURO/229-313    AC A0A5N7DDE8.1
#=GS A0A3G1T1B4_GALME/231-316    AC A0A3G1T1B4.1
#=GS R7YLL1_CONA1/21-111         AC R7YLL1.1
#=GS A0A3L6PNF2_PANMI/234-317    AC A0A3L6PNF2.1
#=GS A0A7E5VDX7_TRINI/231-315    AC A0A7E5VDX7.1
#=GS A0A673WTP4_SALTR/231-314    AC A0A673WTP4.1
#=GS A0A2K5LZX4_CERAT/22-113     AC A0A2K5LZX4.1
#=GS F8VZS0_HUMAN/182-246        AC F8VZS0.1
#=GS J3MQ37_ORYBR/234-318        AC J3MQ37.1
#=GS L8I8T5_9CETA/22-108         AC L8I8T5.1
#=GS G0WB67_NAUDC/20-106         AC G0WB67.1
#=GS A0A550CJP5_9AGAR/229-310    AC A0A550CJP5.1
#=GS A0A3Q8IA63_LEIDO/20-107     AC A0A3Q8IA63.1
#=GS U6J9R0_ECHGR/231-322        AC U6J9R0.1
#=GS A0A067KGQ0_JATCU/36-122     AC A0A067KGQ0.1
#=GS A0A3Q7H7N3_SOLLC/17-111     AC A0A3Q7H7N3.1
#=GS A9PE32_POPTR/19-123         AC A9PE32.1
#=GS A0A2R6RMZ3_ACTCC/17-116     AC A0A2R6RMZ3.1
#=GS A0A4W6CQT3_LATCA/233-304    AC A0A4W6CQT3.1
#=GS M4C9Q0_BRARP/22-112         AC M4C9Q0.1
#=GS A0A151GIM6_9HYPO/17-109     AC A0A151GIM6.1
#=GS A0A0W7TI38_9ARCH/16-102     AC A0A0W7TI38.1
#=GS A0A671WN82_SPAAU/22-112     AC A0A671WN82.1
#=GS A0A0A1TDB9_9HYPO/229-312    AC A0A0A1TDB9.1
#=GS A0A553NXA4_TIGCA/231-314    AC A0A553NXA4.1
#=GS A0A0D3GVS5_9ORYZ/51-139     AC A0A0D3GVS5.1
#=GS A0A261Y5N0_9FUNG/20-106     AC A0A261Y5N0.1
#=GS A0A484GMQ0_SOUCH/22-113     AC A0A484GMQ0.1
#=GS A0A394DG56_LUPAN/17-111     AC A0A394DG56.1
#=GS A0A3B3H3J4_ORYLA/231-314    AC A0A3B3H3J4.1
#=GS A0A0M8P1D7_9EURO/52-141     AC A0A0M8P1D7.1
#=GS A0A5N6PD81_9ASTR/39-121     AC A0A5N6PD81.1
#=GS A0A1A6GXJ3_NEOLE/17-114     AC A0A1A6GXJ3.1
#=GS A0A0L9UDB2_PHAAN/2-78       AC A0A0L9UDB2.1
#=GS A0A4D9AAT8_SALSN/317-391    AC A0A4D9AAT8.1
#=GS A0A1E7EY82_9STRA/17-105     AC A0A1E7EY82.1
#=GS S7MIM4_MYOBR/1-72           AC S7MIM4.1
#=GS S3DGQ7_GLAL2/17-111         AC S3DGQ7.1
#=GS A0A0V0X2D3_9BILA/22-112     AC A0A0V0X2D3.1
#=GS A0A6A5M2F3_LUPAL/234-319    AC A0A6A5M2F3.1
#=GS A0A1Z5JNJ9_FISSO/33-120     AC A0A1Z5JNJ9.1
#=GS H0ZHQ4_TAEGU/17-114         AC H0ZHQ4.1
#=GS A0A3S2N3Y3_ORYJA/231-314    AC A0A3S2N3Y3.1
#=GS C0NC89_AJECG/45-127         AC C0NC89.1
#=GS I1RRT8_GIBZE/228-310        AC I1RRT8.1
#=GS A0A2G2XB62_CAPBA/22-113     AC A0A2G2XB62.1
#=GS A0A439CUT2_9PEZI/21-108     AC A0A439CUT2.1
#=GS B7XHX4_ENTBH/23-98          AC B7XHX4.1
#=GS A0A3Q1EDD3_9TELE/231-313    AC A0A3Q1EDD3.1
#=GS A0A1L9VRS8_ASPGL/229-310    AC A0A1L9VRS8.1
#=GS A0A022RX13_ERYGU/234-321    AC A0A022RX13.1
#=GS A0A1Y2EP34_9FUNG/21-105     AC A0A1Y2EP34.1
#=GS E3KYL1_PUCGT/19-107         AC E3KYL1.2
#=GS A0A6A5EZM4_PERFL/22-111     AC A0A6A5EZM4.1
#=GS A0A498I572_MALDO/94-191     AC A0A498I572.1
#=GS A0A669EIJ9_ORENI/17-85      AC A0A669EIJ9.1
#=GS A0A3Q3VL48_MOLML/17-112     AC A0A3Q3VL48.1
#=GS A0A2K5CVC1_AOTNA/22-102     AC A0A2K5CVC1.1
#=GS A0A0D2TK93_GOSRA/229-314    AC A0A0D2TK93.1
#=GS Q4QF62_LEIMA/18-110         AC Q4QF62.1
#=GS L1IMI6_GUITC/17-76          AC L1IMI6.1
#=GS I3KTM3_ORENI/231-314        AC I3KTM3.1
#=GS A0A2G8SPK0_9APHY/229-310    AC A0A2G8SPK0.1
#=GS A0A673YVX2_SALTR/17-112     AC A0A673YVX2.1
#=GS A0A367K083_RHIST/20-102     AC A0A367K083.1
#=GS A0A4V3XI05_9APHY/17-111     AC A0A4V3XI05.1
#=GS A0A1E3QIN5_9ASCO/17-108     AC A0A1E3QIN5.1
#=GS W6KY85_9TRYP/19-107         AC W6KY85.1
#=GS A0A2Y9K2R8_ENHLU/18-88      AC A0A2Y9K2R8.1
#=GS A0A6P5JLD2_PHACI/17-114     AC A0A6P5JLD2.1
#=GS A0A6A4NQZ5_LUPAL/44-141     AC A0A6A4NQZ5.1
#=GS A0A0B7NFA6_9FUNG/17-106     AC A0A0B7NFA6.1
#=GS A0A6J2T147_DROLE/231-318    AC A0A6J2T147.1
#=GS A0A3Q3CDQ1_HAPBU/231-298    AC A0A3Q3CDQ1.1
#=GS M9MEI2_PSEA3/43-131         AC M9MEI2.1
#=GS A0A448YJ07_BRENA/19-106     AC A0A448YJ07.1
#=GS Q8TZJ7_PYRFU/16-106         AC Q8TZJ7.1
#=GS Q8TZJ7_PYRFU/16-106         DR PDB; 5YV5 B; 95-107;
#=GS A0A5B2YWE1_9ARCH/16-101     AC A0A5B2YWE1.1
#=GS A0A3B5RDD2_XIPMA/17-115     AC A0A3B5RDD2.1
#=GS A0A251NP95_PRUPE/17-112     AC A0A251NP95.1
#=GS D7TVT2_VITVI/21-110         AC D7TVT2.1
#=GS G0VDR1_NAUCC/20-106         AC G0VDR1.1
#=GS A0A3N4LZR0_9PEZI/21-109     AC A0A3N4LZR0.1
#=GS A0A158NU13_ATTCE/22-111     AC A0A158NU13.1
#=GS A0A565AL21_9BRAS/22-111     AC A0A565AL21.1
#=GS G3JUX2_CORMM/202-287        AC G3JUX2.1
#=GS A0A3P8W1D4_CYNSE/22-112     AC A0A3P8W1D4.1
#=GS A0A2A2K8E2_9BILA/231-316    AC A0A2A2K8E2.1
#=GS A0A165HN10_9BASI/17-114     AC A0A165HN10.1
#=GS A0A1E4SRI2_9ASCO/229-309    AC A0A1E4SRI2.1
#=GS M0CGF3_9EURY/16-115         AC M0CGF3.1
#=GS A0A5C7H8W5_9ROSI/17-114     AC A0A5C7H8W5.1
#=GS A0A6I9U9P8_SESIN/17-114     AC A0A6I9U9P8.1
#=GS A0A4T0X361_9ASCO/229-310    AC A0A4T0X361.1
#=GS A0A1Y2F9K1_9FUNG/23-106     AC A0A1Y2F9K1.1
#=GS B3MUH8_DROAN/22-113         AC B3MUH8.1
#=GS A0A2R6NX82_9APHY/229-311    AC A0A2R6NX82.1
#=GS A0A183W1W5_TRIRE/22-112     AC A0A183W1W5.1
#=GS A0A0D2LBT3_9CHLO/17-106     AC A0A0D2LBT3.1
#=GS A0A251QPL9_PRUPE/21-108     AC A0A251QPL9.1
#=GS G2YDG1_BOTF4/30-118         AC G2YDG1.1
#=GS A0A2T7PGG7_POMCA/220-307    AC A0A2T7PGG7.1
#=GS A0A2A2KT37_9BILA/69-164     AC A0A2A2KT37.1
#=GS A0A168ND44_ABSGL/20-105     AC A0A168ND44.1
#=GS V4ME21_EUTSA/16-98          AC V4ME21.1
#=GS A4YH90_METS5/16-101         AC A4YH90.1
#=GS A0A196SGJ7_BLAHN/30-113     AC A0A196SGJ7.1
#=GS A0A0B7N7Q1_9FUNG/20-105     AC A0A0B7N7Q1.1
#=GS A0A1E3QKR2_9ASCO/17-107     AC A0A1E3QKR2.1
#=GS Q4Q6R5_LEIMA/35-124         AC Q4Q6R5.1
#=GS A0A423XII3_9PEZI/229-313    AC A0A423XII3.1
#=GS A0A183I1K9_9BILA/231-319    AC A0A183I1K9.1
#=GS A0A1Q2YGH0_9ASCO/22-107     AC A0A1Q2YGH0.1
#=GS G4RKP0_THETK/16-109         AC G4RKP0.1
#=GS A0A6J2L975_9CHIR/22-113     AC A0A6J2L975.1
#=GS A0A0B7N3F0_9FUNG/20-105     AC A0A0B7N3F0.1
#=GS A7LIT3_9ROSI/56-118         AC A7LIT3.1
#=GS E1F4E2_GIAIA/233-312        AC E1F4E2.1
#=GS A0A485MSB3_LYNPA/35-115     AC A0A485MSB3.1
#=GS A0A3P8RXR7_AMPPE/17-114     AC A0A3P8RXR7.1
#=GS A0A2P5EC77_TREOI/17-114     AC A0A2P5EC77.1
#=GS D2RQS4_HALTV/16-115         AC D2RQS4.1
#=GS A7TF23_VANPO/19-104         AC A7TF23.1
#=GS D8M3G8_BLAHO/9-101          AC D8M3G8.1
#=GS A0A2J6QY04_9HELO/231-315    AC A0A2J6QY04.1
#=GS A0A1D6FPB9_MAIZE/17-98      AC A0A1D6FPB9.1
#=GS A0A1M2VJQ0_TRAPU/56-144     AC A0A1M2VJQ0.1
#=GS A0A6P8R8L4_GEOSA/22-112     AC A0A6P8R8L4.1
#=GS A0A1B9I004_9TREE/17-111     AC A0A1B9I004.1
#=GS A0A4Q4TBF7_9PEZI/21-110     AC A0A4Q4TBF7.1
#=GS A0A6J0JC57_RAPSA/17-113     AC A0A6J0JC57.1
#=GS D7LMJ6_ARALL/17-110         AC D7LMJ6.1
#=GS F8W1K8_HUMAN/21-106         AC F8W1K8.1
#=GS A0A4V4MAM9_WALIC/20-104     AC A0A4V4MAM9.1
#=GS A0A2K6ERF6_PROCO/17-114     AC A0A2K6ERF6.1
#=GS M3X004_FELCA/24-108         AC M3X004.3
#=GS G4VJS1_SCHMA/21-115         AC G4VJS1.1
#=GS A0A383UUB9_BLUGH/230-313    AC A0A383UUB9.1
#=GS A0A251S239_HELAN/59-148     AC A0A251S239.1
#=GS M0T501_MUSAM/1-93           AC M0T501.1
#=GS A0A2T6ZLT6_TUBBO/21-110     AC A0A2T6ZLT6.1
#=GS A0A0D3C702_BRAOL/22-112     AC A0A0D3C702.1
#=GS A0A183PT73_9TREM/21-114     AC A0A183PT73.1
#=GS A0A0S4JVF4_BODSA/19-105     AC A0A0S4JVF4.1
#=GS A0A4Q7JRZ0_METCM/17-85      AC A0A4Q7JRZ0.1
#=GS K0TB64_THAOC/106-196        AC K0TB64.1
#=GS A0A1Y2M149_EPING/229-314    AC A0A1Y2M149.1
#=GS A0A2J6L909_LACSA/20-108     AC A0A2J6L909.1
#=GS N4V258_COLOR/21-108         AC N4V258.1
#=GS A0A2K5M064_CERAT/169-255    AC A0A2K5M064.1
#=GS F6RRL3_CIOIN/17-108         AC F6RRL3.2
#=GS A0A5D2UWI2_GOSMU/17-112     AC A0A5D2UWI2.1
#=GS A0A4D9DTS2_9SAUR/108-202    AC A0A4D9DTS2.1
#=GS A0A176VIV8_MARPO/17-113     AC A0A176VIV8.1
#=GS A0A540MAA6_MALBA/1-64       AC A0A540MAA6.1
#=GS A0A202DF82_9ARCH/16-101     AC A0A202DF82.1
#=GS A0A1V9X251_9ACAR/231-314    AC A0A1V9X251.1
#=GS A0A6P5JYS1_PHACI/32-92      AC A0A6P5JYS1.1
#=GS T1H6I7_MEGSC/17-109         AC T1H6I7.1
#=GS U3IZK4_ANAPP/231-317        AC U3IZK4.2
#=GS A0A4S2N293_9PEZI/17-110     AC A0A4S2N293.1
#=GS A0A0D3B5Y7_BRAOL/234-318    AC A0A0D3B5Y7.1
#=GS A0A445L3W7_GLYSO/21-94      AC A0A445L3W7.1
#=GS F6YP53_CALJA/169-255        AC F6YP53.1
#=GS A9SDK8_PHYPA/21-108         AC A9SDK8.1
#=GS A0A7F8RNR6_LEPWE/16-88      AC A0A7F8RNR6.1
#=GS A0A3N4I9L5_ASCIM/229-315    AC A0A3N4I9L5.1
#=GS A0A6S7MXL6_LACSI/4-87       AC A0A6S7MXL6.1
#=GS A0A0C9XD34_9AGAR/229-310    AC A0A0C9XD34.1
#=GS M3CXL0_SPHMS/21-112         AC M3CXL0.1
#=GS A0A225AEK5_9EURO/229-312    AC A0A225AEK5.1
#=GS A0A2K6KGV5_RHIBE/23-114     AC A0A2K6KGV5.1
#=GS A0A0S3S0R3_PHAAN/234-318    AC A0A0S3S0R3.1
#=GS M4DVB0_BRARP/35-119         AC M4DVB0.1
#=GS A0A2I3TRK3_PANTR/169-254    AC A0A2I3TRK3.1
#=GS A0A2I3HX83_NOMLE/179-264    AC A0A2I3HX83.1
#=GS A2ZHU8_ORYSI/234-319        AC A2ZHU8.1
#=GS C5DNX7_ZYGRC/229-309        AC C5DNX7.1
#=GS A0A3Q3XB52_MOLML/17-112     AC A0A3Q3XB52.1
#=GS A0A2I3GMH8_NOMLE/213-292    AC A0A2I3GMH8.1
#=GS A0A4U5NGY4_STECR/192-269    AC A0A4U5NGY4.1
#=GS A0A7N9CWM7_MACFA/21-107     AC A0A7N9CWM7.1
#=GS A0A7J6IKJ0_COLFN/41-133     AC A0A7J6IKJ0.1
#=GS A0A1V8UFY8_9PEZI/21-111     AC A0A1V8UFY8.1
#=GS A0A2K5IK72_COLAP/11-108     AC A0A2K5IK72.1
#=GS A0A199VEQ5_ANACO/22-74      AC A0A199VEQ5.1
#=GS M9PG76_DROME/231-316        AC M9PG76.1
#=GS E3LMT1_CAERE/17-107         AC E3LMT1.1
#=GS G3HF33_CRIGR/22-68          AC G3HF33.1
#=GS A0A179UGP8_BLAGS/21-109     AC A0A179UGP8.1
#=GS G4T708_SERID/21-112         AC G4T708.1
#=GS A0A2P6U1V6_CHLSO/21-104     AC A0A2P6U1V6.1
#=GS A0A421JGF1_9ASCO/20-105     AC A0A421JGF1.1
#=GS A0A6P6XRV2_DERPT/17-112     AC A0A6P6XRV2.1
#=GS A0A0V0SDL3_9BILA/251-339    AC A0A0V0SDL3.1
#=GS G2WZ41_VERDV/17-109         AC G2WZ41.1
#=GS A0A2P5X8C7_GOSBA/17-73      AC A0A2P5X8C7.1
#=GS A0A1E4TUG5_PACTA/19-106     AC A0A1E4TUG5.1
#=GS A0A2K5M039_CERAT/231-338    AC A0A2K5M039.1
#=GS A0A6P4C5C3_ARADU/23-119     AC A0A6P4C5C3.1
#=GS A0A2S4W551_9BASI/229-309    AC A0A2S4W551.1
#=GS A0A1I7VGW5_LOALO/4-66       AC A0A1I7VGW5.1
#=GS A0BIU4_PARTE/17-109         AC A0BIU4.1
#=GS H2P6X3_PONAB/22-99          AC H2P6X3.1
#=GS A0A166B084_DAUCS/1-68       AC A0A166B084.1
#=GS A0A0V1MXY9_9BILA/24-121     AC A0A0V1MXY9.1
#=GS A0A078FPZ5_BRANA/71-161     AC A0A078FPZ5.1
#=GS A0A178AE94_9PLEO/21-111     AC A0A178AE94.1
#=GS A0A420XZQ7_9PEZI/17-110     AC A0A420XZQ7.1
#=GS S2JQH4_MUCC1/17-105         AC S2JQH4.1
#=GS A0A653BEJ3_CALMS/192-276    AC A0A653BEJ3.1
#=GS A0A6B0T9I6_9EURY/16-117     AC A0A6B0T9I6.1
#=GS A0A498JAW8_MALDO/21-109     AC A0A498JAW8.1
#=GS RLA2_DICDI/15-105           AC P22683.3
#=GS A0A0K9QR70_SPIOL/35-119     AC A0A0K9QR70.1
#=GS B9SLB2_RICCO/36-90          AC B9SLB2.1
#=GS W4IQB3_PLAFP/19-111         AC W4IQB3.1
#=GS A0A507APZ1_9PEZI/21-109     AC A0A507APZ1.1
#=GS A0A2P5DFB1_PARAD/21-107     AC A0A2P5DFB1.1
#=GS RL12_SULAC/16-104           AC P08055.2
#=GS G1M6P5_AILME/18-88          AC G1M6P5.2
#=GS A0A1V6S394_9EURO/21-107     AC A0A1V6S394.1
#=GS A0A2G9TSK1_TELCI/1-75       AC A0A2G9TSK1.1
#=GS K1WN96_MARBU/21-109         AC K1WN96.1
#=GS A0A317VR33_9EURO/21-107     AC A0A317VR33.1
#=GS A0A225UN76_9STRA/27-113     AC A0A225UN76.1
#=GS A0A5F9DQW5_RABIT/18-88      AC A0A5F9DQW5.1
#=GS A0A0C2F5E6_9BILA/22-113     AC A0A0C2F5E6.1
#=GS R1GV22_BOTPV/229-312        AC R1GV22.1
#=GS A0A078A2R0_STYLE/270-348    AC A0A078A2R0.1
#=GS W6MJM1_9ASCO/11-117         AC W6MJM1.1
#=GS A0A0A2JUI9_PENEN/21-107     AC A0A0A2JUI9.1
#=GS A0A0E0JG01_ORYPU/55-118     AC A0A0E0JG01.1
#=GS Q758U4_ASHGO/16-104         AC Q758U4.1
#=GS A0A2I3HIJ1_NOMLE/17-109     AC A0A2I3HIJ1.1
#=GS A0A6P6HEU5_PUMCO/18-88      AC A0A6P6HEU5.1
#=GS A0A6H0XKT4_9PEZI/229-313    AC A0A6H0XKT4.1
#=GS A0A183I9B7_9BILA/32-73      AC A0A183I9B7.1
#=GS A0A6I9I6R8_VICPA/231-317    AC A0A6I9I6R8.1
#=GS A0A0V0U5A5_9BILA/72-160     AC A0A0V0U5A5.1
#=GS A0A5P1FTM3_ASPOF/79-139     AC A0A5P1FTM3.1
#=GS E9CTT5_COCPS/17-110         AC E9CTT5.1
#=GS A0A653HHD4_9APIC/32-118     AC A0A653HHD4.1
#=GS A0A6J1K610_CUCMA/233-319    AC A0A6J1K610.1
#=GS S7P9Y9_MYOBR/22-112         AC S7P9Y9.1
#=GS F0VGP2_NEOCL/32-117         AC F0VGP2.1
#=GS A0A6H0XU05_9PEZI/67-162     AC A0A6H0XU05.1
#=GS F4NTD8_BATDJ/17-109         AC F4NTD8.1
#=GS B0XFG3_CULQU/41-110         AC B0XFG3.1
#=GS A0A2G8KLC4_STIJA/22-111     AC A0A2G8KLC4.1
#=GS A0A167S5B3_CALVF/17-114     AC A0A167S5B3.1
#=GS A0A177EI21_9MICR/16-99      AC A0A177EI21.1
#=GS Q9SM26_MAIZE/17-111         AC Q9SM26.1
#=GS J5RZR0_SACK1/16-105         AC J5RZR0.1
#=GS A0A2G2VAU2_CAPBA/75-169     AC A0A2G2VAU2.1
#=GS A0A6P6AR37_DURZI/17-119     AC A0A6P6AR37.1
#=GS A0A3B3HJN0_ORYLA/17-114     AC A0A3B3HJN0.1
#=GS A0A2U9IG00_9CREN/16-102     AC A0A2U9IG00.1
#=GS A0A2G4T246_RHIZD/17-107     AC A0A2G4T246.1
#=GS B5DH21_SALSA/22-110         AC B5DH21.1
#=GS A0A177WJ21_BATDL/231-316    AC A0A177WJ21.1
#=GS G3RT68_GORGO/21-102         AC G3RT68.2
#=GS V6LLL6_9EUKA/20-106         AC V6LLL6.1
#=GS A0A0N4U3K0_DRAME/17-105     AC A0A0N4U3K0.1
#=GS A0A6J1PND3_9HYME/22-111     AC A0A6J1PND3.1
#=GS A0A4T0MK09_9BASI/229-311    AC A0A4T0MK09.1
#=GS A0A6J0JRU9_RAPSA/17-113     AC A0A6J0JRU9.1
#=GS A0A2Y9ICF4_NEOSC/231-316    AC A0A2Y9ICF4.1
#=GS I7J9I3_BABMR/265-347        AC I7J9I3.1
#=GS RLA2B_MAIZE/17-112          AC O24415.1
#=GS A0A2K6FJN4_PROCO/18-88      AC A0A2K6FJN4.1
#=GS A0A2I3TWP8_PANTR/177-260    AC A0A2I3TWP8.1
#=GS A0A094A5D9_9PEZI/57-134     AC A0A094A5D9.1
#=GS A0A1S7HGH8_9SACH/16-104     AC A0A1S7HGH8.1
#=GS A0A1X2G6C0_9FUNG/228-306    AC A0A1X2G6C0.1
#=GS A0A7H9HW07_9SACH/229-311    AC A0A7H9HW07.1
#=GS A5DZX0_LODEL/17-110         AC A5DZX0.1
#=GS A0A2T7A0B6_TUBBO/228-313    AC A0A2T7A0B6.1
#=GS A0A662YLJ5_ACIRT/22-104     AC A0A662YLJ5.1
#=GS A0A3L6TAV6_PANMI/234-319    AC A0A3L6TAV6.1
#=GS A8QDQ2_MALGO/229-313        AC A8QDQ2.1
#=GS A0A2H5P0B3_CITUN/21-109     AC A0A2H5P0B3.1
#=GS G8Y3N2_PICSO/229-308        AC G8Y3N2.1
#=GS G8BWL0_TETPH/16-105         AC G8BWL0.1
#=GS L5K483_PTEAL/22-113         AC L5K483.1
#=GS A0A2H3ANR8_9AGAR/17-111     AC A0A2H3ANR8.1
#=GS A0A5J9WB45_9POAL/17-110     AC A0A5J9WB45.1
#=GS A0A024TCK8_9STRA/17-107     AC A0A024TCK8.1
#=GS A0A163J650_ABSGL/91-175     AC A0A163J650.1
#=GS C4JVS3_UNCRE/229-310        AC C4JVS3.1
#=GS A0A6P5Y0Q5_DURZI/21-112     AC A0A6P5Y0Q5.1
#=GS A0A2B7ZIL2_9EURO/229-310    AC A0A2B7ZIL2.1
#=GS J3KCL7_COCIM/21-110         AC J3KCL7.2
#=GS A0A0M9FPH6_9TRYP/20-107     AC A0A0M9FPH6.1
#=GS A0A2W1C0R8_HELAM/92-150     AC A0A2W1C0R8.1
#=GS A8PUC9_MALGO/6-93           AC A8PUC9.1
#=GS H3G993_PHYRM/231-311        AC H3G993.1
#=GS J8PI57_SACAR/16-104         AC J8PI57.1
#=GS A0A1G4MAP9_LACFM/20-105     AC A0A1G4MAP9.1
#=GS A0A0L6VCC0_9BASI/77-165     AC A0A0L6VCC0.1
#=GS I2FQ08_USTH4/230-312        AC I2FQ08.1
#=GS A0A1X6PJ70_PORUM/17-107     AC A0A1X6PJ70.1
#=GS A0A0X3BIX8_9EURY/16-104     AC A0A0X3BIX8.1
#=GS A0A6J0NX24_RAPSA/17-111     AC A0A6J0NX24.1
#=GS A0A1Y1IG08_KLENI/22-127     AC A0A1Y1IG08.1
#=GS A0A5D2ZSU4_GOSMU/187-273    AC A0A5D2ZSU4.1
#=GS A0A074VMF3_9PEZI/17-108     AC A0A074VMF3.1
#=GS A0A2L2TVV2_9HYPO/17-108     AC A0A2L2TVV2.1
#=GS A0A395GT96_9EURO/21-107     AC A0A395GT96.1
#=GS A0A3P8S0C4_AMPPE/169-252    AC A0A3P8S0C4.1
#=GS G1RT29_NOMLE/18-88          AC G1RT29.1
#=GS A0A5A9NKL1_9TELE/22-113     AC A0A5A9NKL1.1
#=GS C4LVQ0_ENTHI/16-106         AC C4LVQ0.1
#=GS A0A1Y2W045_9PEZI/17-110     AC A0A1Y2W045.1
#=GS G3I3H2_CRIGR/17-114         AC G3I3H2.1
#=GS S3DI74_GLAL2/21-110         AC S3DI74.1
#=GS A0A2Z6QDY9_9GLOM/21-111     AC A0A2Z6QDY9.1
#=GS F1RN65_PIG/22-113           AC F1RN65.2
#=GS A0A540MC30_MALBA/7-69       AC A0A540MC30.1
#=GS A0A671F6D1_RHIFE/231-316    AC A0A671F6D1.1
#=GS T1G9K8_HELRO/17-114         AC T1G9K8.1
#=GS A0A1J6IHM9_NICAT/22-111     AC A0A1J6IHM9.1
#=GS A0A151S1K9_CAJCA/234-321    AC A0A151S1K9.1
#=GS G3WPE0_SARHA/17-89          AC G3WPE0.2
#=GS A0A0R3T4L3_RODNA/17-118     AC A0A0R3T4L3.1
#=GS A0A3Q1CLE3_AMPOC/231-314    AC A0A3Q1CLE3.1
#=GS A0A444SDW6_ARMVU/16-111     AC A0A444SDW6.1
#=GS A0A0A1TZN0_ENTIV/16-106     AC A0A0A1TZN0.1
#=GS A0A3R7KYI6_9TRYP/26-114     AC A0A3R7KYI6.1
#=GS A0A2R6XVQ4_MARPO/17-112     AC A0A2R6XVQ4.1
#=GS A0A1G9U303_9EURY/16-118     AC A0A1G9U303.1
#=GS A0A061GX53_THECC/234-320    AC A0A061GX53.1
#=GS A0A4D8ZNN0_SALSN/234-321    AC A0A4D8ZNN0.1
#=GS A0A0Q3U1W1_AMAAE/231-317    AC A0A0Q3U1W1.1
#=GS A0A2J6KKH3_LACSA/37-120     AC A0A2J6KKH3.1
#=GS A0A074X9U1_AURPU/229-312    AC A0A074X9U1.1
#=GS A0A5E3WX46_9AGAM/21-110     AC A0A5E3WX46.1
#=GS A0A151P8E5_ALLMI/22-112     AC A0A151P8E5.1
#=GS A0A6A4QGU0_LUPAL/17-114     AC A0A6A4QGU0.1
#=GS A0A498HIA6_MALDO/7-69       AC A0A498HIA6.1
#=GS A0A673LRM6_9TELE/9-101      AC A0A673LRM6.1
#=GS D5G5W0_TUBMM/17-93          AC D5G5W0.1
#=GS A0A446XIL5_TRITD/234-318    AC A0A446XIL5.1
#=GS W9I5T3_FUSOX/21-108         AC W9I5T3.1
#=GS A0A1Y1X8Z8_9FUNG/17-108     AC A0A1Y1X8Z8.1
#=GS A0A369RRF7_9METZ/22-109     AC A0A369RRF7.1
#=GS A0A2Z7C9D1_9LAMI/21-98      AC A0A2Z7C9D1.1
#=GS A0A6A5FIL2_PERFL/17-113     AC A0A6A5FIL2.1
#=GS A0A329SFK5_9STRA/27-114     AC A0A329SFK5.1
#=GS I1C644_RHIO9/20-106         AC I1C644.1
#=GS A0A067F4P6_CITSI/17-109     AC A0A067F4P6.1
#=GS A0A540K4Y6_MALBA/1-88       AC A0A540K4Y6.1
#=GS A0A1J4L0H8_9EUKA/17-104     AC A0A1J4L0H8.1
#=GS A5K4W2_PLAVS/232-314        AC A5K4W2.1
#=GS Q6CL57_KLULA/19-103         AC Q6CL57.1
#=GS A0A7E4RJL7_CIMLE/231-316    AC A0A7E4RJL7.1
#=GS A0A5F8GC33_MONDO/22-98      AC A0A5F8GC33.1
#=GS A0A1J9Q4L9_9EURO/64-119     AC A0A1J9Q4L9.1
#=GS A0A4U6TU16_SETVI/17-111     AC A0A4U6TU16.1
#=GS A7IAK2_METB6/9-102          AC A7IAK2.1
#=GS I4DID9_PAPXU/17-111         AC I4DID9.1
#=GS L0ICQ0_HALRX/16-111         AC L0ICQ0.1
#=GS A0A118JY39_CYNCS/21-110     AC A0A118JY39.1
#=GS A9S5K3_PHYPA/21-106         AC A9S5K3.1
#=GS A0A7M7N374_STRPU/231-312    AC A0A7M7N374.1
#=GS A0A2T7EZM9_9POAL/234-318    AC A0A2T7EZM9.1
#=GS A0A0D9RMD1_CHLSB/22-113     AC A0A0D9RMD1.1
#=GS A0A395MSL3_9HYPO/17-109     AC A0A395MSL3.1
#=GS A0A5C5G083_9BASI/229-285    AC A0A5C5G083.1
#=GS M2ZKM0_PSEFD/229-314        AC M2ZKM0.1
#=GS A0A6A1Q670_BALPH/22-113     AC A0A6A1Q670.1
#=GS A0A445D0J4_ARAHY/23-117     AC A0A445D0J4.1
#=GS I1C783_RHIO9/228-308        AC I1C783.1
#=GS A0A2D3VJV8_9PEZI/21-110     AC A0A2D3VJV8.1
A8BKF1_GIAIC/21-105                    ........................................................................EPTAANLKSICDA......A.G.V.K.VD.....S.IWFT..L.......F....A.N...Y.......LE............G.K...NV.K.E.L.LT.T.LGSA--............................................SAAPAP..V.....T....A.......G......G......A....V..A....A...A..A....A......A...A....E.....T....A.KK...EES-...................-..D..DDE.........IVG.aGGMF..............................
A0A427Y491_9TREE/17-110                .......................................................................a-PSAADVKALLEV......V.G.I.E.AD.....A.AQLD..K.......L....I.S...E.......LE............G.K...DV.N.E.L.IA.E.GSSKLAsvp......................................sggAAPAAA..A.....G....G.......A......A......A....A..A....G...G..D....A......A...P....A.....E....E.KK...EEAK...................E..E..SDD.........DMG..FGLF..............................
A0A084VHA0_ANOSI/744-827               ........................................................................YPTLASVPHSIAN......G.F.R.N.LL.....A.IAAV..T.......E....V.E...F.......KE............A.E...TV.K.E.F.IK.D.PSKF--............................................AAVSAA..A.....A....P.......A......A......A....A..A....A...P..A....A......K...V....E.....E....K.KE...ESE-...................-..S..EDD.........DMG..FGLF..............................
A0A0D0BXB3_9AGAR/17-113                ........................................................................SPSASDIKRVLSA......V.S.I.Q.AD.....D.ERLD..K.......L....L.S...A.......LK............D.K...DI.N.Q.L.IQ.E.GSSKLSl..........................................iPSGGGP..V.....P....V.......D......A......G....G..G....G...T..Q....E......K...E....V.....D....K.KE...ENEEl................akD..D..GDDs.......eDEG..FYL-nlf...........................
A0A4W6DRG5_LATCA/22-112                .......................................................................t-VTEDKLNALIKA......A.G.V.T.VE.....P.FWPS..L.......F....A.K...A.......LS............S.I...DI.G.S.L.IC.N.VGAGGG...........................................aPAGAPA..A.....G....A.......A......A......A....A..G....D...A..P....A......K...E....E.....E....K.KE...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A1L0BXU2_9ASCO/20-106                .......................................................................e-LSSDNLLALTQA......A.G.A.T.VD.....A.VWAD..V.......F....A.K...A.......LE............G.Q...NL.K.E.L.LF.S.FAASA-............................................PAASAG..A.....S....G.......A......A......A....G..G....A...A..A....V......E...A....A.....E....E.KE...EEAA...................E..E..SDD.........DMG..FGLF..............................
A0A803JQS2_XENTR/17-92                 ........................................................................SPSANDIKSILKS......V.G.I.D.AD.....D.ERVK..K.......V....I.S...E.......LS............G.K...DL.E.D.V.VN.S.GLAKLSsvp......................................sggAVSAAP..A.....S....A.......P......A......A....G..G....A...A..P....A......E...K....-.....-....-.--...----...................-..-..---.........---..----iyk...........................
A0A7N5K7N3_AILME/22-112                .......................................................................t-VTEDKINALIKA......A.G.V.T.VE.....P.FWPG..L.......F....A.K...A.......LT............N.I...DI.G.S.L.IC.N.VGVGGG...........................................aPAASAP..A.....G....G.......G......A......P....G..G....G...G..A....P......A...E....E.....K....K.EE...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A399GA78_9PLEO/25-117                .......................................................................a-ITPEKLQTLLKA......A.G.LeD.VE.....P.IWTT..L.......F....A.N...A.......LK............D.K...NV.K.E.V.LT.A.VTAA--............................................PAGRNT..V.....A....D.......T......K......E....D..G....K...V..S....G......E...N....G.....N....E.ER...DGDEgi..............didA..D..SDD.........---..----gsafgdlf......................
A0A5N3XFE1_MUNRE/22-113                .......................................................................t-VTEEKINALIKA......A.R.V.N.VE.....P.FWPG..L.......F....A.K...A.......LA............N.V...NI.G.S.L.IC.N.VGAGGPa..........................................pAAGAAP..A.....G....S.......P......A......P....A..S....T...A..A....L......A...E....E.....K....K.VE...AKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A150FY74_GONPE/17-109                ........................................................................SPTADDINKILSS......V.G.V.E.AD.....A.EKVN..K.......L....I.S...E.......LE............G.K...DL.Q.E.V.LS.A.GRAKLAsvp......................................sggAVAAAP..A.....-....G.......G......A......A....P..A....A...G..G....A......A...P....A.....P....K.KE...EKKE...................P..S..EEE.........DMG..FSLF..............................
F0ZXE3_DICPU/227-304                   ........................................................................YPTIASIPHSVMN......A.F.K.N.LL.....A.ISFE..T.......E....I.T...F.......DA............A.D...KF.K.A.-.--.-.---A--............................................-ASAAP..V.....A....T.......A......A......A....P..A....A...A..A....P......A...A....A.....K....K.VV...EEPK...................E..E..SDD.........DMG..MGLF..............................
A0A091ISD7_CALAN/17-63                 ........................................................................SPSSKDLKKILDS......V.G.I.E.TD.....D.ERMN.kV.......V....I.S...E.......LN............G.K...NI.E.D.V.IA.Q.GKQS--............................................------..-.....-....-.......-......-......-....-..-....-...-..-....-......-...-....-.....-....-.--...----...................-..-..---.........---..----l.............................
A0A4S8JJ09_MUSBA/17-111                .......................................................................h-PSAGDLKSILES......V.G.A.E.VD.....E.KRVD..L.......L....L.S...E.......VK............G.K...DL.A.E.L.IA.A.GREKFAsvp......................................sggAVAAVA..V.....S....A.......P......G......A....G..A....A...P..A....A......E...E....P.....K....K.EE...KVEE..................kE..E..SDD.........DMG..FSLF..............................
A0A4P1QV23_LUPAN/234-320               ........................................................................YPTIAAAPHMFVN......A.Y.K.N.VL.....S.VAVA..T.......Q....Y.S...F.......PQ............A.D...EV.K.E.Y.LK.D.PSKFAV............................................AAPAAV..S.....G....T.......A......P......A....A..A....A...A..A....T......A...K....E.....E....K.KE...EPA-...................D..E..SDD.........DLG..LSLF..............................
G8JWW4_ERECY/92-178                    ........................................................................EVSADNLLALTKA......A.G.A.S.VD.....N.VWAD..I.......F....S.K...A.......LE............G.K...DV.K.D.I.LS.G.FHAAGS...........................................aSGASVG..A.....S....T.......T......G......A....A..S....D...E..A....A......A...E....E.....A....A.EE...AA--...................E..E..SDD.........DMG..FGLF..............................
A0A1Y2FID2_PROLT/19-106                ........................................................................EITADKLQTLCKA......A.N.V.E.VE.....P.IWAS..L.......F....A.K...A.......LE............G.K...DV.K.D.L.LL.N.VGGA-S............................................GAAPAA..A.....G....G.......A......A......A....S..G....D...A..P....A......A...E....E.....K....K.EE...KAEE..................kE..E..SDD.........DMG..FGLF..............................
M4ENX5_BRARP/28-120                    .......................................................................a-ITADKIATLIKS......A.G.V.S.CE.....S.YWPM..L.......F....A.K...M.......AE............K.R...NV.T.D.L.IM.N.VGAGGGgg.......................................apvS-AAAP..A.....A....G.......G......G......G...gG..A....A...A..A....P......A...A....E.....E....K.KK...EEVA...................E..E..SDG.........DLG..FGLF..............................
F6Z136_CALJA/18-88                     .....................................................................dde-------------......-.-.-.-.--.....-.----..V.......T....V.T...A.......LA............N.V...NI.G.S.L.IC.N.VGAGGPa..........................................pAAGAAP..A.....G....G.......P......A......P....S..T....A...A..A....P......A...E....E.....K....K.VE...AKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A1A6GF20_NEOLE/4-100                 .......................................................................k--SAKDIKKILES......V.G.I.K.AD.....N.DQLN..K.......V....F.S...E.......LN............G.K..sEL.M.D.V.IA.Q.GVGKLAsvpv....................................ggavAVSADP..G.....S....A.......A......P......A....A..G....S...A..P....A......A...E....E.....K....K.DE...KKEE..................sE..E..SDD.........DMG..FGLF..............................
M2MFM3_BAUPA/234-321                   ........................................................................YPTLPSVSHTILN......A.Y.K.N.LL.....A.IAVE..T.......E....Y.E...W.......PA............I.A...QL.K.A.G.IR.D.PSLLQAa..........................................aPAASEA..A.....P....A.......A......E......E....A..K....A...D..A....P......K...E....E.....E....K.KE...EE--...................E..E..EDE.........DMG..FGLF..............................
A0A445B993_ARAHY/23-119                ........................dieesssdtfeiqrklvkavcavdssgavqssfstvtpssavfqvvvg-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.G----Avfv......................................gggAAAAAA..P.....A....G.......G......A......A....P..A....A...E..A....A......P...A....A.....A....K.KE...EKVE...................E..E..DDE.........DFG..MSLF..............................
A0A3Q7UY48_VULVU/22-113                .......................................................................t-VTEDKINALIKA......A.G.V.N.VE.....P.FWPG..L.......F....A.K...A.......LA............N.V...NI.G.S.L.IC.N.VGAGGPa..........................................pAAGAAP..A.....G....G.......P......A......P....S..T....A...A..A....P......A...E....E.....K....K.VE...AKKEe.................sE..E..SDD.........DMG..FGLF..............................
B3S429_TRIAD/231-313                   ........................................................................YPTTVSVPHSIIN......G.F.K.N.VL.....A.VAVE..T.......D....I.N...F.......PE............A.E...KA.K.A.F.LA.D.PSAF--............................................-IVAAP..V.....A....A.......A......G......E....A..E....E...A..K....P......A...K....E.....E....K.QE...EEE-...................-..E..SDD.........DMG..FGLF..............................
A0A226NAL5_CALSU/231-316               ........................................................................YPTIASVPHSIIN......G.Y.K.R.VL.....A.VAVE..T.......N....Y.S...F.......PL............A.E...KV.K.A.F.LA.D.PSAFVV............................................AAPAVT..E.....T....A.......A......P......A....A..A....A...A..T....P......A...K....E.....A....P.KE...ESE-...................-..E..SDE.........DMG..FGLF..............................
A0A0W7TI05_9ARCH/230-333               .......................................................................y-PAKETMPALIAK......A.Y.R.-.-S.....A.VALS..V.......E....A.A...I.......PT............K.D...TI.G.A.L.FA.K.ADRQMLalasasgft.........................nddiaarlasAPVAAS..A.....A....A.......E......P......A....A..P....A...E..Q....K......A...E....E.....E....K.SE...EE--...................T..E..EEV.........SAG.lGALF..............................
A8Y1E6_CAEBR/22-110                    .......................................................................a-ITAEKISSLLKA......A.N.V.E.FE.....P.FWPG..L.......F....A.K...A.......LE............G.V...DV.K.N.L.IT.S.VSSGAGs..........................................gPAPAAA..A.....A....A.......P......A......A....G..G....A...A..P....A......A...E....T.....K....K.KE...EPK-...................E..E..SDD.........DMG..FGLF..............................
A0A3Q4HEJ8_NEOBR/17-113                ........................................................................NPDAKDIKKILES......V.G.I.E.ID.....D.TRLD..K.......V....I.S...E.......LK............G.K...NV.N.D.V.IT.T.GYGKLAsmpa....................................ggavAVASSA..A.....A....G.......S......G......G....A..A....A...P..A....A......A...E....E.....K....K.EE...KKEE..................sE..E..SDD.........DMG..FGLF..............................
A0A162R5H3_MUCCL/228-307               ........................................................................YPTLASVPHSVIN......G.Y.K.N.LL.....A.VSVA..S.......D....Y.T...F.......PG............S.E...QI.K.E.Y.IA.N.PDAF--............................................---AVA..A.....P....V.......A......A......E....T..S....S...A..P....A......A...E....A.....A....A.EE...SE--...................-..E..EDD.........DMG..FGLF..............................
M2T1B0_COCSN/17-112                    ........................................................................SPSAEDVKSVLNA......V.G.I.E.AD.....D.ERLN..K.......L....I.S...E.......LE............G.K...DI.N.E.L.IA.S.GSEKLAsvps....................................ggsgGGAAAA..T.....G....G.......A......A......A....G..G....A...A..A....A......E...E....A.....P....A.AK...EEEK...................E..E..SDE.........DMG..FGLF..............................
D3S1Z2_FERPA/18-105                    ........................................................................EINEENVKAVLEA......A.G.I.E.VN.....E.ARVK..A.......L....V.T...A.......LE............G.I...NI.D.E.A.IS.K.AAFV--............................................AAPAAA..P.....A....A.......P......A......E....E..A....K...E..E....E......K...K....E.....E....K.KE...EEEE..................vK..E..EEV.........LEG.lGALF..............................
A0A4S3J849_9EURO/21-106                ........................................................................EVTADKIQTLLDA......A.K.VqE.IE.....P.IWSS..I.......F....A.K...A.......LE............G.K...DI.K.D.L.LT.N.IGSA--............................................-GPAVA..A.....P....A.......A......A......A....G..G....A...A..A....P......A...E....A.....A....E.EK...EEEK...................E..E..SDE.........DMG..FGLF..............................
A0A5A7SR49_CUCME/17-114                .......................................................................s-PGVDDVKAILNS......V.G.V.E.ID.....E.ERIT..L.......L....L.S...E.......VK............G.K...DV.T.E.L.IA.S.GREKLAsvps...................................gggaiAVSASA..G.....G....A.......A......G......G....G..A....A...P..A....P......A...E....Q.....K....K.EE...KVEE..................kE..E..SDD.........DMG..FSLF..............................
A0A2U1Q8M6_ARTAN/237-320               ........................................................................YPTIAAAPHMLIN......G.Y.K.N.IL.....A.VAVG..T.......G....Y.S...F.......PL............A.D...RV.K.E.Y.LE.D.PTRF--............................................-AVVAP..A.....S....G.......T......A......P....A..A....A...D..A....A......P...A....E.....E....K.ND...EPA-...................D..D..SED.........DFN..FSLF..............................
A0A1Y2MFJ4_EPING/17-111                ........................................................................SPSAADVKAVLES......V.G.I.E.AD.....E.SRLE..T.......L....I.S...E.......LE............G.K...DI.N.E.L.IA.S.GSEKLAsvps....................................ggagGAAPAA..G.....G....A.......A......A......A....G..G....A...A..E....A......A...P....A.....E....E.KA...EEK-...................E..E..SDD.........DMG..FGLF..............................
A0A4W4DYU7_ELEEL/77-173                ........................................................................SPSAKDIKNILGS......V.G.I.E.AD.....D.QRLN..K.......V....I.S...E.......LN............G.K...DI.N.E.V.MN.A.GLSKLAsvpa....................................ggavAVSASA..P.....S....G.......G......A......P....A..A....E...A..P....A......A...E....E.....K....K.EE...KREE..................sE..E..SDE.........DMG..FGLF..............................
A0A446YI05_TRITD/227-311               ........................................................................YPTMAAAPHMFLN......A.Y.K.N.VL.....A.VALE..T.......D....Y.S...Y.......DH............A.D...KI.K.E.Y.LK.D.PSKF--............................................AVAAPA..A.....A....A.......S......G......G....A..A....A...A..A....P......K...E....E.....E....K.KD...EPE-...................E..E..SDG.........EMG..FSLF..............................
A0A229XGW7_9EURO/17-111                ........................................................................SPSTEDVKAVLSS......V.G.I.D.AD.....E.ERLN..K.......L....I.A...E.......LE............G.K...DL.Q.E.L.IA.E.GSAKLAsvp.....................................sggaGGAAAP..A.....A....G.......G......A......A....A..G....G...A..A....A......A...A....P.....A....E.EK...EEEK...................E..E..SDE.........DMG..FGLF..............................
A0A4Z1SUJ6_GIAMU/17-108                .......................................................................k-PTAADVKKIIEA......I.G.G.K.PN.....D.ELVE..V.......V....V.K...K.......VGg..........sE.H...SL.E.D.L.MA.A.GRKRMAam.......................................pciA--AGG..A.....P....A.......S......G......A....A..G....A...A..A....A......A...A....E.....P....A.KK...EES-...................-..S..DDE.........IIG.aGGMF..............................
A0A6J1D8P9_MOMCH/17-114                ........................................................................SPSAGDVKDILGS......V.G.A.E.ID.....E.DRIE..L.......L....L.S...N.......VK............G.K...DI.A.E.L.IA.S.GREKLAsvps...................................ggggiVA-VSA..G.....G....G.......G......G......G....G..A....A...A..P....A......A...E....E.....S....K.KE...EKVEe.................kE..E..SDD.........DMG..FSLF..............................
A0A4P1RQ58_LUPAN/17-114                .......................................................................t-PSAADIKNILGS......V.G.A.E.AE.....A.EKIE..F.......L....L.N...E.......VK............G.K...SI.V.E.L.IA.S.GREKLAsvps...................................gggavAVSAAP..A.....G....G.......A......G......G....G..G....S...A..P....A......A...E....A.....K....E.EK...KVEE..................kE..E..SDD.........DMG..FSLF..............................
A0A4U0VBQ2_9PEZI/21-112                .......................................................................d-ITADKLQSIITA......A.K.VqD.VE.....P.IWTT..L.......F....A.K...A.......LE............G.K...DV.K.D.L.LL.N.VGSGGG............................................AAAAAP..A.....A....Gg....agG......A......A....A..G....G...A..A....E......E...K....E.....E....E.KK...EEEK...................E..E..SDE.........DMG..FGLF..............................
A0A5A9NRC4_9TELE/17-114                ........................................................................NPSAKDIKTILGS......V.G.I.E.AD.....D.ERLN..K.......V....I.S...E.......LN............G.K...DI.N.E.V.MN.A.GLSKLTsvpa....................................ggavAVSAVA..A.....S....G.......G......A......A....P..A....V...E..A....P......A...A....E.....E....K.KE...EKKDe.................sE..E..SDE.........DMG..FGLF..............................
A0A2G8JRJ1_STIJA/29-123                ........................................................................SPSSDDIKKILGS......V.G.I.E.AE.....D.DKLN..K.......V....I.S...E.......LK............G.K...NL.E.E.L.IA.E.GNGKLAsm........................................psG-GAAP..A.....A....S.......G......G......G....A..A....A...G..G....A......A...E....E.....E....K.KE...EAKKee...............sdS..E..SDD.........DMG..FGLF..............................
A0A5N7A9V3_9EURO/17-108                ........................................................................NPSAEDIKNVLSS......V.G.I.D.SD.....E.ERLQ..K.......L....I.S...E.......LE............G.K...DV.Q.Q.L.IS.E.GTEKLAtvp......................................sggAGGAAP..A.....A....G.......G......A......A....A..G....G...D..A....P......A...A....E.....E....K.EE...EKE-...................-..E..SDE.........DMG..FGLF..............................
A0A6J0JCK5_RAPSA/22-112                ........................................................................SITADKIATLVKA......A.G.V.E.IE.....S.YWPM..L.......F....A.K...M.......AE............K.R...NV.T.D.L.IM.N.VGAGGGgg........................................apVAAAAP..A.....A....G.......G......G......G....A..A....A...A..P....A......A...E....E.....K....K.KE...EVA-...................E..E..SDG.........DLG..FGLF..............................
A0A1F5LZA1_9EURO/21-106                ........................................................................EVSADKIQTLIGA......A.K.VpE.VE.....P.IWAQ..I.......F....A.K...A.......LE............G.K...DI.K.E.L.LT.N.VGSA--............................................--GPAA..A.....A....P.......A......A......A....G..G....A...A..P....A......A...E....E.....K....K.EE...KEED..................kE..E..SDE.........DMG..FGLF..............................
X0CM61_FUSOX/17-109                    ........................................................................SPSAADVKAVLES......V.G.I.E.AD.....D.ERLN..T.......L....I.S...E.......LE............G.K...DI.Q.E.L.IA.E.GSEKLAsvp......................................sggAGGAAA..G.....G....A.......A......A......A....G..G....A...A..E....E......A...K....E.....E....E.KE...EEK-...................E..E..SDE.........DMG..FGLF..............................
I2JUJ7_DEKBR/21-110                    .......................................................................e-LSSENLLKLTHA......A.G.L.D.MD.....S.VWGN..I.......Y....A.K...A.......LE............G.Q...DL.K.K.L.LI.N.FNIS--............................................SAAAAP..A.....A....A.......X......A......A....A..A....G...E..X....D......A...A....E.....E....D.EE...KKEEs................eeE..E..EDD........vDMG..MGLF..............................
R0EUX9_9BRAS/22-100                    .......................................................................a-ITADKIATLVKS......A.G.V.D.VE.....S.YWPM..L.......F....A.K...M.......AE............K.R...NV.T.D.L.IM.N.VGAGGGgg........................................apVAAAAP..A.....A....G.......G......G......A....A..A....A...A..P....A......A...E....E.....K....K.KV...----...................-..-..---.........---..----klk...........................
A0A5D2SFC0_GOSMU/22-112                .......................................................................p-ITAEKISTLVKA......A.N.V.S.VE.....S.YWPS..L.......F....A.K...L.......FE............K.C...NI.E.D.L.IT.N.VGAGGGg.........................................apVAAAAP..V.....A....A.......G......G.....gA....G..A....A...A..P....P......P...A....E.....E....K.KE...EP-E...................E..E..SDD.........DMG..FSLF..............................
S9XIA7_CAMFR/22-113                    .......................................................................t-VTEDKINALIKA......A.G.V.N.VE.....P.FWPG..L.......F....T.K...A.......LA............N.I...NI.G.S.L.LC.N.AGAGGPa..........................................pAAGTAP..A.....G....G.......H......D......P....S..P....T...A..A....P......A...E....E.....K....K.VK...AKKEe.................sE..E..NDD.........DMG..FALF..............................
A0A0E0I6L3_ORYNI/21-109                .......................................................................p-ITSEKIATLVKA......A.N.I.K.VE.....A.YWPG..L.......F....A.K...L.......LE............H.R...SV.D.D.L.IL.S.VGSGGGa..........................................aPVAAAA..A.....P....A.......A......G......G....G..A....A...A..A....P......A...A....E.....E....K.KE...EAK-...................E..E..SDD.........DMG..FSLF..............................
A0A068Y975_ECHMU/17-122                .......................................................................r-PQESDIKSILSS......V.G.I.E.CE.....Q.ARAK..L.......V....V.D...Q.......LH............G.R...NV.H.D.L.IN.A.GKEKMStvsfgavp...........................vavatpaggAPTTAT..A.....A....A.......E......A......P....K..G....G...D..K....A......P...A....P.....A....K.EE...KKEE..................sE..E..SDA.........DMG..FSLF..............................
E9CCZ9_CAPO3/17-110                    .......................................................................t-PSAADVKAILSS......V.G.I.E.AD.....E.TKLN..K.......V....I.A...E.......LS............G.K...SL.E.Q.L.IA.A.GSAKLAsv.......................................pagGAAAAP..A.....A....S.......S......A......A....P..A....K...E..A....K......K...E....E.....P....K.KE...EKKK...................E..E..SEE........gDMG..FGLF..............................
A0A103XIF9_CYNCS/21-109                .......................................................................p-ITSEKIATLLKA......A.N.V.N.CE.....S.YWPG..L.......F....A.K...L.......AE............K.K...NI.E.D.L.IV.N.VGAGGGg.........................................aaPAVA-A..P.....A....A.......G......G......A....V..A....A...A..A....P......A...P....E.....E....K.KE...EPK-...................E..E..SDD.........DMG..FSLF..............................
A0A0H2R2S6_9AGAM/232-314               ........................................................................YPTIVSVTHTLVN......A.Y.K.N.LI.....A.VALV..T.......D....F.S...F.......EG............A.E...KI.K.D.M.LA.N.PDAY--............................................-AAAAP..A.....A....V.......A......A......A....P..A....A...E..E....S......K...P....E.....E....K.EE...EKE-...................-..E..SDE.........DMG..FGLF..............................
A0A6G2HD99_9EURY/16-107                ........................................................................EINEDNITGVLEA......A.G.V.D.VE.....E.SRVK..A.......L....V.A...A.......LE............D.V...DI.E.E.A.IE.T.AAAA-P............................................AAGAAA..A.....S....G.......A......A......D....G..D....D...S..D....D......E...E....E.....E....A.AE...EEDDe.................dE..E..EDD.........DGG..EGL-gelf..........................
A0A1J7J678_9PEZI/229-316               ........................................................................YPTLPSVFHSLVN......S.Y.K.K.VL.....A.VAVA..T.......E....Y.S...W.......PA............I.E...EL.K.D.R.IA.N.PDAY--............................................A-AAAP..A.....A....G.......G......A......A....D..S....S...A..P....A......A...A....E.....E....A.KD...EDKS..................dE..E..SDE.........DGG.gFG--dlf...........................
A0A2P6NBB3_9EUKA/21-108                .......................................................................p-VTADKIAALLNA......A.G.V.T.FA.....P.YWPG..I.......F....A.R...A.......LG............N.K...NL.D.D.L.IT.N.SGGGAP............................................AAAPAA..S.....S....A.......P......A......A....G..G....A...A..P....A......A...K....E.....E....K.KK...EEPK...................E..E..EDD.........DMG..FGLF..............................
A2YT04_ORYSI/17-113                    ........................................................................SPSKDDVRAILGS......V.G.A.D.VD.....E.AKLD..L.......L....F.E...E.......IA............G.K...DV.P.E.L.IA.A.GRERLAlaap....................................cggiAAAAAG..G.....Q....V.......V......A......A....G..G....A...A..A....A......A...A....E.....E....E.AE...EEKE...................E..E..EDD.........DDG.lFNLF..............................
A0A1E3QSW0_9ASCO/19-103                ........................................................................EITSENLLAITKA......A.G.A.S.VD.....S.IWAD..V.......F....A.K...S.......LE............G.K...DL.K.Q.I.LA.G.FSAA--............................................GAAPAA..G.....A....A.......P......A......A....G..A....S...T..E....A......A...A....E.....E....V.AE...EAA-...................E..E..SDD.........DMG..FGLF..............................
A0A2P6TRH2_CHLSO/233-313               ........................................................................YPTIASVPHSLIN......G.Y.K.N.VL.....A.IAVE..T.......D....Y.S...F.......PQ............A.E...KV.K.A.Y.LA.D.PSAF--............................................AVAAAP..T.....A....G.......G......A......A....P..A....A...A..A....A......A...A....P.....E....P.EE...----...................-..E..EDE.........DMG..FSLF..............................
A0A034VBX9_BACDO/231-316               ........................................................................YPTIASAPHSVAN......G.F.K.N.LL.....A.IAAA..T.......E....V.D...F.......KE............A.A...TI.K.E.F.IK.D.PSKFV-............................................AAAAAS..A.....P....A.......A......G......A....G..A....A...A..E....K......K...E....E.....A....K.KE...ESE-...................S..E..EDD.........DMG..FGLF..............................
RL12_HALVD/16-112                      ........................................................................EVNEENITAVLEA......A.G.V.D.VE.....E.SRVK..A.......L....V.A...A.......LE............D.V...DI.E.E.A.IE.T.AAAA--............................................PAPAAG..G.....S....A.......G......G......E....V..E....A...A..D....D......D...D....E.....E....D.AE...EEAAdeggd.........ddgddD..E..EAD.........GEG.lGALF..............................
D7EAE1_METEZ/237-345                   ........................................................................YPTAENITTLISK......G.V.S.-.-E.....A.RNLG..V.......N....A.T...I.......IE............P.Q...LM.D.T.H.LS.K.AYSQMLsvaqivydk.........................denavdddlkQTLTSA..A.....T....S.......K......Q......E....T..E....S...G..P....T......T...E....E.....E....T.KE...SEEE...................E..E..SEEe......sgMAG.lGSLF..............................
V7CH15_PHAVU/234-320                   .......................................................................f-PTLAAAPHMFVN......A.Y.K.N.VL.....S.VAVE..T.......D....Y.S...Y.......PE............A.D...KV.K.E.Y.LK.D.PSKFAV............................................AATVAP..A.....A....A.......S......G......A....P..A....A...A..A....A......K...E....E.....E....K.KE...EPA-...................E..E..SDD.........DMG..FSLF..............................
D8LSD6_ECTSI/26-112                    ........................................................................EITSDQLSALITA......T.G.N.E.VE.....G.YWPT..L.......F....S.G...F.......LA............K.A...GI.E.K.L.IL.A.ASSG--............................................SGGGGG..G.....G....G.......G......G......D...gG..G....D...A..P....A......A...E....E.....E....K.KE...EE--...................E..E..EEI.........DMG..GGM-dmf...........................
I1LTT3_SOYBN/17-110                    ........................................................................SPSADDIKHILGA......V.G.A.E.AE.....N.ELIE..L.......L....L.T...E.......VK............G.K...DF.N.E.L.IA.S.GSEKMSavs.....................................gggaAVAVAA..A.....P....A.......G......G......A....A..A....P...A..A....E......A...K....E.....E....K.KV...EEK-...................E..E..SDD.........DMG..FSLF..............................
A0A194VCY8_9PEZI/21-107                .......................................................................d-ITADKLQTLVKT......A.G.V.E.VE.....P.IWTS..L.......F....A.K...A.......LE............G.K...DV.K.D.L.LT.S.VGSG--............................................GGAAAP..A.....A....G.......G......A......A....A..A....G...G..A....A......E...E....T.....K....E.EE...KVEE..................kE..E..SDD.........DMG..FGLF..............................
A0A078HWW9_BRANA/34-119                ..................................lqrkvvqtalsadssggvqssfslvsptsavfqviigg-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.-GSGGGf..........................................aAGGGAA..A.....G....G.......G......G......G....G..E....A...A..A....A......T...K....E.....E....E.KK...KEES...................E..E..EEG.........DFG..FDLF..............................
A0A068U5S5_COFCA/21-111                .......................................................................p-VTAEKIATLVKA......A.N.V.T.VE.....S.YWPS..L.......F....A.K...L.......CE............K.R...NI.E.D.L.IV.N.VGCGGGaa.......................................vavAA-PGA..G.....A....G.......S......A......P....A..A....A...A..A....P......A...A....E.....E....K.KE...EP-K...................E..E..SDE.........DMG..FSLF..............................
H2Y4S4_CIOSA/17-109                    .......................................................................s-PSGNDIKNILGS......V.G.I.D.VD.....D.DKLN..M.......V....L.S...Q.......LK............G.K...NL.E.E.V.IA.A.GNEKLAsvp......................................sggGGAVAA..S.....S....G.......G......A......A....G..G....A...E..G....K......K...K....E.....E....V.KE...ESE-...................E..E..SDD.........DMG..FGLF..............................
A0A0A0LV50_CUCSA/234-319               .......................................................................f-PTLAAAPHMLIN......A.Y.K.N.AL.....A.IAVA..T.......E....Y.S...F.......SE............A.D...EI.K.E.F.LK.D.PSKF--............................................AAAAAP..A.....V....A.......A......E......S....V..A....A...A..P....A......A...V....E.....E....K.KE...EPE-...................E..E..SDE........gDMI..MGLF..............................
A0A167PYB1_CALVF/1-55                  ................................................................mllnvgag-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.G----Gap........................................vaGSGPAA..A.....A....G.......S......A......A....P..E....A...A..A....E......E...K....E.....E....E.KK...EEEK...................E..E..SDD.........DMG..FGLF..............................
A0A061DU49_THECC/93-184                .......................................................................s-VTADKIAAIIKA......A.N.L.S.VE.....S.YWPN..L.......F....A.K...L.......AE............K.R...NL.E.D.L.IA.N.VGAGGGaa........................................avAVAAPP..A.....G....G.......G......G......G....G..A....A...A..P....P......P...A....E.....E....K.KK...EEPE...................E..E..SDD.........DMG..FSLF..............................
A0A673M1Q5_9TELE/17-115                ........................................................................NPSAKDIKNILGS......V.G.I.E.AD.....D.ERLN..K.......V....I.S...E.......LN............G.K...DI.N.E.V.MN.A.GLSKLAsvpag..................................gavavSAAATG..G.....G....G.......A......A......P....A..G....E...A..P....A......A...E....E.....K....K.EE...KKEE..................sE..E..SDE.........DMG..FGLF..............................
I3TDH6_THEC1/23-114                    ........................................................................EINEENVKKVLEA......A.G.V.A.VD.....E.VRVK..S.......L....V.A...A.......LK............T.I...DI.G.K.V.LE.Q.ALAAPV............................................AAAPVA..Q.....P....V.......Q......P......Q....Q..Q....A...A..E....K......K...E....E.....E....K.KE...EEKQ...................EtiS..EEQ........lAEG.lGALF..............................
A0A6J0P6V5_RAPSA/22-112                .......................................................................a-ITADKIATLVKA......A.G.V.E.IE.....S.YWPM..L.......F....A.K...M.......AE............K.R...NV.T.D.L.IM.N.VGAGGGgg........................................apVAAAAP..A.....A....G.......G......G......G....A..A....A...A..P....A......A...E....E.....K....K.KE...EVA-...................E..E..SDG.........DLG..FGLF..............................
A0A077ZUT5_STYLE/32-118                ........................................................................EINGEKLAKVIKA......S.G.N.E.VE.....A.YWPA..L.......F....A.K...A.......LK............G.Q...DI.E.G.L.LS.N.LASAPS............................................VGGGAA..G.....P....A.......A......E......T....T..A....V...A..A....P......K...K....E.....V....V.EE...KKKE...................E..E..ADV.........DMG..-GLF..............................
D7LSI6_ARALL/1-57                      .....................................................................mdy-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.L.IM.N.AGAGGSaa.......................................apvAVSSSA..S.....S....S.......G......S......A....T..Q....A...A..P....V......A...E....E.....I....K.KE...DEK-...................E..E..SDD.........DF-..----vsff..........................
A0A2P5B216_PARAD/17-108                ........................................................................NPSADDIKHILGS......V.G.A.E.AD.....E.DKIK..L.......L....L.S...S.......LE............G.K...DI.S.E.L.IA.A.GREKLAy..........................................cVPSGGG..A.....A....V.......A......A......A....A..T....A...A..P....A......E...A....E.....T....K.KE...EKEEl.................iE..E..SDE.........EGM..LSLF..............................
A0A197JGX0_9FUNG/20-106                ........................................................................EITSDKLQTLLKA......A.N.V.E.VE.....S.IWTS..L.......F....A.K...A.......LE............G.K...DV.A.A.M.LS.N.VGAAGS...........................................aPAAGAA..A.....P....A.......G......G......A....A..A....A...E..E....K......A...E....E.....K....K.EE...AK--...................E..E..SDD.........DMG..FGLF..............................
W6KKB3_9TRYP/16-110                    .......................................................................t-PSQSDVEAVLKA......A.G.V.A.VD.....S.SRIR..S.......L....F.K...E.......LE............G.K...SF.D.E.L.CM.E.GKSKLGagga....................................aapvS----G..G.....A....A.......A......A......A....S..G....A...A..P....A......A...A....V.....P....E.AD...NNKAq................pvD..D..DED.........DMD..FGLF..............................
L0PBR1_PNEJ8/17-106                    .......................................................................c-PTAQDIKKVLES......V.G.L.E.AD.....D.GRLT..S.......L....F.D...K.......LN............G.H...SI.E.D.L.IA.Q.GKEKLAs..........................................vPSGGAG..A.....A....A.......P......A......S....A..A....A...P..V....S......T...E....E.....A....P.AK...EEEE...................E..E..SDE.........DMG..FGLF..............................
Q7PQG7_ANOGA/231-313                   ........................................................................YPTLASVPHSIAN......G.F.R.N.LL.....A.IAAV..T.......E....V.E...F.......KE............A.E...TV.K.E.F.IK.D.PSKF--............................................--AAAT..A.....T....T.......A......S......A....A..A....P...A..A....K......A...E....E.....K....K.VE...SES-...................E..D..EDE.........DMG..FGLF..............................
A0A3Q1F923_9TELE/22-112                .......................................................................t-VTEDKLNALIKA......A.G.V.T.VE.....P.FWPS..L.......F....A.K...A.......LS............S.V...DI.G.S.L.IS.N.VGAGGA...........................................aPAGAPA..A.....G....G.......A......A......A....A..G....D...A..P....A......K...E....E.....E....K.KE...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A6J0T1C2_9SAUR/17-113                ........................................................................SPSSKDLKKILDS......V.G.I.E.TD.....Y.ERVN..K.......V....I.S...E.......LN............G.K...NI.E.D.V.IA.Q.GNSKLAsmp.....................................vggaVAVSAG..G.....S....A.......A......P......A....A..G....A...A..P....A......A...A....E.....E....K.KE...EKKEv.................sE..E..SDD.........DMG..FGLF..............................
A0A395HP26_ASPHC/21-107                ........................................................................EVTADKLQTLINA......A.K.VpE.VE.....P.IWTS..I.......F....A.K...A.......LE............G.K...DI.K.E.L.LT.N.VGSGG-............................................PAAAAP..A.....A....A.......A......G......G....A..A....A...P..A....E......A...V....E.....E....K.KE...EEK-...................E..E..SDD.........DMG..FGLF..............................
A0A367IW73_RHIST/20-103                ........................................................................EITADKLQTLVAA......A.G.I.E.VE.....P.IWFS..L.......Y....A.K...A.......LA............G.Q...DL.K.A.L.LL.N.VGAP--............................................GAGPAV..A.....G....G.......G......A......A....A..G....A...A..T....D......A...P....A.....E....E.EK...AEEK...................E..E..SDD.........DMG..FG--..............................
A0A2K5KU25_CERAT/22-113                .......................................................................t-VTEDKINALIKA......A.G.V.N.VE.....P.FWPG..L.......F....A.K...A.......LA............N.V...NN.G.S.L.IC.N.VGAGGPa..........................................pAAGAAP..A.....G....G.......P......A......P....S..T....A...A..A....P......A...E....E.....K....K.VE...AKKEe.................sE..E..YDD.........DMG..FGLF..............................
A0A1Q9DP29_SYMMI/549-634               .......................................................................i-PTEAGLPHAFGN......A.F.R.N.VA.....S.LIAD..I.......D....F.T...F.......KE............V.E...EV.K.Q.F.LE.D.PEAYA-............................................AANPVA..A.....S....G.......P......A......A....G..A....P...A..E....A......K...K....E.....E....K.KA...VVE-...................E..E..EEE.........EMD..FDLF..............................
A0A0H5S275_BRUMA/21-116                .......................................................................a-ITGDKISTILKA......A.H.V.D.VE.....P.FWPG..L.......F....A.K...A.......LE............G.V...DV.K.S.L.IT.N.ISSSVGsggg...................................aaagvAAPSAT..A.....A....A.......A......A......P....A..A....A...A..E....E......K...E....D.....K....K.KE...EPK-...................E..E..SDD.........DMG..FGLF..............................
A0A0E0HF91_ORYNI/33-128                ........................................................................SPSADDIKNILES......V.G.V.E.AN.....D.ERLE..F.......L....L.S...E.......LE............G.K...DI.T.E.V.IA.A.GREKFAsvp.....................................sgggGGIAVA..A.....P....T.......A......A......G....G..G....A...A..P....A......E...E....A.....K....K.EE...KVEE..................kE..E..SDD.........DMG..FSLF..............................
A0A210QYK4_MIZYE/22-109                .......................................................................a-ITDDKLATILKT......A.K.V.T.VE.....P.YWPG..L.......F....A.K...A.......LD............G.V...NV.R.E.L.IS.N.IASS--............................................AGSAAP..A.....G....G.......A......G......A....A..P....A...A..E....E......K...K....E.....E....K.KE...EKKEe.................sD..E..SDD.........DMG..FGLF..............................
A0A251SUJ1_HELAN/233-316               ........................................................................YPTIAAAPHMLIN......G.Y.K.N.LL.....A.VAVE..T.......E....Y.S...F.......PL............A.D...KV.K.E.Y.LA.D.PSKF--............................................-AVAAP..V.....A....E.......A......A......P....A..A....A...A..A....P......A...E....T.....K....K.EE...PKE-...................E..S..DDE.........DFG..ISLF..............................
A0A0D2XDL8_FUSO4/229-312               .......................................................................f-PTLPSVLHSVVN......S.Y.K.K.VL.....A.VAIS..T.......E....I.T...W.......PE............I.E...EL.K.D.R.IA.N.PDAY--............................................-ASAAP..A.....A....A.......A......S......G....G..A....A...A..P....A......E...A....E.....K....K.DE...SEE-...................-..E..DED.........EEG.fGGLF..............................
A0A4U1F2G0_MONMO/229-315               ........................................................................YPTVASVPHSIIS......G.Y.K.R.VL.....A.LSVE..T.......E....Y.T...F.......PL............A.E...KV.K.A.F.LA.D.PSAFVA............................................AAPVAA..A.....S....T.......A......A......P....A..A....A...A..A....A......P...A....K.....V....E.AK...EE-S...................E..E..SDE.........DMG..FGLF..............................
A0A6J3LA80_9HYME/17-113                ........................................................................SPSQNDIEKILSS......V.G.I.E.AD.....T.EKLK..K.......V....I.S...E.......LN............G.K...SV.D.E.L.IA.Q.GMEKLLsm.......................................pvgGAVAVS..A.....D....A.......A......P......A....G..G....A...A..A....P......A...E....E.....K....K.EE...KKPAke...............esE..S..EDD.........DMG..FGLF..............................
G0NY22_CAEBE/231-311                   ........................................................................YPTLASVAHSLAT......G.L.Q.N.ML.....G.VAAV..T.......D....V.T...F.......KE............A.E...TI.K.A.Y.IA.D.PSKF--............................................---AAA..A.....P....A.......A......A......A....A..P....A...A..A....A......P...A....A.....K....K.EE...PK--...................E..E..SDD.........DMG..FGLF..............................
A0A0M9VXK6_9HYPO/21-107                ........................................................................EITAEKIQAVIAA......A.G.L.E.VE.....A.VWAS..I.......F....A.K...A.......LE............G.K...DV.K.D.L.LV.N.VGSG--............................................GGAAAP..A.....A....G.......G......A......A....A..A....G...G..A....A......E...E....A.....K....V.EE...KEEE..................kE..E..SDE.........DMG..FGLF..............................
A0A4D8YNV2_SALSN/289-379               .......................................................................p-ITADKISTLLKA......A.N.L.S.VE.....S.YWPS..L.......F....A.K...L.......CE............K.R...NV.E.D.L.IM.N.VGAGGGgg........................................avAVAAPT..G.....A....G.......G......G......A....A..A....A...A..P....A......A...E....E.....K....K.KE...EEK-...................E..E..SDD.........DMG..FGLF..............................
A0A3L6T4J7_PANMI/17-111                ........................................................................SPSAEDLSSILES......V.G.C.E.ID.....N.EKME..L.......L....L.S...Q.......LS............G.K...DI.T.E.L.IA.A.GREKFAsvp......................................cggGGVAVA..A.....A....A.......P......A......A....G..G....A...A..P....A......A...E....A.....K....K.EE...KVEE..................kE..E..SDD.........DMG..FSLF..............................
A0A674ENL3_SALTR/22-110                .......................................................................t-VTEDKLMALIKA......A.N.V.T.IE.....P.FWPS..L.......F....S.K...A.......LA............S.V...DI.G.S.L.IC.N.VGAG--............................................GGAAPA..A.....G....G.......A......A......P....A..A....D...A..P....A......K...E....E.....E....K.KE...EKKEe................seE..G..SDD.........DMG..FGLF..............................
A0A6I9QE30_ELAGV/17-111                ........................................................................SPTADDLKDILGS......V.G.I.E.AD.....D.DRIE..F.......L....L.S...E.......VK............G.K...DI.T.E.L.VA.S.GREKFAsvp......................................sggGAIAVA..A.....P....A.......G......G......G....A..A....A...P..A....A......D...E....P.....K....K.EE...KVEE..................kE..E..SDE.........DMG..FSLF..............................
A0A672KCV0_SINGR/17-96                 ........................................................................NPSAKDIKNILGS......V.G.I.E.AD.....D.ERLN..K.......V....I.S...E.......LN............G.K...DI.N.E.V.MN.A.GLSKLAsv.......................................pagGAVAVS..A.....A....A.......T......G......G....G..G....A...A..P....A......G...E....F.....K....T.K-...----...................-..-..---.........---..----ntkn..........................
M3HIT8_CANMX/17-108                    .......................................................................s-PAAADISALLES......V.G.V.E.VE.....E.SRLQ..L.......L....L.K...E.......LE............G.K...DL.Q.E.L.IA.E.GNTKFAs.........................................vpSGGAAA..S.....S....G.......A......A......A....A..S....G...A..A....A......T...E....E.....A....A.EE...EEEA..................kE..E..SDD.........DMG..FGLF..............................
A0A5N5FYC0_9ROSA/17-114                ........................................................................SPSAADLKDILGS......V.G.A.E.AD.....S.DKIE..L.......L....L.S...E.......VK............G.K...DI.T.E.L.IA.S.GREKLAsvps....................................gggaVAYSAP..A.....A....T.......G......G......G....G..A....A...A..P....A......A...A....E.....Q....K.KE...EKVEe.................kE..E..SDD.........DMG..FSLF..............................
A9V5U8_MONBE/22-104                    ........................................................................EVTDEKITTLLKT......A.G.V.E.FE.....P.YWPG..L.......F....A.K...A.......LA............G.K...DI.K.D.M.LS.N.VGSA--............................................--SAAP..A.....A....A.......A......A......P....A..A....A...A..E....E......K...K....E.....E....K.KE...ESE-...................-..D..EDE.........DMD.gFSLF..............................
RLA0_CHICK/231-315                     ........................................................................YPTIASVPHSIVN......G.Y.K.R.VL.....A.VAVE..T.......D....Y.T...F.......PL............A.E...KV.K.A.F.LA.D.PSAFVA............................................AAPVVV..E.....T....A.......A......P......A....A..A....A...A..P....A......K...E....-.....A....P.KE...ESE-...................-..E..SDE.........DMG..FGLF..............................
A0A2I3LSE1_PAPAN/20-98                 ..............................................................evtvtekina-------------......-.-.-.-.--.....-.---L..I.......K....A.A...G.......LA............N.V...NI.G.S.L.LC.N.VGAGGPa..........................................pAAGSAP..T.....G....A.......S......A......R....S..A....A...A..A....P......A...E....E.....K....K.VE...AKKEe.................sE..K..SDD.........DMG..FGLF..............................
W2QB22_PHYPN/231-311                   .......................................................................i-PTLASIPHSIAN......A.F.K.D.LV.....A.IAVE..C.......E...eF.S...F.......EK............A.E...PY.K.A.F.LA.D.PSAF--............................................---AVA..A.....P....A.......G......G......A....-..-....-...-..A....A......T...E....E.....K....K.EE...AVE-...................E..E..EEV.........DMG..GGM-dmf...........................
A0A6P5KV53_PHACI/15-87                 ....................................................................lydd-------------......-.-.-.-.--.....-.----..-.......D....V.T...A.......LS............N.V...NI.A.S.L.IC.N.VGVSGPa.........................................ptAGGAAP..A.....G....G.......V......S......P....A..S....S...A..A....P......A...E....V.....K....K.KE...EAEKe................esE..E..SND.........DMG..FGLF..............................
A0A553HKJ1_9PEZI/17-111                ........................................................................SPSAKDIKKVLDS......V.G.I.E.AD.....D.DRLE..T.......L....I.S...E.......LK............G.K...DI.N.E.L.IA.E.GSSKLAsvp......................................sggAGGAAA..A.....G....G.......G......A......A....A..G....G...A..A....A......V...E....E.....K....A.EE...KEEE..................kE..E..SDD.........DMG..FGLF..............................
A0A175W089_9PEZI/17-109                ........................................................................SPSAADIKALLES......V.G.I.E.AD.....D.ERLE..K.......L....L.S...E.......LD............G.K...DI.N.E.L.IA.E.GSTKLAsvp......................................sggGGGAAA..A.....G....G.......A......A......A....G..G....G...A..E....A......P...K....E.....E....E.KE...EEK-...................E..E..SDE.........DMG..FGLF..............................
A0A498JSZ6_MALDO/21-110                .......................................................................p-VTAEKIATLVKA......A.N.V.P.VD.....S.YWPS..L.......F....A.K...L.......AE............K.R...NI.E.D.L.VL.N.VGSGGA...........................................vSVAAPG..V.....A....E.......A......A......A....P..A....A...A..P....P......P...E....D.....K....K.KK...EEPE...................E..E..SDD.........DCP.iFDLF..............................
B9RNK0_RICCO/21-112                    .......................................................................p-ITAEKIAQLVKA......A.N.V.Q.IE.....S.YWPS..L.......F....A.K...L.......AE............K.R...NI.E.D.L.VM.N.VGSGGGgap......................................vavAAPAGG..A.....A....A.......G......G......A....A..A....A...-..A....P......P...P....E.....E....K.KE...EPQ-...................E..E..SDD.........DMG..FSLF..............................
A0A4Q9KTW3_9MICR/8-101                 ...............................................................ailsvagkp-VTEDSISKLFTV......VpG.K.E.CD.....K.EQVQ..L.......L....I.N...N.......IK............G.R...DY.N.S.I.KE.E.GSKKMSs..........................................fSSVSVQ..P.....S....A.......V......K......V....A..D....E...S..E....K......K...E....E.....A....E.AP...KEE-...................-..E..MD-.........---..----ldlfa.........................
A0A6P5MDL8_ARADU/57-144                .......................................stydlqrklvnavraadssgavqssfsfvspss-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...AV.F.Q.V.VV.G.GAVFVG............................................GGTVAA..A.....H....A.......G......G......A....V..A....E...S..A....A......P...G....A.....E....K.KE...EKVA...................E..E..EDE.........DFG..MLLF..............................
A0A166UK57_9PEZI/229-312               .......................................................................f-PTLPSVIHSFFN......S.Y.K.N.VL.....A.IAIE..T.......E....I.S...W.......PE............I.E...QL.K.D.R.IA.N.PDAY--............................................---ASA..A.....P....A.......A......A......A....G..G....A...A..E....A......K...E....E.....E....K.EA...EKSD...................E..E..SDE.........DGG.fGGLF..............................
A0A0F4YT67_TALEM/21-126                ........................................................................EITADKLNTLIKT......A.N.VpE.VE.....P.IWSQ..I.......F....A.K...A.......LE............G.K...DV.K.E.L.LT.N.VGSAGA...........................................aAPAAAA..A.....P....A.......A......G......G....A..A....P...E..A....A......A...E....E.....K....K.EE...KK-Keegknlpl..tmclfpaitE..E..SDE.........DMG..FGLF..............................
A0A3N4INN3_ASCIM/17-110                ........................................................................SPSASDIETVLSS......V.G.I.E.SD.....S.SRVE..S.......L....L.K...E.......LE............G.K...DI.Q.T.L.IA.E.GSQKLAsv.......................................psgGAGGAA..A.....S....S.......G......A......A....A..G....G...A..A....A......A...D....E.....K....V.EE...KEEE..................kE..E..SDD.........DMG..FGLF..............................
A0A4U5MP81_POPAL/21-108                ........................................................................SITSDKIATLVKA......A.N.V.T.VE.....S.YWPS..L.......F....A.K...L.......AE............K.R...NV.G.D.L.IM.N.IGGGGGg..........................................aAPVAVA..S.....S....G.......P......A......A....G..G....A...A..A....P......A...V....E.....E....K.KE...EAP-...................-..E..SDD.........DMG..FSLF..............................
A0A0V0R7S0_PSEPJ/29-108                .......................................................................d-ITADRLESILKA......S.N.V.A.TS.....A.ALSK..V.......F....A.R...A.......LE............G.K...DV.K.E.F.FA.G.GA----............................................-GGDAP..V.....Q....A.......Q......A......Q....G..Q....A...P..A....A......A...Q....E.....E....A.KP...EEP-...................-..E..EDM.........DMG..-GLF..............................
A0A1S3MIY2_SALSA/17-115                ........................................................................SPSSQNIKDILGS......V.G.I.E.AD.....D.QRLA..K.......V....I.S...E.......LM............G.K...DI.N.E.V.LN.A.GMSKLAsvpv....................................ggavAVSAAG..G.....S....A.......A......V......A....P..G....A...A..P....A......S...E....E.....K....K.KE...EEKKe................esE..E..SDE.........DMG..FGLF..............................
A0A6P7GGK6_DIAVI/231-314               ........................................................................YPTVASAPHSIAN......G.F.K.N.LL.....A.IAAV..T.......D....V.E...F.......KE............A.K...TI.K.E.Y.IK.D.PSKF--............................................AAAAAP..V.....A....A.......A......A......A....A..P....A...A..E....S......K...K....E.....E....K.KE...ESE-...................-..S..EDD.........DMG..LGLF..............................
A6R7C5_AJECN/21-109                    ........................................................................EVTADKLQTLLKA......A.N.VqD.VE.....P.IWST..L.......F....A.K...A.......LE............G.K...DV.K.D.L.LL.N.IGSGGG............................................AAAAVA..S.....G....A.......G......P......V....A..A....E...T..G....G......A...E....E.....K....V.EK...EEEK...................E..E..SDE.........DMG..FGLF..............................
A0A195FCE2_9HYME/231-317               ........................................................................YPTVASAPHSIVN......G.F.K.N.LL.....A.VAAV..T.......E....V.E...F.......AE............A.T...TI.K.E.Y.VK.D.PSKFAV............................................AAAAVV..T.....P....A.......A......A......A....A..D....A...P..A....A......E...K....K.....E....E.KK...EES-...................D..S..EDD.........DMG..FGLF..............................
A0A1B8G8I0_9PEZI/229-311               .......................................................................f-PTLPSVMHSVVN......S.Y.K.N.VL.....A.VAVS..T.......E....Y.S...W.......TE............I.E...EL.K.E.R.IA.N.PEKF--............................................--ASAT..V.....A....T.......T......S......D....A..P....K...A..A....A......A...E....E.....K....K.EE...SEA-...................-..E..ESG.........DEG.fGGLF..............................
A0A5J5C265_9ASTE/39-114                ...................................................elikkgdkgsvfnpevlnlte-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.E.D.L.IE.K.FAAGDPr.........................................kfVVVVAP..V.....-....A.......V......A......D....S..G....P...A..P....A......S...A....D.....K....K.KE...EEEI...................E..E..CDD.........DFT..GGLF..............................
A0A5N5GNX9_9ROSA/17-114                ........................................................................SPSAADLKDILGS......V.G.A.E.AD.....G.DKIE..L.......L....L.S...E.......VK............G.K...DI.T.E.L.IA.S.GREKLAsvps....................................gggaVAYSAP..A.....A....G.......G......G......G....G..A....A...A..P....A......A...A....E.....Q....K.KE...EKVEe.................kE..E..SDD.........DMG..FSLF..............................
A0A6J1DK62_MOMCH/34-119                ..................................lqrklvqtalavdssggvqssfsyisptsavfqviigg-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.GGGG-Gfi........................................sgGGAAAA..A.....P....S.......G......G......A....A..P....A...A..E....A......P...A....E.....K....K.EE...EK--...................E..E..SDD.........DLG..LSLF..............................
E2B864_HARSA/22-110                    .......................................................................a-VTGEKIQTILKA......A.N.V.N.VE.....S.YWPG..L.......F....A.K...A.......LE............G.I...NV.K.E.L.IT.N.IGSGVGa.........................................apAGAGAP..A.....A....A.......A......P......A....S..T....E...A..A....P......A...K....E.....E....K.KK...EEPE...................E..E..SDD.........DMG..FG--..............................
W9QTA2_9ROSA/17-115                    ........................................................................SPSAGDLKDILSS......V.G.V.E.PD.....E.GRIQ..L.......L....L.T...E.......VK............G.K...DI.T.E.L.IA.S.GREKLAsvpsg..................................ggavaYSAPAG..G.....A....G.......G......G......A....D..A....P...A..A....A......A...E....S.....K....K.EE...KVEE..................kE..E..SDD.........DMG..FSLF..............................
A0A6J2KK52_BOMMA/231-315               ........................................................................YPTIASAPHSIAN......G.F.K.N.LL.....A.IAAV..T.......E....V.E...F.......EE............A.T...TI.K.E.F.IK.D.PSKF--............................................AAVAAA..V.....A....P.......S......A......A....A..A....P...A..E....K......K...E....E.....K....K.EE...KEE-...................E..E..SDD.........DMG..FGLF..............................
A0A2K6CQT1_MACNE/17-114                ........................................................................SPSAKDIKKILDS......V.G.I.E.AD.....D.DRLN..K.......V....I.S...E.......LN............G.K...NI.E.D.V.IA.Q.GIGKLAsvpa....................................ggavAVSAAP..G.....S....A.......A......P......A....A..G....S...A..P....A......A...A....E.....E....K.KD...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A5N6KCC0_9HELO/44-132                .......................................................................d-ITADKLQTLIKA......A.G.IeD.VE.....P.IWTS..L.......F....A.K...A.......LE............G.K...DV.K.D.L.LL.N.VGSGG-............................................GAAPAA..A.....G....A.......A......A......G....G..D....A...A..A....P......A...E....E.....K....K.EE...KEEA..................kE..E..SDE.........DMG..FGLF..............................
A0A2I0TDM5_LIMLA/22-113                .......................................................................t-VTEDKINALIKA......A.G.V.N.VE.....P.FWPG..L.......F....A.K...A.......LA............N.I...DI.G.S.L.IC.N.VGAGGGg..........................................aPAAAAP..A.....G....G.......A......A......P....A..G....G...A..A....P......A...E....E.....K....K.EE...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A7N5JGY6_AILME/21-106                ........................................................................YPTVASVPHSIIN......G.Y.K.R.VL.....A.LSVE..T.......D....Y.T...F.......PL............A.E...KV.K.A.F.LA.D.PSAF--............................................VAAAPV..A.....A....A.......T......T......A....A..P....A...A..A....A......A...P....A.....K....V.EA...KEES...................E..E..SDE.........DMG..FGLF..............................
H0ZQZ1_TAEGU/22-113                    .......................................................................t-VTEDKINALIKA......A.G.V.N.VE.....P.FWPG..L.......F....A.K...A.......LA............N.I...DI.G.S.L.IC.N.VGAGGGg..........................................aPAAAAP..A.....G....G.......A......A......P....A..G....G...A..A....P......A...E....E.....K....K.EE...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A251S133_HELAN/1-51                  ...................................................................mnvga-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.GGGGGA............................................PAVAAP..G.....G....G.......G......G......A....A..A....A...A..A....P......P...P....E.....E....K.KE...EIE-...................E..E..SDD.........ELG..FGLF..............................
A0A1S3JLM9_LINUN/22-112                .......................................................................p-ITAEKISTILKA......A.D.Y.S.VE.....P.YWPG..L.......F....S.K...A.......LE............G.I...NI.K.D.L.IS.N.VGSSVGa..........................................aPAAGGA..A.....P....A.......A......G......D....A..G....A...G..A....A......K...E....E.....A....K.EE...KKEE..................sE..E..SDD.........DMG..FGLF..............................
A0A420I0K8_9PEZI/17-110                ........................................................................SPTEDDITKVLAS......V.G.V.E.PE.....K.ERVS..K.......L....L.S...E.......LE............G.K...DI.N.E.L.IA.A.GSAKLAsvp......................................sggAGGASA..G.....G....A.......A......A......A....G..G....A...V..A....E......E...K....S.....E....E.KE...EEKE...................E..E..SDE.........DMG..FGLF..............................
W1QEQ6_OGAPD/17-108                    ........................................................................SPSAADITALLES......V.G.A.E.IE.....Q.EKLN..L.......L....L.S...S.......LE............G.K...SV.E.E.L.IA.E.GATKLAs.........................................ipAGGAAP..A.....A....A.......G......A......A....A..S....G...A..A....A......E...E....A.....A....A.EE...EEAA..................eE..E..EDD.........DMG..FGLF..............................
A0A1R3KG69_COCAP/17-113                .......................................................................c-PSADDIKEILGA......V.G.A.E.AE.....N.DRIQ..L.......L....L.S...E.......VK............G.K...DI.T.E.L.IA.S.GREKLAsvps....................................ggggVAVAAA..A.....P....G.......G......G......G....G..A....A...P..A....A......A...E....S.....K....K.EE...KVEE..................kE..E..SDD.........DMG..FSLF..............................
W6QLH1_PENRF/21-106                    ........................................................................EVSADKIQTLITA......A.K.VqE.VE.....P.IWAS..I.......F....A.R...A.......LE............G.K...DI.K.D.L.LT.N.VGSA--............................................-GPAAA..A.....P....A.......G......G......A....A..A....A...A..P....A......E...A....K.....A....E.EK...EEEK...................E..E..SDE.........DMG..FGLF..............................
A0A1S2XL12_CICAR/234-320               ........................................................................YPTLAAAPHMFVN......A.Y.K.N.VL.....A.VAVA..T.......E....Y.S...F.......PE............A.D...KV.K.E.F.LK.D.PSKFAV............................................AAVATP..A.....A....D.......S......G......A....A..P....A...A..A....A......K...E....E.....E....K.KD...EPA-...................E..E..SDD.........DMG..FSLF..............................
A6UTF7_META3/16-98                     ........................................................................EITEDAVSAILSA......A.G.V.E.VV.....D.ARVK..A.......L....V.A...A.......LD............G.V...DI.E.E.A.IS.K.AAAA--............................................--PVAV..A.....A....A.......P......A......A....E..E....A...K..E....E......A...K....E.....E....K.KE...EE--...................-..N..SEA........aAAG.lGALF..............................
A0A509AJ86_PLABA/32-118                ........................................................................SITNENIVKLIKK......S.N.N.T.VL.....P.YLPM..L.......F....E.K...A.......LK............G.K...DI.E.G.L.LS.N.LSVG--............................................GGAPAA..S.....A....Q.......V......A......T....E..T....A...D..D....G......K...K....D.....S....K.KE...EKVE..................eE..E..EED.........DLG..FSLF..............................
A0A0F8XGE4_9EURO/229-312               ........................................................................YPTLPSVIHSVLN......S.Y.K.K.VL.....A.IAVE..T.......E....Y.S...W.......PE............I.E...EL.K.D.R.IA.N.PDAY--............................................AS-AAP..A.....A....A.......A......A......A....G..G....A...A..E....A......A...P....A.....A....A.PE...EPE-...................E..E..SDD.........DMG..FGLF..............................
A0A091UHF5_PHORB/17-114                ........................................................................SPTSKDLKKILDS......V.G.I.E.TD.....D.ERMN..K.......V....I.S...E.......LN............G.K...NI.E.D.V.IA.Q.GNGKLAsmpa....................................ggavAVSAGG..G.....S....A.......A......P......A....A..A....A...A..P....A......A...A....E.....E....K.KE...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A3Q7QHU1_CALUR/231-316               ........................................................................YPTVASVPHSIIN......G.Y.K.R.VL.....A.LSVE..T.......D....Y.T...F.......SL............A.E...KV.K.A.F.LA.D.PSAFVA............................................AAPAAA..A.....P....A.......S......A......P....A..A....T...A..A....P......A...K....V.....E....A.KE...ES--...................E..E..SDE.........DMG..FGLF..............................
A0A5E4GIK0_PRUDU/16-116                .................sakqhngdleasaastfelqrklvqtalstdssggvqtsyspvtptsavfqvivg-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.-----Gggg......................................afiGGGAAA..A.....T....G.......G......G......A....A..A....A...E..A....P......P...A....E.....E....K.KE...EKE-...................-..E..SDD.........DMG..FSLF..............................
A0A3P9MU45_POERE/169-251               ........................................................................YPTLASVPHSVIN......G.Y.K.R.VL.....A.VAVE..T.......D....Y.S...F.......PL............A.E...KV.K.A.Y.LA.D.PTAF--............................................AAVAAP..A.....A....V.......A......E......T....A..A....A...P..A....A......K...E....E.....V....K.EE...SE--...................-..E..SDD.........DMG..FGLF..............................
A0A6J5WP27_PRUAR/21-111                .......................................................................a-ITSEKIAALVRS......A.N.V.A.VE.....S.YWPS..L.......F....A.K...L.......AE............K.R...SL.E.D.L.IL.N.AGSGGCsa........................................pvTVAAAS..G.....G....A.......G......G......A....A..S....A...A..A....P......A...V....E.....E....K.KE...EPK-...................E..E..SDD.........DMG..FSLF..............................
A0A1U8LLR2_GOSHI/234-320               .......................................................................f-PTLAAAPHMFIN......A.Y.K.T.AL.....S.LAVA..T.......E....Y.T...F.......PQ............A.E...KI.K.E.Y.LK.D.PTKFAV...........................................aVGGDAA..A.....P....A.......T......S......A....K..E....E...K..A....E......Q...S....E.....P....A.KE...EE--...................E..E..SDE.........DLV..AGLF..............................
A0A2P8A5D0_9PEZI/17-111                .......................................................................t-PSASDIKEVLSS......V.G.I.E.AD.....G.DRLD..K.......L....I.S...E.......LE............G.K...DI.Q.E.L.IT.E.GSGKLAsvps....................................ggagGAAPAA..G.....G....A.......A......A......G....G..D....A...A..A....P......A...A....E.....A....A.KE...EEK-...................E..E..SDE.........DMG..FGLF..............................
A0A5C3EVH8_9BASI/17-111                ........................................................................SPSAADIKSLLET......V.G.I.E.AD.....S.ERLD..K.......L....I.S...E.......LQ............G.K...DI.N.Q.L.IA.E.GQEKLAsvpa....................................ggaaPAAAAG..G.....A....A.......A......A......A....G..G....A...A..E....E......K...K....E.....E....K.KE...EEK-...................E..E..SDD.........DMG..FGLF..............................
N4UH12_FUSC1/17-109                    ........................................................................SPSAADVKAVLES......V.G.I.E.AD.....D.ERLN..T.......L....I.S...E.......LE............G.K...DI.Q.E.L.IA.E.GSEKLAsvp......................................sggAGGAAA..G.....G....A.......A......A......A....G..G....A...A..E....E......A...K....E.....E....E.KE...EEK-...................E..E..SDE.........DMG..FGLF..............................
A0A643CHP5_BALPH/441-521               .......................................................................t-VTEDKINALIKA......A.G.V.N.VE.....P.FWPG..L.......F....A.K...A.......VA............G.V...SI.G.S.L.IC.G.AGQLLAhiiimfsnqig.....................llllellellfdK-----..-.....-....-.......-......-......-....-..-....-...-..-....-......-...-....-.....-....-.--...----...................-..-..---.........---..----fnavaaahsv....................
I3EIJ4_NEMP3/21-99                     .......................................................................t-VTEENIKKVADH......L.G.V.T.VD.....S.YLAE..L.......F....S.K...-.......LS............A.E...QI.Q.S.I.IE.N.PTGG--............................................---SVQ..A.....A....A.......A......T......S....T..Q....A...V..E....E......K...K....E.....E....K.EE...SEE-...................-..E..SSG.........DMD.lF---g.............................
A1C664_ASPCL/17-110                    ........................................................................SPSAADVKEVLSS......V.G.I.D.AD.....E.ERLN..K.......L....I.A...E.......LE............G.K...DL.Q.E.L.IA.E.GSTKLAsip......................................sggAGGAAP..A.....A....G.......G......A......A....A..G....G...A..A....E......A...A....P.....A....E.EK...EEEK...................E..E..SDD.........DMG..FGLF..............................
W0K3A8_9EURY/16-113                    .......................................................................e-LNEENITGVLEA......A.G.V.D.VE.....E.SRVK..A.......L....V.A...A.......LE............D.V...DI.E.E.A.VE.Q.AAAA--............................................PAAGAA..P.....A....G.......G......A......A....E..A....D...E..A....E......A...E....E.....A....D.EE...EPEAeaed..........egdddD..-..---.........---..----eeeeasgeglgdlf................
A0A151N9F0_ALLMI/43-117                ........................................................................SPTAKNIKKILSS......V.G.I.D.AD.....D.ERVD..K.......V....I.S...E.......LS............G.K...DV.D.D.V.IN.S.GLSKLTcv........................................paGGAVAA..A.....P....A.......A......P......A....G..G....G...A..A....P......A...E....-.....-....-.--...----...................-..-..---.........---..----ivde..........................
A0A1L0DN57_9ASCO/229-311               ........................................................................YPTLPSVGHSVVN......H.Y.K.N.VL.....A.LSIA..T.......D....Y.T...F.......EG............S.E...AI.K.D.R.LA.N.PEAY--............................................-AAAAP..A.....A....A.......A......A......G....G..D....S...S..A....A......A...E....D.....A....P.AE...EEE-...................-..E..SDD.........DMG..FGLF..............................
A0A1Q9E0V8_SYMMI/86-178                .......................................................................d-ITPASMSTLIKA......A.G.C.N.VE.....G.YWPM..I.......M....S.K...M.......VNsv........gvE.V...QL.Q.E.R.LG.S.GAGGGGgg........................................ggGGAAAG..A.....A....A.......G......G......A....G..G....G...E..A....K......A...E....E.....K....K.VE...EE--...................-..E..EEE.........EMD..FDLF..............................
A0A6P5M545_PHACI/231-316               ........................................................................YPTVASVPHSIIN......G.Y.K.R.VL.....A.VAVE..T.......E....Y.T...F.......PL............A.E...KV.K.A.F.LA.D.PSAF--............................................AVAAPA..A.....A....A.......P......A......A....T..V....P...V..A....A......A...P....A.....K....V.ET...KEES...................E..E..SDE.........DMG..FGLF..............................
M4EWV0_BRARP/63-153                    ........................................................................SITADKIATLIKS......A.G.V.S.CE.....S.YWPM..L.......F....A.K...M.......AE............K.R...NV.T.D.L.IM.N.VGAGGGgg........................................apVSAAAP..A.....A....G.......G......G......A....A..A....A...A..P....A......A...E....E.....K....K.KE...EVA-...................E..E..SDG.........DLG..FGLF..............................
A9S6G5_PHYPA/17-113                    ........................................................................SPSAKDIEAILGA......V.G.A.E.AD.....A.SRVS..L.......L....L.K...E.......LE............G.K...DI.L.E.V.IA.A.GKEKFAsvpsg..................................ggggvVVASGG..G.....S....S.......A......A......A....A..P....A...E..E....K......K...E....E.....A....K.KE...EEK-...................E..E..SDD.........DMG..FSLF..............................
A0A061GR04_THECC/18-120                .................kqlegelegsaasayelqrklvqcatavdssggvsssfslitpksavfqviiggg-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.--GGGGf.........................................lgGGAAAP..A.....G....G.......A......A......P....A..A....E...A..P....A......A...E....E.....K....K.KE...EKVE...................E..S..DDE.........DMG..FSLF..............................
A0A2K6GLN6_PROCO/22-113                .......................................................................t-VTEDKINALIKA......A.G.V.N.VE.....P.FWPG..L.......F....A.E...A.......LA............N.V...NI.G.S.L.IC.N.VGAGGPa..........................................pVAGAAP..A.....G....S.......P......A......P....S..T....A...A..A....P......A...E....E.....K....E.VE...AKKEe.................sE..E..SDD.........DMG..FGLF..............................
J7S764_KAZNA/229-312                   ........................................................................YPTLPSVGHTLIN......N.Y.K.N.LL.....A.VAIA..S.......G....Y.H...Y.......AE............I.E...EL.I.D.R.IE.N.PDKY--............................................AS-AAP..V.....A....A.......A......A......G....G..A....A...E..S....G......A...A....E.....E....A.AE...EEE-...................E..E..SDA.........DMG..FGLF..............................
A0A059BIC8_EUCGR/233-319               ........................................................................YPTLAAAPHMFIN......A.Y.K.N.VL.....A.VAVE..T.......E....Y.S...Y.......PH............A.D...EV.K.E.F.LK.D.PSKFAV............................................AVAPAG..A.....A....D.......S......G......A....A..P....A...A..A....A......K...E....E.....E....K.KD...EPA-...................E..E..SDD.........DMG..FSLF..............................
A0A0Q4B269_9ARCH/16-102                ........................................................................EITDDAIAAILSA......A.G.V.E.AD.....A.AKIK..A.......L....T.A...S.......LE............G.V...DI.K.E.A.IA.S.ASVM--............................................--AAPA..A.....G....A.......A......P......A....A..A....A...A..A....P......G...E....E.....K....K.EE...PEEEa.................vS..E..EEA.........AAG.lSALF..............................
A0A509AI60_PLABA/19-110                .......................................................................n-PGKKEIKNVLSA......V.N.A.E.VE.....E.EVLG..N.......L....L.D...S.......LK............G.K...SY.H.E.L.IS.E.GLKKLQnv........................................ggGAAAAA..A.....A....P.......V......A......G....D..T....G...D..S....K......K...E....E.....K....K.EE...KEEE...................E..E..EED.........DLG..FSLF..............................
A0A094GEC3_9PEZI/64-151                .......................................................................d-ITAEKLQTLIAA......A.K.VaD.VE.....P.IWTS..L.......F....A.K...A.......LE............G.K...DV.K.D.L.LL.N.VGSGGG............................................APAAGG..A.....A....A.......G......G......A....A..A....A...S..E....D......A...P....V.....E....E.KE...EEK-...................E..E..SDD.........DMG..FGLF..............................
A0A1J9PR42_9EURO/229-312               .......................................................................f-PTLPSVMHSVVN......S.Y.K.N.MI.....A.IAVE..T.......E....Y.G...W.......SE............I.E...EL.K.D.R.IA.N.PEAY--............................................---AVA..A.....P....T.......A......E......A....T..K....G...E..E....S......K...E....D.....T....K.KE...ESEA...................E..E..SED.........EGG.fGDLF..............................
A0A1U8JIR4_GOSHI/16-114                ..sakqlegeiessaastyelqrklvqaatacdssggvtssfsvvtpnsaafqvviggavggafiggxxxxx-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.------............................................------..-.....-....-.......-......X......A....A..A....A...E..A....P......A...A....E.....E....K.KE...EKE-...................-..E..SDD.........DMG..FSLF..............................
A0A5D2Z0J4_GOSMU/17-119                ..............akqlegeiessaastyelqrklvqaatacdssggvtssfsvvtpnsavfqvviggavg-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.-G---Af.........................................igGGGAAA..A.....P....A.......G......G......A....A..A....A...A..E....A......P...A....A.....E....E.KK...EEK-...................E..E..SDD.........DMG..FSLF..............................
I0YK96_COCSC/20-115                    ........................................................................SPSADDINKILGS......V.G.I.E.AD.....S.ERVD..A.......L....L.K...E.......LD............G.K...DI.A.E.V.IA.S.GVSKLAsvps...................................gggavAASGGG..G.....G....G.......G......G......G....G..G....A...E..A....A......K...E....E.....E....K.KE...EEE-...................E..E..EDE.........DMG..FSLF..............................
A0A6I8SKG2_XENTR/169-251               ........................................................................YPTVASVPHSVIN......G.Y.K.R.VL.....A.IAVE..T.......D....Y.S...F.......PL............A.D...KV.K.A.F.LA.D.PSAF--............................................-VVAAP..A.....A....D.......V......A......A....A..P....A...A..A....P......A...K....E.....E....K.QE...ESE-...................-..E..SDD.........DMG..FGLF..............................
RLA2_MOUSE/17-114                      ........................................................................SPSAKDIKKILDS......V.G.I.E.AD.....D.DRLN..K.......V....I.S...E.......LN............G.K...NI.E.D.V.IA.Q.GVGKLAsvpa....................................ggavAVSAAP..G.....S....A.......A......P......A....A..G....S...A..P....A......A...A....E.....E....K.KD...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
RLA2A_MAIZE/17-111                     ........................................................................SPSADDLTAILES......V.G.C.E.VD.....N.EKME..L.......L....L.S...Q.......LS............G.K...DI.T.E.L.IA.A.GREKFAsvp......................................cggGGVAVA..A.....A....A.......P......A......A....G..G....A...A..P....A......A...E....A.....K....K.EE...KVEE..................kE..E..SDD.........DMG..FSLF..............................
A0A2I0WBU6_9ASPA/18-108                .......................................................................p-ITAEKISTLVKA......A.K.I.S.VE.....S.YWAT..L.......F....A.K...L.......LE............K.R...SV.E.D.L.IL.S.VGSGGGg.........................................aaVAVATP..A.....A....G.......G......G......G....G..A....A...V..E....T......P...A....A.....E....E.KK...EEPK...................E..E..SDD.........DMG..FSLF..............................
R0HZN3_9BRAS/233-319                   ........................................................................YPTLAAAPHMFIN......A.Y.K.N.AL.....A.IAVA..T.......E....Y.T...F.......PQ............A.E...KV.K.E.F.LK.D.PSKF--............................................AVAVAA..V.....S....A.......D......A......G....G..G....A...Q..A....A......A...A....P.....K....V.EE...KKEE..................sD..E..EDY.........DGG..FGLF..............................
A0A1V6R9H6_9EURO/17-108                .......................................................................a-PSAADIKAVLSS......V.G.I.D.AE.....G.DRLD..K.......V....I.S...E.......LQ............G.K...DL.Q.Q.L.IA.E.GSTKLAsv.......................................psgGAGGAA..A.....P....A.......A......A......G....G..A....A...A..A....A......P...A....E.....E....K.EE...EK-E...................E..E..SDE.........DMG..FGLF..............................
L9KS94_TUPCH/44-138                    .....................................................................lrv----KDFKKILDS......V.G.I.K.TD.....H.NQLN..K.......V....I.S...E.......LN............G.K...NM.K.D.V.IA.H.GIGKLAafpl....................................awqwHSAALG..S.....A....A.......P......A......A....G..S....A...S..A....A......T...E....E.....E....K.VE...KGES...................G..K..SND.........DMG..FGLF..............................
A0A6A3DU44_9STRA/17-107                .......................................................................h-PTEHDVVRILHS......C.G.V.E.TD.....E.ARVA..A.......V....V.K...A.......ME............G.K...SV.E.E.V.IA.A.GSGKLAs.........................................fgS----A..A.....A....A.......P......A......A....G..G....A...A..A....A......G...G....E.....A....A.KV...EEKAv.................eE..E..EEI.........DMG..GGM-dmf...........................
A0A6J2X8N7_SITOR/17-111                .......................................................................s-PGSGDIEKILGS......V.G.I.E.AD.....G.EKLK..R.......V....I.S...E.......LN............G.K...SI.D.E.L.IA.Q.GREKLSsip.....................................agggGAAPAA..A.....A....G.......G......A......A....P..A....A...E..E....K......K...D....A.....K....K.EE...AKEE...................S..E..SDE.........DMG..FTLF..............................
A0A673X185_SALTR/17-116                ........................................................................SPSSQNIKDILGS......V.G.I.E.AD.....D.QRLA..K.......V....I.S...E.......LM............G.K...DI.N.E.V.LN.A.GMSKLAsvpv....................................ggavAVSAAG..G.....S....A.......A......V......A....P..G....A...A..A....A......S...E....E.....K....K.KE...EEEKke...............esE..E..SDE.........DMG..FGLF..............................
A0A383YW62_BALAS/19-94                 ................................................................devtvteg-------------......-.-.-.-.--.....-.----..L.......F....A.K...A.......LA............N.V...NI.G.I.L.IR.N.VGAGGPa..........................................pAGGPAP..A.....G....G.......P......A......P....S..I....T...A..A....P......A...E....E.....K....K.AE...AKEE...................EsgE..SHD.........GMC..FGLF..............................
A0A4D9A598_SALSN/25-119                ..........................................................eatgdcafslqrnl-----------VQ......A.A.L.S.AA.....S.GAVQ..S.......S....F.S...Y.......VT...........pK.S...AV.F.Q.V.IV.G.GGGGGAfv........................................ggGGAAAA..A.....S....G.......G......G......G....G..G....A...A..A....E......E...P....A.....A....A.KE...EEK-...................D..E..SDD.........DIG..MSLF..............................
A0A5N7BFX2_9EURO/16-107                .......................................................................a-PSAEDIKTVLSS......V.G.I.D.AD.....E.ERLQ..K.......L....I.S...E.......LE............G.K...DL.Q.Q.L.IA.E.GAEKLAtvp......................................tggAG-AAA..P.....A....A.......G......G......A....A..A....A...G..D....A......P...A....A.....E....E.KE...EEK-...................E..E..SDE.........DMG..FGLF..............................
A0A6A3NKD7_9STRA/231-311               .......................................................................l-PTLASIPHSIAN......A.F.K.D.LV.....A.IAVE..C.......E...eF.S...F.......EK............A.E...PY.K.A.F.LA.D.PSAF--............................................---AVA..A.....P....A.......G......G......A....A..A....A...V..E....K......K...E....E.....A....V.E-...----...................E..E..EEV.........DMG..GGM-dmf...........................
A0A095AN35_SCHHA/17-112                .......................................................................k-PTENDIKTVLNS......V.G.I.E.HD.....S.ERLD..K.......L....L.S...S.......IS............G.K...DI.P.Q.L.IA.E.GSTKLSsip.....................................ssgaVVSSAP..A.....A....A.......A......S......S....K..T....E...A..P....Q......E...V....K.....P....A.KV...EVKE..................eS..E..SDE.........DMG..FGLF..............................
A0A0P7XY39_SCLFO/22-112                .......................................................................t-VTEDKLNALIKA......A.G.V.T.VE.....P.FWPS..L.......F....A.K...A.......LA............S.V...DI.G.S.L.IC.S.VGAGGGa..........................................pVAAATG..A.....P....A.......A......A......A....A..G....A...A..P....A......E...E....E.....K....K.EE...KKEE..................sE..E..SDD.........DMG..FGLF..............................
A0A2H5PJT9_CITUN/20-102                .................................................................sglvefs-------------......-.F.F.T.SQ.....P.EKIA..T.......L....I.K...L.......FE............K.R...SA.D.E.L.YL.N.VGSGGAh.........................................laVAAPAV..A.....S....S.......G......L......G....G..A....A...L..A....A......A...V....E.....E....K.KE...ETK-...................E..E..SDD.........DMG..LSLF..............................
A0A0F4GXM4_9PEZI/17-110                ........................................................................SPSAEDIKGVLSA......V.G.I.E.AD.....E.ERLT..Q.......L....L.S...E.......LE............G.K...DI.N.E.L.IT.E.GSAKLAsvp.....................................sggaAAPAAG..G.....A....A.......A......G......G....A..A....A...T..E....A......A...P....E.....A....A.KE...EEK-...................E..E..SDE.........DMG..FGLF..............................
A0A3P8TTM0_AMPPE/17-113                ........................................................................NPEAKDIKKILES......V.G.I.E.AD.....D.TRLD..K.......V....I.S...E.......LK............G.K...NV.D.E.V.IA.T.GYGKLAsmpa....................................ggavAVASSA..A.....A....G.......S......G......G....A..A....A...P..A....A......A...E....E.....K....K.EE...KKEE..................sE..E..SDD.........DMG..FGLF..............................
S0E8J0_GIBF5/17-109                    ........................................................................SPSAADVKAVLES......V.G.I.E.AD.....D.ERLN..T.......L....I.S...E.......LE............G.K...DI.Q.E.L.IA.E.GSEKLAsvp......................................sggAGGAAA..G.....G....A.......A......A......A....G..G....A...A..E....E......A...K....E.....E....E.KE...EEK-...................E..E..SDE.........DMG..FGLF..............................
A0A4Q4X8C7_9PEZI/229-311               .......................................................................f-PTLPSVVHSFFN......G.Y.K.N.VV.....A.AAIE..I.......D....Y.S...W.......EA............I.E...QL.K.D.R.IA.N.PDAY--............................................-AAAAP..A.....A....A.......A......A......D....A..P....A...A..A....A......A...E....E.....K....K.EE...SEQ-...................E..S..EDE.........GFG..-GLF..............................
A0A2V3IZH6_9FLOR/17-106                ........................................................................SPSADDIKKILDS......A.G.V.D.YE.....D.DVLS..T.......V....M.S...Q.......LE............G.K...DI.M.E.V.ME.E.GKSKLAs.........................................vpSGGGAV..A.....A....G.......G......A......G....A..A....E...E..A....A......Q...E....E.....A....P.KE...ESE-...................E..E..EEE.........EMD..FDLF..............................
A0A5E8BG66_9ASCO/21-107                ........................................................................EITADNLLTLTKS......A.G.VtG.VE.....P.IWAQ..L.......F....S.K...A.......LN............G.Q...NI.L.E.L.LT.Q.FSAG--............................................GAGPAA..A.....G....P.......A......A......A....A..S....G...A..A....A......E...E....A.....A....E.EE...EEEK...................E..E..SDD.........DMG..FGLF..............................
A0A1Y2VIY1_9PEZI/229-312               .......................................................................f-PTLPSVIHSLVN......S.Y.K.K.VL.....A.VAIE..T.......E....Y.S...W.......PE............I.E...QL.K.D.R.IA.N.PEAY--............................................AS-AAP..A.....A....A.......A......A......E....T..S....T...A..A....A......A...E....E.....E....K.KE...ESE-...................-..E..ESG.........DEG.fGGLF..............................
A0A218NNM9_9ARCH/16-101                .......................................................................d-ISEQSMTEVIKA......A.G.L.T.PD.....E.AKVK..S.......V....V.E...S.......LK............G.V...DI.K.S.V.IE.N.AQSM--............................................QVAAAP..G.....K....A.......E......A......K....A..E....G...K..K....E......S...K....A.....E....A.KS...EAK-...................S..E..EEA.........AGG.lAGLF..............................
A0A4Y7QFM8_9AGAM/229-313               ........................................................................YPTIVSVSHTLVN......A.Y.K.N.LI.....S.IALV..T.......D....Y.S...F.......EG............A.E...KI.K.E.I.LA.N.PEAF--............................................AAAAAA..A.....A....P.......E......A......A....P..A....A...A..E....E......T...K....A.....E....E.KE...EEK-...................E..E..SDD.........DMG..FGLF..............................
E3S6K2_PYRTT/21-111                    .......................................................................d-ITADKLQSLIKA......A.N.IeD.VE.....P.IWTS..L.......F....A.K...A.......LE............G.K...DV.K.D.L.LL.N.VGSGGGa.........................................apAAGAAA..G.....A....A.......A......G......G....A..D....A...A..E....P......A...A....E.....E....K.KE...EEK-...................E..E..SDD.........DMG..FGLF..............................
A0A0V1K4Y5_TRIPS/231-318               ........................................................................YPTAASAPHMIAN......A.F.K.N.LL.....S.IAAV..T.......D....I.T...F.......KE............A.E...KL.K.E.Y.LA.D.PSKFA-............................................VAAAPA..A.....S....A.......A......A......A....P..K....A...E..K....E......D...S....S.....S....K.KE...EKVE...................E..E..SDE.........EEG.mGGLF..............................
A0A2K5JVY5_COLAP/231-317               ........................................................................YPTVASVPHSIIN......G.Y.K.R.VL.....A.LSVE..T.......D....Y.T...F.......PL............A.E...KV.K.A.F.LA.D.PSAFVA............................................-AAPVA..A.....A....T.......T......A......A....P..A....A...A..A....A......A...P....A.....K....V.EA...KEES...................E..E..SDE.........DMG..FGLF..............................
W7L7T8_9CREN/16-103                    ........................................................................EITEESLKNVLTA......A.G.V.Q.AD.....D.VRIK..A.......V....V.A...A.......LK............E.V...NI.D.E.V.LK.N.AAAM--............................................PVAAAP..A.....P....A.......A......T......E....E..K....K...E..A....K......E...E....K.....K....E.EE...EK-Kg.................pS..E..EEI.........AGG.lSSLF..............................
A0A094AE68_9PEZI/66-153                .......................................................................d-ITAEKLQTLITS......A.K.ViD.VE.....P.IWTS..L.......F....A.K...A.......LE............G.K...DV.K.D.L.LL.N.VGSGGG............................................APAAGG..A.....A....A.......G......G......A....A..A....A...T..E....D......A...P....A.....E....E.KE...EEK-...................E..E..SDE.........DMG..FGLF..............................
G8YFW0_PICSO/80-163                    ........................................................................EITSDNLLAVTKA......A.G.A.N.VE.....N.IWAD..V.......Y....A.K...A.......LE............G.K...DL.K.E.L.LF.S.FA----............................................AAAPAA..A.....P....A.......G......G......D....A..A....A...A..G....E......T...E....A.....A....K.EE...APAE...................E..E..SDE.........DLG..MGLF..............................
G3B9G8_CANTC/17-109                    .......................................................................a-PSASDVSSLLSA......V.N.A.D.VD.....E.ARIS..A.......L....L.K...E.......LE............G.K...DI.Q.E.L.IA.E.GNTKLAsv.......................................ptgGAAASS..G.....A....G.......A......A......A....G..G....A...A..A....A......E...E....E.....A....A.AE...EEEK...................E..E..SDD.........DMG..FGLF..............................
R9T4G7_METII/9-101                     ................................................................vlhaagka-VDEDAIANVLKS......A.G.V.E.PD.....A.AKIK..S.......L....T.A...S.......LE............G.V...NI.D.E.A.IA.S.AAIA--............................................PVAAAA..P.....A....A.......A......A......A....P..A....D...V..P....K......S...A....E.....E....E.KK...EEV-...................S..E..DEA.........AAG.lAALF..............................
A0A061FL90_THECC/234-319               ........................................................................YPTLAAAPHMFIN......A.Y.K.N.VL.....A.LAIA..T.......E....Y.S...F.......PQ............A.D...KV.K.E.Y.LA.D.PSKF--............................................AVAAAP..V.....A....A.......D......A......G....A..A....P...A..A....P......A...A....V.....E....E.KK...PEPE...................E..E..SDD.........DMG..FSLF..............................
Q5CR36_CRYPI/239-317                   ................................................................iptlpsar--------DGIIS......S.F.R.N.CV.....A.LGLD..V.......D....F.D...F.......PE............M.Q...AI.K.N.A.LA.N.PSSF--............................................VA-AST..A.....A....D.......N......T......T....A..V....G...A..S....A......P...-....-.....-....-.VE...EEE-...................-..E..EEG.........DLG..FSLF..............................
A0A1D1VXI9_RAMVA/22-113                .......................................................................a-VTGDKIQTLLKA......A.S.V.D.VE.....P.YWPD..L.......F....A.R...S.......LE............S.V...SL.K.E.L.VS.S.FGSAAPaa........................................apA-----..A.....A....A.......A......P......A....A..A....A...A..P....A......A...E....D.....K....G.KK...EDKKaa..............keeE..P..EDE.........DMG..FGLF..............................
A0A365T938_9EURY/16-114                ........................................................................EINEDNLTDVLDA......A.G.V.D.VE.....E.SRVK..A.......L....V.A...A.......LE............D.V...DI.E.E.A.VE.Q.AAAVPAgg.......................................aggAAGAAE..D.....G....A.......E......E......G....G..E....E...E..A....A......E...E....E.....E....A.AE...EEEAg................ddD..E..EDD.........ASG..EGL-gelf..........................
A0A0V1PJV9_9BILA/22-119                ........................................................................NPEVADLKKIITS......A.T.D.E.FD.....E.SKAK..M.......V....V.D...S.......CK............G.N...DL.L.K.L.IA.E.GATKLSsvpsg.................................pavatgGASVAA..D.....A....A.......A......P......A....A..T....E...S..S....K......K...E....D.....S....K.KK...EES-...................E..E..EDE.........DMG..FGLF..............................
RLA2_BRUMA/18-113                      ........................................................................SPSAKDIEDVLGS......V.G.L.D.VD.....M.EDAN..K.......V....V.S...A.......LS............G.K...SI.D.E.V.IT.A.GLAKVSsv.......................................psdAAVSAI..A.....P....V.......V......S......A....T..P....T...D..A....L......Q...A....G.....S....K.KG...ETKEg................pkE..E..SDE.........DMG..FGLF..............................
A0A663ETR5_AQUCH/17-114                ........................................................................SPTSKDLKKILDS......V.G.I.E.TD.....D.ERMN..K.......V....I.S...E.......LN............G.K...NI.E.D.V.IA.Q.GNGKLAsmpa....................................ggavAVSAGG..G.....S....A.......A......P......A....A..A....A...A..P....A......A...A....E.....E....K.KE...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A5N6KII1_9HELO/17-108                ........................................................................SPSAKDITSVLES......V.G.I.E.VD.....N.ERLD..T.......L....I.K...E.......LD............G.K...DI.N.E.L.IT.E.GSSKLAsvp......................................sggAGGAAP..A.....A....G.......G......A......A....A..A....G...G..A....A......A...E....E.....K....A.EE...KAE-...................-..-..---.........---..----gtffhldtdet...................
RLA2_CAEEL/17-106                      ........................................................................SPSAQDVLKVLEA......G.G.L.D.CD.....M.ENAN..S.......V....V.D...A.......LK............G.K...TI.S.E.V.IA.Q.GKVKLSs.........................................vpSGGSAP..A.....A....A.......A......P......S....G..G....A...A..P....K......A...E....E.....K....K.KE...EPK-...................E..E..SDD.........DMG..FGLF..............................
A0A3S3PYQ8_9ACAR/238-320               ........................................................................YPTVASVPHSIVN......G.L.K.N.LI.....A.VAVE..T.......D....I.S...F.......KE............A.E...TA.K.E.Y.LK.D.PSKF--............................................AA-IAA..A.....A....A.......P......A......A....E..E....K...K..E....E......K...K....E.....E....K.KE...ES--...................E..E..SDE.........DMG..FDLF..............................
A0A5E8B597_9ASCO/229-310               ........................................................................YPTLPAVSHSIIN......H.Y.K.N.VL.....A.LSIA..T.......E....Y.T...F.......EG............S.E...AI.K.D.R.IA.N.PDAY--............................................-AAAAP..V.....A....A.......A......A......A....E..T....S...A..-....A......A...E....E.....A....P.AE...EEE-...................-..E..SDD.........DMG..FGLF..............................
A0A124SFA5_CYNCS/126-213               ........................................................................YPTIAAAPHMLIN......A.Y.K.N.AL.....A.IAVE..T.......D....Y.S...F.......PL............A.D...KV.K.E.Y.LE.D.PSKFAV............................................AAPVAA..S.....S....G.......G......G......A....P..A....A...A..A....S......A...P....A.....E....E.KK...EEPA...................E..E..SDD.........DMG..FSLF..............................
H3GGS5_PHYRM/27-114                    ........................................................................EITPESINHILHA......S.G.N.E.VE.....P.YWPN..L.......F....S.S...L.......LS............K.E..gKV.I.E.I.IS.T.GGAAAG............................................GAAAAS..G.....A....A.......A......G......A....A..G....A...E..A....A......K...E....E.....E....K.AV...E---...................E..E..EEV.........DMG..GGM-dmf...........................
F0YQD0_AURAN/17-110                    ........................................................................SPTAADVKAVIEA......A.G.G.T.AD.....E.EQLT..A.......L....C.A...A.......ME............G.K...SF.A.E.M.CA.A.GMEKIKdvp......................................mggGGGGGG..G.....G....G.......G......G......G....G..G....G...A..A....P......A...E....E.....E....K.KE...EEE-...................-..E..EEI.........DMG..GGM-dmf...........................
A0A1S7HUC7_9SACH/17-109                .......................................................................k-PSARDIKHVVES......I.G.V.E.AE.....D.SRIE..S.......L....L.S...S.......LE............G.K..tSL.N.E.L.IA.E.GQQKLAsv.......................................pagGVGSAG..A.....A....G.......A......T......G....A..A....G...G..E....E......A...E....E.....E....A.KE...EAK-...................E..E..SDD.........DMG..FGLF..............................
A0A0F7IG78_9EURY/16-105                ........................................................................EITEENVKAVLEA......A.G.I.E.VN.....E.ARVK..A.......L....V.A...A.......LE............G.V...DI.D.E.A.IS.K.AAFAPA............................................VAAPAA..A.....A....A.......P......A......E....A..G....A...A..E....E......K...A....E.....E....A.KE...EEEE..................qK..E..EEA.........LEG.lGALF..............................
A0A6P4YAR9_BRABE/17-113                ........................................................................NPSAGDIKKILGS......V.G.I.D.AD.....D.ERLN..K.......V....I.S...E.......LK............G.K...DI.E.E.V.MA.A.GRGKLSsmp.....................................sgggVAVAAG..G.....G....G.......A......A......A....G..G....A...A..P....A......A...E....E.....K....K.EE...KKEEs.................eE..E..SDE.........DMG..FGLF..............................
A0A4S4EPU0_CAMSI/17-109                .......................................................................c-PSADDLNNILNS......V.G.A.E.AD.....D.DKIE..L.......L....L.S...E.......VK............G.K...DI.T.E.L.IA.S.GREKLAsvp.....................................sgggGAIAVT..S.....Y....G.......G......G......A....A..A....A...A..P....A......A...A....E.....P....K.KE...EKVEe.................kE..E..SDD.........---..----fsl...........................
A0A4P1RAG9_LUPAN/17-114                ........................................................................NPSAKDIKNILAS......V.G.A.E.AD.....D.DRIE..L.......L....L.S...E.......VK............G.K...DI.E.D.I.IA.S.GREKLAsvps...................................gggavAVAAAP..G.....R....G.......-......S......G....G..G....A...A..P....A......A...A....E.....A....K.KE...EKVEe.................kE..E..SDD.........DMG..FSLF..............................
W2QPS0_PHYPN/27-114                    ........................................................................EITSDSIQQVVNA......S.G.N.E.VE.....P.YWPT..L.......F....A.S...L.......LS............K.E..gKV.L.E.L.IS.T.GGAAAG............................................GAAAAP..G.....A....A.......A......G......A....A..G....A...E..E....E......K...V....E.....E....K.AK...EE--...................-..E..EEA.........DLG..GGM-dmf...........................
A0A1J8QY12_9AGAM/30-119                ........................................................................EITADKILALTNA......A.S.V.E.LE.....P.IWAS..L.......L....A.K...A.......LE............G.K...NV.K.D.L.LS.N.VGAGGGg.........................................paVGAPAA..A.....A....A.......G......G......A....P..A....A...E..A....P......K...E....E.....E....K.KE...EAK-...................E..E..SDD.........DMG..FGLF..............................
A0A2V5GSV4_ASPV1/21-106                ........................................................................EVTADKLQTLISA......A.K.VpE.IE.....P.IWTS..I.......F....A.K...A.......LE............G.K...DI.K.D.L.LT.N.VGSG--............................................-GPAAA..A.....P....A.......A......A......A....G..G....A...A..A....P......A...E....A.....A....E.EK...EEEK...................E..E..SDE.........DMG..FGLF..............................
A0A260ZCD4_9PELO/17-106                .......................................................................d-PKADDLKKILSS......V.G.I.D.AD.....A.EKVD..S.......V....V.A...A.......LK............G.K...NL.A.E.V.IT.E.GKAKIAs..........................................vPSGGAP..A.....A....S.......S......A......A....P..A....A...A..A....A......D...T....K.....A....A.KK...EEPK...................E..E..SDD.........DMG..FGLF..............................
A0A2P5I356_9PEZI/229-312               ........................................................................YPTLPSVMHSFVN......G.Y.K.N.VV.....S.VALE..T.......E....F.S...W.......PE............I.D...EL.K.D.R.IA.N.PDAY--............................................-AAAAP..A.....A....G.......A......A......D....S..G....A...A..A....P......A...A....E.....E....K.KE...EEE-...................E..E..EDD.........DMG..FGLF..............................
A0A3P7DZS8_WUCBA/189-250               ....................................................................fysv-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.IT.A.GLAKISsvps...................................ggavsTIAPVV..S.....A....T.......P......T......S....A..L....Q...A..E....S......K...K....E.....E....K.KE...EPK-...................E..E..SDE.........DMG..FGLF..............................
A0A026VZT8_OOCBI/231-316               ........................................................................YPTVASAPHSIAN......G.F.K.N.LL.....A.IAAV..T.......E....V.E...F.......TE............A.A...TI.K.E.Y.IK.D.PSKF--............................................AVAAAS..V.....A....A.......P......A......A....A..A....D...A..P....A......A...E....K.....K....E.EK...KEES...................E..S..EDE.........DMG..FGLF..............................
A0A024XF36_PLAFC/19-111                ........................................................................NPSTKEVKNVLGA......V.N.A.D.VE.....D.EVLN..N.......F....I.D...S.......LK............G.K...SC.H.E.L.IT.D.GLKKLQni........................................ggGVAAAP..A.....G....A.......A......A......V....E..T....A...E..A....K......K...E....D.....K....K.EE...KKEE..................eE..E..EED.........DLG..FSLF..............................
A0A0V0YPL7_9BILA/17-70                 .......................................................................k-PSANDLKHILGS......V.G.A.D.AD.....D.ERID..L.......L....L.S...Q.......VK............G.K...DI.T.E.L.IA.A.GREKFA............................................SV----..-.....-....-.......-......-......-....-..-....-...-..-....-......-...-....-.....-....-.--...----...................-..-..---.........---..----psggg.........................
A0BDW7_PARTE/34-121                    .......................................................................d-IDATKLAKIIKA......S.N.L.R.VE.....P.IWTK..V.......F....E.K...A.......LK............G.K...KV.G.D.L.LH.G.SSGSASs.........................................apQTQTTS..T.....P....A.......A......A......E....T..K....K...A..E....P......V...K....E.....V....K.KA...EEP-...................-..E..EDV.........DMG..-GLF..............................
A0A1X2J0Q3_9FUNG/17-108                ........................................................................EPSAEDITKLLGS......V.G.V.E.GD.....Q.ARLT..S.......L....L.K...A.......LE............G.K...TV.E.E.V.IA.E.GSSKLAsv.......................................ssgPAAGAA..A.....G....A.......A......A......G....G..A....A...A..D....A......P...A....E.....E....A.KE...EEK-...................E..E..SDD.........DMG..FGLF..............................
A0A1E4RSB0_9ASCO/17-105                ........................................................................SPSAADIKSVLES......V.S.I.E.VD.....D.EKIA..K.......L....L.G...E.......VE............G.K...NA.E.E.L.IA.E.GNEKLSs.........................................vpAGAPAG..A.....A....A.......A......A......G....G..A....A...E..E....A......A...E....E.....A....A.PE...AA--...................E..E..SDD.........DMG..FGLF..............................
L1I8D2_GUITC/1-95                      ........................................................................-PSAEDVKKLLNS......V.G.A.K.AD.....D.SSIN..F.......V....V.K...E.......LN............G.K...KL.D.E.V.IA.A.GNLKMAsvggg..................................sggggGGGAAA..P.....A....A.......A......A......A....A..P....A...A..G....G......K...A....A.....A....K.KE...PEP-...................-..E..EEE.........DMG..FSLF..............................
A0A1V1SUP7_9FUNG/17-110                ........................................................................SPSAADVKKVLDS......V.G.I.E.AD.....D.ERLE..K.......L....I.S...E.......LE............G.K...DI.N.E.L.IA.E.GSSKLAsv.......................................psgGAGGGA..A.....A....G.......G......A......A....A..G....G...A..A....A......A...E....E.....K....A.EE...KEEE..................kE..E..SDD.........DMG..FGLF..............................
A0A6J2PRD0_COTGO/17-116                ........................................................................SPSAKDIKAILGS......V.G.I.E.AD.....D.ERLN..K.......V....I.R...E.......LN............G.K...DL.N.E.V.MN.S.GLSKLTsvpag.................................gavaapAAAAAG..A.....A....A.......A......G......A....A..A....T...P..A....A......A...E....E.....K....K.EE...KKEE..................sE..E..SDE.........DMG..FGLF..............................
A0A507FI07_9FUNG/17-111                .......................................................................t-PSAKDIKKILSS......V.G.I.E.AE.....D.SRIE..N.......L....L.S...E.......LE............G.K...NI.A.D.I.IA.E.GTKKMAslp.....................................aggaAAPAAA..G.....A....A.......A......P......A....A..G....G...A..A....A......A...A....P.....K....K.EE...KEEK...................E..E..SDD.........DMG..FGLF..............................
A0A2B7XFY1_9EURO/21-109                .......................................................................d-VTSDKLQSLLKA......A.D.IqD.VE.....P.IWSS..L.......F....A.K...A.......LE............G.K...DV.K.D.L.LL.N.VGSGGG............................................AAPAAG..G.....A....A.......P......V......A....A..E....A...G..G....A......E...E....K.....K....E.EK...EEEK...................E..E..SDE.........DMG..FGLF..............................
A0A0A2L9T9_PENIT/17-107                .......................................................................a-PSSADIKAVLSS......V.G.I.D.AE.....G.DRLE..K.......V....I.S...E.......LQ............G.K...DL.Q.E.L.IS.E.GSAKLAsv.......................................psgGAGAAA..P.....A....A.......A......A......A....G..G....A...A..A....P......A...E....E.....K....V.EE...KE--...................E..E..SDE.........DMG..FGLF..............................
A0A6J1CGB2_MOMCH/21-110                .......................................................................a-ITAEKIAAVVAA......A.G.L.C.VE.....S.YWPS..L.......F....A.K...L.......AE............K.R...NI.G.D.L.LL.N.VGCGGGaa........................................apVSVAAP..A.....G....G.......A......A......A....S..A....A...A..P....A......V...E....E.....K....-.KE...EPK-...................E..E..SDD.........DMG..FSLF..............................
A0A6P5ZUY5_DURZI/234-321               ........................................................................YPTLAAAPHMFVN......A.Y.K.N.AL.....S.VAVA..S.......D....Y.S...F.......PQ............A.E...KV.K.D.Y.LK.D.PSKF--............................................AV-AAT..A.....A....A.......A......A......P....T..S....S...A..A....N......K...E....N.....V....E.QS...EEPKd................veE..E..SDE.........DLV..AGLF..............................
A0A672UCN0_STRHB/231-317               ........................................................................YPTIASVPHSIVN......G.Y.K.R.VL.....A.VAVE..T.......D....Y.T...F.......PL............A.E...KV.K.A.F.LA.D.PSAFAAa..........................................iPV--VA..E.....A....A.......A......P......A....A..A....A...A..A....A......P...A....K.....E....A.AK...EES-...................E..E..SDE.........DMG..FGLF..............................
A0A183W8R7_TRIRE/17-114                ........................................................................NPTESDLKSVLNS......V.G.I.E.HD.....S.EKLS..S.......V....M.S...S.......LS............G.K...DI.T.Q.L.IA.E.GSKKISsvpa...................................agavaSAPAQS..A.....P....A.......A......A......A....K..T....E...A..P....K......E...S....K.....P....A.KE...EVKE..................eS..E..SEE.........DMG..FGLF..............................
A0A1E3PRK0_9ASCO/229-310               ........................................................................YPTLPAVGHSIIN......H.Y.K.N.VL.....A.LSIA..T.......E....Y.T...Y.......EG............S.E...SV.K.D.R.LA.N.PEAY--............................................-AAAAP..A.....A....A.......A......A......S....G..S....S...E..A....A......A...E....A.....A....V.EE...EE--...................-..E..SDD.........DMG..FGLF..............................
A0A2H0ZCD7_CANAR/50-139                .......................................................................a-PSAADIKKVLES......V.S.I.E.VE.....D.EKVD..Q.......L....L.A...E.......VD............G.K...NV.E.E.L.IA.E.GTEKLSa..........................................vPTGAPA..A.....S....G.......A......A......A....G..G....A...A..P....E......A...A....A.....E....E.KE...EEAA...................E..E..SDD.........DMG..FGLF..............................
K8EDG0_9CHLO/232-314                   ........................................................................YPTLAAVPHYIVN......S.Y.K.N.VL.....A.ISIG..T.......E....Y.T...F.......EL............A.Q...KV.K.D.Y.LA.D.PSAF--............................................QSAGGG..G.....G....G.......G......G......G....G..D....K...P..A....A......A...A....A.....A....P.VE...EE--...................-..E..EEE.........DMG..FDLF..............................
D7EAE2_METEZ/16-105                    .......................................................................d-ITEDTVKNVLDA......A.G.I.E.VD.....D.ARVK..A.......L....V.A...A.......LE............D.V...DI.E.E.A.MS.Q.AAFAAP............................................AAGGSS..P.....S....G.......E......S......G....G..A....A...E..E....S......A...A....E.....E....K.EE...EEE-...................E..E..SEEs.......gMAG.lGALF..............................
Q22XR4_TETTS/108-197                   .......................................................................a-ITVDNINKVLTK......A.K.VqN.VE.....K.YLPK..L.......Y....V.S...N.......IT............P.A...VI.A.S.T.IA.N.GGSSSS............................................GSAPAA..A.....A....V.......A......K......E....A..P....K...E..E....K......K...A....E.....V....K.EE...KKAE..................kE..P..EED........lDMG..-DLF..............................
A0A4X2LAL2_VOMUR/21-113                .......................................................................t-VTEDKINALIKA......A.G.V.N.VE.....P.FWPV..L.......L....A.K...A.......LS............N.V...SN.A.S.L.IC.N.VGVGGPa.........................................paAGGAAP..A.....G....G.......A......A......P....A..S....T...A..D....P......T...K....K.....K....K.EE...AKKEe.................sK..E..SDD.........DMG..FGLF..............................
G4T639_SERID/17-115                    ........................................................................SPSADDIKKLLST......V.G.I.D.AD.....E.DRLT..S.......L....M.S...A.......LE............G.K...SI.D.E.L.IS.A.GSSKLSsvpsg..................................gggggAVAAAS..G.....G....G.......G......A......A....G..G....G...A..A....P......A...E....E.....K....A.EE...KKEE..................kE..E..SDD.........DMG..FGLF..............................
RL10_THEKO/232-339                     ........................................................................YPTKQTIEAILQK......A.Y.L.-.-G.....A.KNVA..V.......E....A.G...Y.......IT............K.D...TV.E.D.I.FG.R.AIRAVLliaqnlpedl.......................ldektkellnaQ-AQMA..V.....A....A.......A......P......Q....P..T....E...E..K....V......E...E....A.....E....E.EE...EEEE..................aS..E..EDA.........LAG.lGALF..............................
B8D5P6_DESA1/16-106                    ........................................................................EISEENVKKVLEA......A.G.V.E.VD.....E.VRVK..S.......L....V.T...A.......IK............N.I...DI.A.K.V.LE.Q.ASVAPV...........................................aAAPVQA..A.....P....A.......A......A......P....A..G....E...E..K....K......G...G....E.....E....K.KE...ESK-...................E..L..SEEa.......lSEG.fSALF..............................
A0A0E0MTI5_ORYRU/53-118                ........................................................ssfamvspssavfqvi-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.IG.A.VGGGAA...........................................iGGAAAG..G.....A....A.......A......G......G....A..A....A...E..A....P......K...A....E.....E....K.KE...EEK-...................E..E..SED.........DLG..FSLF..............................
A0A2H3IC99_9EURO/229-312               ........................................................................YPTLPSVMHSLVN......S.Y.K.K.VL.....A.VAIE..T.......D....F.S...W.......PE............I.E...EL.K.D.R.IA.N.PEAY--............................................AAAAPV..A.....A....A.......A......T......G....G..E....A...A..P....A......A...A....E.....E....K.EE...SEE-...................E..S..GDE.........GFG..-GLF..............................
J8Q3S6_SACAR/17-109                    ........................................................................SPSVADIKSVIES......V.G.A.E.AD.....E.ARIN..E.......L....L.S...S.......LE............G.K..gSL.E.E.I.IA.E.GQKKFAsa.......................................paaGSSAGA..A.....G....A.......A......G......A....A..A....G...G..D....A......A...E....E.....E....K.EE...EA-K...................E..E..SDD.........DMG..FGLF..............................
RLA4_YEAST/17-109                      .......................................................................a-PSAADIKAVVES......V.G.A.E.VD.....E.ARIN..E.......L....L.S...S.......LE............G.K..gSL.E.E.I.IA.E.GQKKFAtv.......................................ptgGASSAA..A.....G....A.......A......G......A....A..A....G...G..D....A......A...E....E.....E....K.EE...EAK-...................E..E..SDD.........DMG..FGLF..............................
#=GR RLA4_YEAST/17-109           SS    .......................................................................X-XXXXXXXXXXXX......X.X.X.X.XX.....X.XXXX..X.......X....X.X...X.......XX............X.X..XXX.X.X.X.XX.X.XXXXXXXX.......................................XXXXXXXXX..X.....X....X.......X......X......X....X..X....X...X..X....X......X...X....X.....X....X.XX...XXX-...................X..X..---.........S--..XXXX..............................
A0A0M9G2S6_9TRYP/238-325               .......................................................................i-PTPATIGHMVVD......A.F.K.N.LL.....A.ISVA..T.......S....Y.E...F.......EEh..........nG.K...EL.R.E.A.AI.N.GTLA--............................................GAGGAA..E.....E....A.......A......A......A....P..A....A...A..A....G......G...A....A.....A....K.KE...ETE-...................E..D..EEE.........DFG.mGGLF..............................
A0A1S7H870_9SACH/20-106                ........................................................................EISSDKLLTLTNA......A.N.V.P.VE.....G.IWAD..I.......F....S.R...A.......LE............A.Q...NL.K.D.L.LV.N.FSVGAS............................................VGGVAG..V.....A....G.......G......A......G....G..E....A...A..G....E......G...E....E.....E....K.EE...EAK-...................E..E..SDD.........DMG..FGLF..............................
A0A319DG01_9EURO/229-311               ........................................................................YPTLPSVMHSLIN......G.Y.K.K.VL.....A.VAVE..T.......E....I.S...W.......PE............I.E...EL.K.D.R.IA.N.PDAY--............................................-AAAAP..A.....A....A.......A......A......P....A..A....G...G..D....A......P...A....K.....V....E.EE...EA--...................D..E..SDD.........DMG..FGLF..............................
A0A024TZ76_9STRA/29-112                ........................................................................EVSADNLNEALSA......A.G.V.T.VP.....A.YLPT..L.......Y....A.N...A.......VE...........rG.L...KV.S.K.A.LA.G.PSAG--............................................-GAAAP..A.....P....A.......A......G......A....A..G....A...A..A....P......K...K....E.....E....K.KE...EEE-...................-..E..ADL.........GGG..MDMF..............................
A0A553PX30_9TELE/22-112                .......................................................................t-VTEDKLNALIKA......A.G.V.T.IE.....P.FWPG..L.......F....A.K...A.......LS............S.V...DI.G.S.L.IC.N.VGAGGG............................................AAPAAG..A.....G....T.......A......A......P....S..G....G...D..A....P......A...K....E.....E....E.KK...EEKKe................esE..E..SDD.........DMG..FGLF..............................
L9KM63_TUPCH/231-323                   ........................................................................YPTVASVPHSIIN......G.Y.K.R.VL.....A.LSVE..T.......D....Y.T...F.......PL............A.E...KV.K.R.S.YR.E.HSQGLLdpp......................................alvPAAPVA..A.....A....T.......T......A......A....P..A....A...A..A....A......P...A....K.....V....E.AK...EES-...................E..E..SDE.........DMG..FGLF..............................
A0A1U8AI74_NELNU/21-110                .......................................................................p-VTPEKIATLVKS......A.N.V.S.VE.....S.YWPS..L.......F....S.K...L.......AE............K.R...NI.E.D.L.IM.N.AGSGGGg.........................................apVAVSAP..A.....G....G.......G......G......A....A..A....D...A..A....P......A...A....E.....E....K.KE...EPK-...................E..E..SDD.........DMG..FSLF..............................
W2ZH53_PHYPR/231-311                   .......................................................................i-PTLASIPHSIAN......A.F.K.D.LV.....A.IAVE..C.......E...eF.S...F.......EK............A.E...PY.K.A.F.LA.D.PSAF--............................................---AVA..A.....P....A.......G......G......A....-..-....-...-..A....A......T...E....E.....K....K.EE...AVE-...................E..E..EEV.........DMG..GGM-dmf...........................
K6VAU9_PLACD/32-118                    ........................................................................SITSENIVKLIKK......S.N.N.T.VL.....P.YLPM..L.......F....E.K...A.......LK............G.K...DI.E.G.L.LS.N.LSVG--............................................GGAPAA..A.....A....Q.......A......A......A....D..K....P...S..D....D......K...K....E.....A....K.KE...EKVE..................eE..E..EED.........DLG..FSLF..............................
A0A0C3JZ86_PISTI/229-311               ........................................................................YPTIVSVMHSLVN......S.Y.K.N.LI.....A.VALA..T.......D....Y.T...F.......EG............A.E...KA.K.A.F.LE.N.PEAF--............................................-AVAAA..P.....A....A.......E......E......A....A..P....A...A..A....A......E...E....E.....K....P.AE...KEE-...................-..E..SDD.........DMG..FGLF..............................
A0A4Q4VAN5_9PEZI/21-110                ........................................................................EITADKLQTLIKA......A.N.VtD.VE.....P.IWTS..L.......F....A.K...A.......LE............G.K...DV.K.D.M.LL.N.VGSGG-............................................GAAAAP..A.....A....G.......G......A......A....A..G....G...D..A....A......A...E....T.....K....E.EK...KEEEa.................aE..E..SDE.........DMG..FGLF..............................
RLA1_HUMAN/22-113                      .......................................................................t-VTEDKINALIKA......A.G.V.N.VE.....P.FWPG..L.......F....A.K...A.......LA............N.V...NI.G.S.L.IC.N.VGAGGPa..........................................pAAGAAP..A.....G....G.......P......A......P....S..T....A...A..A....P......A...E....E.....K....K.VE...AKKEe.................sE..E..SDD.........DMG..FGLF..............................
#=GR RLA1_HUMAN/22-113           SS    .......................................................................----HHHHHHHHHH......H.T.-.-.--.....T.HHHH..H.......H....H.H...H.......TT............T.S...-C.G.G.G.GT.T.TT-----..........................................-------..-.....-....-.......-......-......-....-..-....-...-..-....-......-...-....-.....-....-.--...---S-.................-S..-..-S-.........--S..-S--..............................
A0A544ZX35_9PEZI/21-107                ........................................................................EITADKLQTLIKA......A.G.ItD.VE.....P.IWTS..L.......F....A.K...A.......LE............G.K...DV.K.D.L.LT.N.VGSAGA............................................AAPAAA..G.....G....A.......A......A......A....A..G....G...D..A....P......A...E....E.....A....K.EE...EK--...................E..E..SDE.........DMG..FGLF..............................
A0A2K5KWB2_CERAT/186-268               .....................................................................pvt-----SVPHSIIS......G.Y.K.G.GL.....V.LSVE..T.......D....Y.T...F.......PP............A.E...KI.M.T.F.LA.D.PSAF--............................................VATAPV..A.....T....T.......A......T......A....A..S....A...A..A....A......A...P....N.....K....F.ED...EE-L...................E..E..LDE.........DMG..FGLF..............................
A0A0C4EIJ4_PUCT1/17-111                .......................................................................k-PSAEDVKALLSS......V.G.V.D.SE.....E.ERLQ..K.......L....I.S...E.......LK............D.K...TI.A.D.L.IA.E.GSTKLAsvps...................................gggggAAAAAP..A.....T....A.......G......G......A....A..A....A...E..A....P......K...A....E.....A....K.AE...EKE-...................-..E..SDD.........DMG..FGLF..............................
M4CAU5_BRARP/233-320                   .......................................................................f-PTIAAAPHMFIN......A.Y.K.N.AL.....A.ICIA..T.......E....Y.T...F.......PQ............A.E...KV.K.E.Y.LK.D.PSKFAV............................................AVAAVS..A.....D....A.......G......G......G....A..S....A...G..A....A......K...V....E.....E....K.KE...VVE-...................E..S..DEE.........DYG.gFDMF..............................
S2JPQ0_MUCC1/20-104                    ........................................................................EITADKLQTLVSA......A.G.V.E.VE.....P.IWFS..L.......Y....A.K...A.......LA............G.Q...DL.K.A.L.LL.N.VGAP--............................................GSGPAV..S.....A....G.......A......A......A....G..G....A...A..D....A......P...A....E.....E....E.KE...EEK-...................E..E..SDD.........DMG..FGLF..............................
A0A2G5D6W1_AQUCA/17-113                .......................................................................a-PSAGDIKKILGS......V.G.A.E.VE.....D.ERIE..L.......L....L.S...Q.......VK............G.K...DI.T.E.L.IA.S.GREKLAsvps....................................ggggAPVAVS..A.....S....G.......G......G......G....A..A....A...A..P....A......A...A....E.....A....K.KE...EKVEe.................kE..E..SDD.........---..----vrmlsf........................
A0A317SZA7_9PEZI/228-315               ........................................................................YPTLPSVVHSLVN......S.Y.K.N.VI.....A.VALG..T.......E....Y.S...W.......EA............I.D...EL.K.D.R.IA.N.PEAYAS............................................-TGPGP..G.....P....G.......T......G......T....A..A....P...E..G....G......R...P....E.....A....K.EE...EKEE...................E..E..SDD.........EGG.fGDLF..............................
A0A1U8NFT9_GOSHI/17-105                .......................................................npsaadikkilasvsal-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......-Gn.........alG.K...DV.T.E.L.IA.S.GREKLAsvpc...................................gggggVVAAAP..G.....A....G.......A......A......A....A..A....T...P..A....A......A...E....A.....K....K.EE...KVEEk.................aE..S..SDD.........DMG..FSLF..............................
L8IEM2_9CETA/10-83                     .................................................................ilqdtec-------------......-.-.-.-.--.....-.----..L.......F....G.K...A.......LA............N.V...NI.G.S.L.IC.N.VGAGGL............................................APAAGA..D.....P....A.......G......G......P....V..P....S...T..I....A......A...S....A.....K....K.KV...KARKe................esE..E..SND.........DMG..FCLF..............................
A0A0V0U7F6_9BILA/22-112                .......................................................................s-ITMENFQSVLEA......S.N.V.H.VD.....K.IWLN..L.......Y....V.N...A.......LS............K.V...DV.G.D.L.LN.C.LSCGIGs..........................................aSVAAAP..A.....T....A.......E......A......P....K..P....E...A..S....A......P...A....A.....K....K.EE...KKPE..................sD..E..EDE.........DMG..FGLF..............................
A0A1U8P582_GOSHI/234-319               ........................................................................YPTLAAAPHMFIN......G.Y.K.N.VL.....A.VAVA..T.......E....Y.S...F.......PQ............A.D...KV.K.E.Y.LA.D.PSKFAV............................................AAAPVS..A.....A....G.......G......A......A....P..A....A...A..A....P......V...E....E.....K....K.PE...PE--...................E..E..SDD.........DMG..FSLF..............................
A0A2G2VUC0_CAPBA/1-77                  .......................................................................m----------FTN......A.Y.K.N.VL.....A.IAVE..T.......E....Y.S...F.......PL............A.D...KV.K.E.Y.LA.D.PSKF--............................................AAVAVA..P.....V....A.......D......A......S....S..G....A...T..P....V......A...K....E.....E....E.KK...DEPA...................E..E..SDD.........DMG..FSLF..............................
F0LI19_THEBM/16-103                    ........................................................................EITEENLKAVLEA......A.G.V.T.PD.....E.ARIK..A.......L....V.A...A.......LE............G.V...NI.D.E.V.IE.K.AAMPV-............................................AVAAAP..A.....A....A.......P......A......P....A..E....E...A..P....A......Q...E....E.....E....E.EE...EEEA...................S..E..EEA.........LAG.lGALF..............................
A0A0W8DX01_PHYNI/27-107                ........................................................................EITSDSIQQVVNA......S.G.N.E.VE.....P.YWPT..L.......F....A.S...L.......LS............K.E..gKV.L.E.L.IS.T.GGAAAG............................................GAAAAP..G.....A....A.......A......G......A....A..G....A...E..E....E......K...V....E.....E....K.AK...EEEE...................-..E..---.........---..----avs...........................
A0A2K6R6K1_RHIRO/5-102                 ........................................................................SPSAKDIKKILDS......V.G.M.E.VD.....D.DRLN..K.......V....M.G...E.......LN............G.K...NI.G.D.V.IA.Q.GIGKFAsvpa....................................ggavAVSAAP..G.....S....A.......A......P......A....T..G....S...A..P....A......T...A....E.....E....K.KY...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A2K5QM44_CEBIM/17-114                ........................................................................SPSAKDIKKILDS......V.G.I.E.AD.....D.DRLN..K.......V....I.S...E.......LN............G.K...NI.E.D.V.IA.Q.GIGKLAsvpa....................................ggavTISAAP..G.....S....A.......A......P......A....A..G....S...A..P....A......A...A....E.....E....K.KD...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A059CSI3_EUCGR/16-119                ...............takqvsgdleacaastfelqrklvqsavaadssggvqssfslvtpssavfqviiggg-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.-----Gggg......................................figGGAAAA..A.....P....A.......G......G......A....A..P....A...A..E....A......A...P....A.....E....E.KK...EEK-...................E..E..SDD.........DMG..FSLF..............................
A0A1S4E3U5_CUCME/17-112                .......................................................................t-PSAQDINTILYS......V.G.A.E.AD.....V.EKIE..L.......L....L.A...E.......VK............G.K...DI.T.E.L.IA.C.GREKMAslpt....................................gavvA--AVV..A.....A....V.......P......S......T....V..D....A...A..A....P......V...A....A.....E....A.KK...EEKDd.................aM..D..SDE.........DIC..FSLF..............................
A0A2H3E6B9_ARMGA/17-111                ........................................................................SPSAADIKKVLSA......V.G.I.E.AD.....D.DRLS..S.......L....I.S...E.......LS............G.K...SI.D.Q.L.IA.E.GSSKLAsv.......................................psgGAGGAA..A.....P....A.......A......A......S....G..G....A...A..P....A......A...A....E.....E....K.KE...EKEEe.................kE..E..SDD.........DMG..FGLF..............................
K3ZVC4_SETIT/234-318                   ........................................................................YPTLAAAPHMFIN......G.Y.K.N.VL.....A.VAVE..T.......D....Y.S...Y.......PH............A.D...KI.K.E.Y.LK.D.PSKF--............................................AA-AAP..V.....A....S.......A......D......S....G..A....A...A..A....P......K...E....E.....E....K.KA...EEPA...................E..E..SDD.........DMG..FSLF..............................
A0A5J4NYS6_9TREM/21-117                .......................................................................d-VTADKINALLKA......A.N.V.RfVE.....P.YLPG..L.......F....A.N...A.......LQ............G.K...NV.K.D.M.LM.N.IGSAGGapt.....................................gtavA---AS..A.....P....T.......T......T......T....A..Q....A...A..A....A......A...P....D.....K....K.SD...KAEKv................esE.gE..SDE.........SMG..FDLF..............................
A0A267G194_9PLAT/27-121                .......................................................................p-VTADKISAILKA......A.N.I.HfVE.....P.FWPN..M.......F....A.R...A.......LE............K.Q...DL.K.Q.L.LF.S.AGVGAGga........................................agGEAGAA..A.....A....D.......G......A......G....A..G....A...A..A....A......A...P....E.....K....K.EE...KKPEs.................eS..E..SDD.........DMG..LDLF..............................
W4KDF3_HETIT/229-312                   ........................................................................YPTIVSVTHSLVN......A.Y.K.N.LI.....A.VSLA..T.......D....Y.T...F.......EG............A.E...KA.K.E.Y.LA.N.PEAF--............................................AVAAAP..A.....A....A.......A......A......A....D..A....A...P..A....A......A...E....E.....A....K.EE...EKE-...................-..E..SDD.........DMG..FGLF..............................
A0A7D5KKH9_9EURY/16-112                ........................................................................EINEDNVTAVLEA......A.G.V.D.VE.....E.SRVK..A.......L....V.A...A.......LE............D.V...DI.E.E.A.ID.T.AAAAPAa..........................................gAGGAAG..A.....A....G.......G......A......E....E..A....E...S..D....E......D...E....A.....E....D.EE...AEAEea...............gdD..D..EDEs.......sGEG..----lgelf.........................
G1UBJ0_METIK/16-101                    ........................................................................EITEDAVKAVLSA......A.G.V.E.VD.....E.ARVK..A.......L....V.A...A.......LE............G.V...NI.D.E.A.IE.N.AAMP--............................................VA-AAA..P.....A....A.......A......A......A....P..A....A...E..E....K......K...E....E.....E....K.KE...EKKD...................D..T..AAA.........AAG.lAALF..............................
A0A1S3PW10_SALSA/33-129                .......................................................................s-PQAADIKKILES......V.G.I.E.AD.....N.TRME..K.......V....V.T...E.......LG............G.K...NV.E.E.V.IA.Q.GYGKLAsmp.....................................aggaVAVASS..G.....G....A.......A......T......A....G..A....A...A..P....A......A...A....E.....E....K.KE...EKEEs.................eE..G..SDD.........DMG..FGLF..............................
A0A139HJP5_9PEZI/17-112                ........................................................................SPSAEDIKGLLSA......V.G.V.E.AD.....Q.ERLE..K.......L....L.S...E.......LE............G.K...DI.N.E.L.IS.E.GSTKLAsvps...................................ggaggAPAAGG..A.....A....A.......G......A......G....G..D....S...A..A....P......A...A....E.....E....A.KE...EEK-...................E..E..SDE.........DMG..FGLF..............................
A0A3L6PF67_PANMI/16-119                .............takqhsgeieasaatpyelqrrlvaaasaadsasgvqssfsmvspssavfqvivgavgg-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.-----Gpm........................................isGGAAVG..G.....A....A.......A......S......G....G..G....A...A..E....A......P...K....E.....E....K.KE...EEK-...................E..E..SDD.........DMG..FSLF..............................
Q2UKH6_ASPOR/229-312                   .......................................................................f-PTLPAVMHYLVN......S.Y.K.K.VL.....A.VAVS..T.......E....I.S...W.......PE............I.E...EL.K.D.R.IA.N.PDAY--............................................AA-AAP..V.....A....G.......A......G......A....A..A....G...G..D....A......P...A....E.....E....K.KE...EEE-...................E..E..SDD.........DMG..FGLF..............................
A0A099P5Y8_PICKU/19-102                ........................................................................EVSSENLQTVLNA......A.G.A.N.VD.....S.IWTS..V.......F....A.K...A.......LE............G.K...DL.K.E.I.LF.S.MAAA--............................................APAAAA..G.....S....A.......A......A......A....G..G....A...E..E....A......A...A....E.....A....V.EE...EKE-...................-..E..SDD.........DMG..FGLF..............................
E1Z866_CHLVA/233-313                   ........................................................................YPTIASVPHSLIN......G.Y.K.N.VL.....A.IAVE..T.......D....Y.S...F.......PL............A.E...KV.K.A.F.LA.D.PSAF--............................................AVAAAP..A.....A....G.......G......E......A....A..P....A...A..A....A......A...-....-.....-....A.AE...PEE-...................-..E..EDE.........DMG..FSLF..............................
A0A177B0Y2_9BILA/25-109                .......................................................................p-VTENKLEKVLSA......A.D.I.S.IE.....P.FYTK..A.......F....A.K...C.......CQ............Q.K...DYmQ.T.L.LT.N.ASS---............................................-VNTVS..A.....P....T.......T......A......A....V..E....T...T..S....A......P...V....E.....E....K.KE...ESEE...................E..D..SGS.........DNG..FGLF..............................
G0QS62_ICHMG/241-325                   ....................................................................nlaa-------------......-.-.-.-.--.....-.--IS..L.......E....S.G...Y.......VT............D.V...AV.P.H.L.VA.N.AFKNLAaigletgy............................kfkqiegaGQAPAP..A.....A....A.......A......A......K....P..A....A...Q..A....P......A...K....E.....Q....P.KV...EEKE...................A..E..EDY.........DMG..-DLF..............................
A0A2N6NY00_BEABA/21-107                ........................................................................EITADKLQSLIKA......A.N.V.E.VE.....P.IWTS..I.......F....A.K...A.......LE............G.K...DV.K.D.L.LV.N.VGSGGG............................................AAPAAG..G.....A....A.......P......A......A....G..G....A...A..D....A......P...A....E.....E....A.KE...EEK-...................E..E..SDE.........DMG..FGLF..............................
A0A6I9SZL2_SESIN/21-119                .......................................................................p-ITAEKIATLVKA......A.N.V.T.VE.....S.YWPS..L.......F....A.K...L.......CE............K.R...NI.D.D.L.IM.N.VGSGGGgaavav................................aapacaVAAPAG..G.....F....L.......G......G......A....A..A....A...A..A....P......A...A....E.....E....K.KE...EPK-...................E..E..SDD.........DMG..FSLF..............................
A0A084WHE2_ANOSI/23-113                .......................................................................a-VTDEKISTILKA......A.N.V.D.IE.....P.YWPG..L.......F....A.K...A.......LE............G.I...DV.K.S.L.IT.S.IGSGVGs..........................................gGGGGAP..A.....A....A.......A......A......G....G..G....A...A..P....A......A...A....E.....K....K.EE...KEEE..................pE..E..SDD.........DMG..FGLF..............................
A0A0V0X243_9BILA/22-119                ........................................................................NPEVADLKKIITS......A.T.D.E.FD.....E.SKAK..M.......V....V.D...S.......CK............G.N...DL.L.K.L.IA.E.GATKLSsvpsg.................................pavatgGASAAA..D.....A....A.......A......L......A....A..T....E...S..S....K......K...E....D.....S....K.KK...EES-...................E..E..EDE.........DMG..FGLF..............................
A0A096PAI6_OSTTA/229-310               ........................................................................YPTLASVPHSIVN......A.Y.K.N.VL.....A.VSIG..T.......E....Y.T...F.......EL............A.Q...KV.K.D.Y.LA.N.PGAF--............................................AA-AAP..A.....G....G.......A......A......A....G..G....D...S..G....A......K...A....A.....A....A.AV...EEE-...................-..-..EEE.........EMD..FDLF..............................
A0A1R3JJS3_COCAP/307-395               .......................................................................p-ITAEKIATLVKA......A.N.V.S.VE.....S.YWPS..L.......F....A.K...L.......LE............K.R...SC.D.D.L.IM.N.VGSGGGa.........................................apAAVAAP..A.....G....A.......G......G......A....A..A....A...A..P....A......V...E....E.....K....K.EE...PK--...................E..E..SDD.........DMG..FSLF..............................
H2LPR5_ORYLA/17-112                    ........................................................................SPSAKDIKDILGS......V.G.I.E.AD.....D.ERLN..K.......V....I.G...E.......LN............G.K...NI.N.E.V.VN.S.GLSKLAsvp.....................................aggaVAAPAA..A.....P....S.......G......A......T....G..A....A...P..A....P......A...E....E.....K....K.EE...KKEE..................sE..E..SDE.........DMG..FGLF..............................
A0A545A093_9PEZI/21-108                .......................................................................d-ITADKLQTLIKA......A.G.IdD.VE.....P.IWSS..L.......F....A.K...A.......LE............G.K...NI.R.D.L.LS.N.VGSG--............................................GGAAAA..P.....A....V.......A......G......E....A..G....G...A..A....A......A...E....S.....K....E.EE...KEEE..................kE..E..SDD.........DMG..FGLF..............................
A0A545AD34_9PEZI/230-312               .......................................................................f-PTLPSVTHSIIN......S.Y.K.K.IL.....S.IAIE..T.......D....Y.G...W.......PE............I.E...EL.K.D.R.IA.N.PDSY--............................................-AAAAP..V.....A....E.......Q......K......E....S..A....P...E..A....A......K...E....E.....E....K.KE...EEE-...................E..S..GDE.........GFG..-GLF..............................
A0A2T3Z8E0_9HYPO/21-108                ........................................................................EITADKLQTLISA......A.K.V.E.VE.....P.IWTS..I.......F....A.K...A.......LE............G.K...DI.K.D.L.LV.N.VGSGGG............................................AAAAAG..G.....A....A.......A......A......A....G..G....A...A..A....E......A...A....P.....E....E.EK...VEEK...................E..E..SDE.........DMG..FGLF..............................
A0A2R8ZWV3_PANPA/17-114                ........................................................................SPSAKDIKKILDS......V.G.I.E.AD.....D.DRLN..K.......V....I.S...E.......LN............G.K...NI.E.D.V.IA.Q.GIGKLAsvpa....................................ggavAVSAAP..G.....S....A.......A......P......A....A..G....S...A..P....A......A...A....E.....E....K.KD...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A5N5X1I4_9EURO/229-311               .......................................................................f-PTLPSVMHSLVN......S.Y.K.K.VL.....A.VAVS..T.......D....F.S...W.......PE............I.D...EL.K.D.R.IA.N.PDAY--............................................ASAAPA..A.....A....A.......A......P......A....A..G....G...A..P....A......A...E....E.....K....K.EE...EE--...................-..E..SDD.........DMG..LGLF..............................
A0A0D9WH38_9ORYZ/17-111                ........................................................................SPTADDVKNILES......V.G.V.E.AN.....E.ERLE..F.......L....I.S...E.......LE............G.K...DI.T.E.V.IA.A.GREKFAsvp......................................sggGAMAVA..A.....P....A.......A......A......A....G..G....A...A..P....A......E...E....A.....K....K.EE...KVEE..................kE..E..SDD.........DMG..FSLF..............................
A0A183TEY4_SCHSO/17-115                .......................................................................h-IGADDIKAILDS......V.G.I.E.CE.....E.ER--..-.......L....L.A...Q.......LK............G.K...NA.H.D.L.IN.A.GKAKLSsvsvaa................................paahaaG-GAAA..P.....S....A.......P......A......A....G..K....E...E..A...gG......K...K....E.....K....A.EE...KKPEs.................dE..E..SDD.........DMG..FGLF..............................
A0A0D1Z6K8_9EURO/17-113                .......................................................................d-PSEDDIKSVLSS......V.G.I.D.AD.....E.ERLS..K.......L....L.E...E.......LK............G.K...DI.N.E.L.IA.E.GSTKLAsvp.....................................tggaGGAAAP..A.....A....G......gA......A......A....G..G....A...A..A....A......E...E....E.....K....P.AE...KEEE..................kE..E..SDE.........DMG..FGLF..............................
A0A7H9B229_ZYGMR/17-110                ........................................................................SPSAADIKSVIES......I.G.V.E.AD.....D.ARIN..E.......L....L.S...S.......LQ............G.K..gSL.D.E.I.IA.E.GQQKFAsvp......................................aggAASAGA..A.....A....G.......G......A......A....A..G....G...D..A....A......A...E....E.....E....A.AE...EEK-...................E..E..SDD.........DMG..FGLF..............................
A0A0V1CZ80_TRIBR/231-319               ........................................................................YPTAASAPHMIAN......A.F.K.N.LL.....S.IAAV..T.......D....I.T...F.......KE............A.E...KL.K.E.Y.LA.D.PSKFAV............................................AAAPAA..A.....A....A.......D......S......S....K..A....E...K..E....D......S...S....S.....K....K.KE...EKVE...................E..E..SDE.........EEG.mGGLF..............................
A0A6G1G7K6_9PEZI/229-313               .......................................................................f-PTLPSVIHSVVN......S.Y.K.K.LL.....S.IAVE..T.......E....V.E...W.......EG............I.E...EL.K.D.R.IQ.N.PDKY--............................................AGAAPA..A.....A....A.......G......G......A....A..A....A...E..A....P......K...E....E.....A....K.PE...SDE-...................E..S..EDD.........DMG..FGLF..............................
A0A0N4VYA0_HAEPC/17-71                 .......................................................................s-PKLEDIKNILGA......V.G.V.D.TD.....A.EAAK..L.......V....I.S...R.......LQ............G.K...NI.E.E.V.IA.E.GSAGLV............................................------..-.....-....-.......-......-......-....-..-....-...-..-....-......-...-....-.....-....-.--...----...................-..-..---.........---..----svscafft......................
C1MX55_MICPC/17-108                    ........................................................................SPSEADVKSVLSS......V.S.A.E.VD.....D.EKLK..A.......F....F.A...A.......ID............G.K...DV.A.E.L.IK.E.GTEKLAsvp......................................sggGGGGGG..G.....G....G.......G......G......G....G..G....G...G..G....A......A...A....A.....P....E.PE...PE--...................E..E..EEE.........AMD..FDLF..............................
G1QHI2_NOMLE/231-316                   ........................................................................YPTVASVPHSIIN......G.Y.K.R.VL.....A.LSVE..T.......D....Y.T...F.......PL............A.E...KV.K.A.F.LA.D.PSAF--............................................VAAAPV..A.....A....A.......T......T......A....A..P....A...A..A....A......A...P....A.....K....V.EA...KEES...................E..E..SDE.........DMG..FGLF..............................
L5LCV2_MYODS/2-92                      .....................................................................ted----NKINALIKA......A.G.V.M.GE.....L.FWPG..L.......F....A.K...A.......LA............N.V...NI.G.S.L.IC.N.VGAGGPa..........................................pAASAAP..A.....G....G.......P......A......P....S..T....A...A..A....P......A...E....E.....T....K.VE...AKKEd.................pE..E..SDD.........DMG..FGLF..............................
A0A6A5P2D0_LUPAL/253-337               ........................................................................YPTIAAAPHMFVN......A.Y.K.N.VL.....S.VALA..T.......Q....Y.S...F.......PQ............A.D...EV.K.E.Y.LK.N.PSKF--............................................AVAAPA..A.....V....S.......A......T......A....P..A....A...A..T....A......A...K....E.....E....K.KE...EPA-...................E..E..SDD.........DLG..LSLF..............................
RLA25_ARATH/17-113                     ........................................................................NPSVADLKKIVES......V.G.A.E.ID.....Q.EKID..L.......F....F.S...L.......IK............D.R...DV.T.E.L.IA.V.GREKMAalss....................................gggaVAVASG..G.....G....G.......G......A......A....P..A....A...E..P....A......S...V....E.....S....K.KK...EEEK...................E..E..SED.........DGG.mMSLF..............................
A0A091FQM0_9AVES/17-114                ........................................................................SPTSKDLKKILDS......V.G.I.E.TD.....D.ERMN..K.......V....I.S...E.......LN............G.K...NI.E.D.V.IA.Q.GNGKLAsmpa....................................ggavAVSAGG..G.....S....A.......A......P......A....A..A....A...A..P....A......A...A....E.....E....K.KE...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A9PCM7_POPTR/17-112                    .......................................................................c-PTAEDLKNILGS......V.G.A.D.AD.....D.DRIE..L.......L....L.S...S.......VK............G.K...DI.T.E.L.IA.S.GREKLAsvp.....................................sgggVAVSAG..A.....A....P.......A......A......A....G..G....A...A..P....A......A...E....A.....K....K.EE...KVEE..................kE..E..SDD.........DMG..FSLF..............................
A0A1B7P4U5_9EURO/17-111                ........................................................................SPSAADIKSVLGA......V.G.I.D.AD.....D.ERLE..K.......L....I.S...E.......LK............G.K...EL.S.E.L.IA.E.GSTKLAsv.......................................psgGAAAAP..A.....A....G.......G......A......A....A..G....G...E..A....A......A...A....A.....E....K.AE...EKEEe.................kE..E..SDE.........DMG..FGLF..............................
A0A1S3C8T5_CUCME/17-114                .......................................................................s-PGVDDVKAILNS......V.G.V.E.ID.....E.ERIT..L.......L....L.S...E.......VK............G.K...DV.T.E.L.IA.S.GREKLAsvps...................................gggaiAVSASA..G.....G....A.......A......G......G....G..A....A...P..A....P......A...E....Q.....K....K.EE...KVEE..................kE..E..SDD.........DMG..FSLF..............................
A0A397XNN1_BRACM/35-120                ................................qrklvqtalsadssggvqssfslvsptsavfqviigggsg-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.----GGfa........................................agG-GAAA..G.....G....A.......S......G......G....G..E....S...A..A....A......A...K....E.....E....E.KK...KEES...................E..E..EEG.........DFG..FDLF..............................
S5Z820_9CREN/16-105                    ........................................................................EINEESVKKILEA......A.G.I.Q.VD.....D.VRVK..A.......L....V.A...A.......LK............E.V...NI.E.E.A.IK.T.AALPVA............................................VGGAAP..A.....A....A.......P......A......Q....A..P....A...E..Q....K......K...E....E.....K....K.EE...KKEE..................vK..E..ETV.........EEG.lAGLF..............................
A0A6H5HSK8_9HEMI/17-114                ........................................................................NPSSADIEKILSS......V.G.I.E.AD.....S.EKLN..K.......V....I.G...E.......LK............G.K...NV.E.E.V.IS.K.GKEKLAtvpa....................................gggaAAPAAA..G.....G....A.......A......P......A....A..D....S...P..S....K......A...A....E.....S....K.KE...EKKEe.................sD..Q..SDD.........DMG..FGLF..............................
A0A067KDN6_JATCU/17-86                 ....................................................................apsv-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.D...DI.K.D.I.LS.H.VRADVDdvkiry................................llleieAVAPVG..G.....A....A.......S......T......P....A..V....A...V..E....A......K...K....E.....E....K.VE...EKE-...................-..E..LDD.........DIG..FSLF..............................
A0A401L5J7_ASPAW/229-311               ........................................................................YPTIPAVMHSLVN......S.Y.K.K.VL.....A.VAVE..T.......E....Y.S...W.......PE............I.E...EL.K.D.R.IA.N.PDAY--............................................AS-AAP..A.....A....A.......A......A......P....A..A....G...G..A....P......A...A....E.....A....P.KE...EEE-...................-..E..SDE.........DMG..FGLF..............................
A0A3P9P5U6_POERE/22-114                .......................................................................t-VTEDKLNALIKA......A.G.V.T.VE.....P.FWPS..L.......F....A.K..qA.......LS............S.I...DI.G.S.L.IC.N.VGAGGGg..........................................aPAGAPA..A.....G....A.......A......P......A....G..G....D...A..P....A......K...E....E.....E....K.KE...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A6J0YDX1_ODOVR/231-317               ........................................................................YPTVASVPHSIIN......G.Y.K.R.VL.....A.LSVE..T.......D....Y.T...F.......PL............A.E...KV.K.A.F.LA.D.PSAFVAa..........................................aPVTAAT..T.....A....A.......P......A......A....T..T....A...A..P....A......K...V....E.....A....K.EE...S---...................E..E..SDE.........DMG..FGLF..............................
A0A409YIH8_9AGAR/59-147                ........................................................................EITADKIVALTNA......A.G.V.E.LE.....P.IWAT..L.......L....E.K...A.......LA............G.K...NV.K.D.L.LS.N.VGAG--............................................GGAPAA..A.....A....A.......P......A......A....G..G....A...A..A....A......A...E....E.....A....P.KE...EEKKe................ekE..E..SDD.........DMG..FGLF..............................
A0A1S3ZR95_TOBAC/234-318               ........................................................................YPTLAAIPHMFIN......G.Y.K.N.VL.....S.FAIA..T.......E....Y.S...F.......PQ............A.E...KV.K.E.Y.LK.D.PSKF-A............................................AATAAP..V.....A....A.......K......P......A....A..K....P...A..T....A......K...E....E.....K....K.EE...PAE-...................-..E..DDD.........DFV..GGLF..............................
RLA2_BOVIN/17-114                      ........................................................................SPSAKDIKKILDS......V.G.I.E.AD.....D.DRLN..K.......V....I.S...E.......LH............G.K...NI.E.D.V.IA.Q.GIGKLAsvpa....................................ggavAVSAAP..G.....S....A.......A......P......A....A..G....S...A..P....A......A...A....E.....E....K.KE...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
S9W177_SCHCR/17-108                    ........................................................................SPSTSDIETVLST......V.G.I.E.SE.....S.ARVE..S.......L....L.N...E.......LQ............G.K...NL.E.E.L.IA.A.GNEKLAt.........................................vpSGGAAA..A.....P....A.......A......A......G....G..A....A...T..P....A......A...E....E.....A....K.KE...EAKE..................eE..E..SDE.........DMG..FGLF..............................
Q9U1X9_CAEEL/17-109                    ........................................................................NPKVDDLKNILSA......V.G.V.D.AD.....A.ETAK..L.......V....V.S...R.......LA............G.K...TV.E.E.L.IA.E.GSAGLVsv........................................sgGAAPAA..A.....A....A.......P......A......A....G..G....A...A..P....A......A...D....S.....K....P.AK...KEEP..................kE..E..SDD.........DMG..FGLF..............................
A0A6P6SX37_COFAR/17-113                .......................................................................c-PSAKDIKVILAS......V.G.A.D.VD.....D.EKID..L.......L....L.S...Q.......VD............G.K...DI.T.E.M.IA.A.DREKLAsvpa....................................gggaGVAVAA..A.....A....A.......A......G......G....A..A....A...A..P....V......A...E....D.....K....K.EE...KVEE..................kE..E..SDD.........DMG..FSLF..............................
A0A6J8BDM3_MYTCO/85-156                ...................................................................qpvtl-------------......-.-.-.-.--.....-.----..-.......-....-.K...R.......LL............G.K...NL.E.D.L.IK.E.GQEKLAsvp......................................sggAVAAAP..A.....A....A.......A......E......E....A..P....K...G..G....A......K...K....E.....E....K.KK...PEPE...................S..E..SDD.........DMG..FGLF..............................
Q4DWU6_TRYCC/16-106                    .......................................................................t-PSKSAVEAVLKA......A.G.V.P.VD.....P.SRVD..A.......L....F.A...E.......FA............G.K...DF.D.T.V.CT.E.GKSKLVggv.....................................trpnAATASA..P.....T....A.......A......A......A....A..S....S...G..A....A......A...P....A.....A....A.AE...E---...................-..E..EDD.........DMG..FGLF..............................
Q5DBM5_SCHJA/17-114                    .......................................................................k-PTENDIKTVLNS......V.G.I.E.HD.....S.ERLT..K.......L....L.A...S.......LS............G.K...DI.P.Q.L.IA.E.GSQKLSsvpt....................................agaaVSAPSS..A.....P....T.......A......P......A....K..A....E...V..P....K......A...E....S.....K....P.AK...TEVKe.................eS..E..SEE.........DMG..FGLF..............................
A0A1B7MWK1_9AGAM/21-110                ........................................................................EITADKILALTNA......A.S.V.E.LE.....P.IWAS..L.......L....A.K...A.......LE............G.K...NV.K.D.L.LS.N.VGAGGGa.........................................paVGAPAA..A.....A....A.......G......G......A....P..A....A...E..A....P......K...E....E.....E....K.KE...EAK-...................E..E..SDD.........DMG..FGLF..............................
A0A3B1IRI4_ASTMX/17-110                ........................................................................NPSSNDIKKILES......V.G.I.E.VD.....E.TRMG..K.......V....V.S...E.......LN............G.K...KV.E.D.V.IA.Q.YGKLASvp.......................................sggAVAVAS..S.....A....A.......P......A......A....G..G....A...A..A....P......A...E....E.....K....K.EE...KKEE..................sE..E..SDD.........DMG..FGLF..............................
A0A0L9UNI9_PHAAN/17-77                 .......................................................................t-PSASDIKNILGA......V.G.A.E.AE.....D.ELIN..L.......L....L.A...E.......VK............G.K...DF.N.E.L.LA.S.GREKMSa..........................................vS--GGG..A.....A....V.......A......V......A....-..-....-...-..-....-......-...-....-.....-....-.--...----...................-..-..---.........---..----ai............................
A0A2S4PMA6_9PEZI/21-109                .......................................................................d-ITADKLQTLIKA......A.G.IeD.VE.....P.IWST..L.......F....A.K...A.......LE............G.K...DV.K.E.L.LL.N.VGSG--............................................GGAAAP..A.....S....S.......G......D......S....G..A....A...A..A....T......E...D....K.....K....A.EE...KEEEk.................eE..E..SDE.........DMG..FGLF..............................
C5Z967_SORBI/61-118                    ..........................................................tsavfqvivgavgg-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.-GAMM-............................................VSGGGG..A.....A....A.......A......S......G....G..A....A...A..E....A......P...K....E.....E....K.KE...EEK-...................E..E..SDD.........DMG..FSLF..............................
A0A0E0FJ28_ORYNI/53-118                ........................................................ssfamvspssavfqvi-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.IG.A.VGGGAA...........................................iGGAAAG..G.....A....A.......A......G......G....A..A....A...E..A....P......K...A....E.....E....K.KE...EEK-...................E..E..SED.........DLG..FSLF..............................
A0A642UMG5_DIURU/20-105                ........................................................................EISPENLKTLTET......A.G.V.E.VE.....A.IWTS..I.......Y....A.K...A.......LD............G.K...DL.K.D.L.FF.Q.VQAG-P............................................AAGAAP..A.....A....G.......A......A......A....A..G....G...E..A....A......A...A....E.....E....K.EE...EAK-...................E..E..SDD.........DMG..FGLF..............................
A0A0P7V4N1_SCLFO/231-295               ........................................................................YPTLASIPHSIIN......G.Y.K.R.VL.....A.VAVE..T.......D....Y.T...F.......PL............A.E...KV.K.A.Y.LA.D.PSAF--............................................-AAAAP..A.....A....A.......A......A......E....T..A....A...A..P....A......A...A....-.....-....-.--...----...................-..-..---.........---..----a.............................
A0A0X8V2L6_9ARCH/16-102                ........................................................................EITEDAITAILNA......A.G.A.E.VD.....A.AKVK..A.......L....V.A...S.......LE............G.V...DI.K.E.A.IA.N.ASFA--............................................APAAAA..A.....A....A.......P......A......A....A..A....D...A..P....A......A...A....P.....A....E.EE...EE-K..................vS..E..DEA.........AAG.lSALF..............................
A0A1S2Z8G7_CICAR/21-75                 .......................................................................a-ITAEKINTILKA......V.G.V.T.VE.....S.YWPS..L.......F....A.K...L.......AQ............N.K...SI.D.D.L.VL.N.AGAT--............................................GGAAVA..V.....S....A.......-......-......-....-..-....-...-..-....-......-...-....-.....-....-.--...----...................-..-..---.........---..----p.............................
E4WQM2_OIKDI/20-106                    .......................................................................d-ISGDKIASLLKA......A.N.V.D.VE.....P.FWPG..L.......F....A.G...A.......LK............N.C...NV.S.E.L.IS.N.ISSGV-............................................GAGPSA..A.....G....G.......A......A......A....G..G....A...A..E....E......A...K....E.....E....E.KK...PESS...................S..E..SDD.........DMG..FDMF..............................
A0A669PEW4_PHACC/169-253               ........................................................................YPTIASVPHSIVN......G.Y.K.R.VL.....A.VAVE..T.......D....Y.S...F.......PL............A.E...KV.K.A.F.LA.D.PSAFVA............................................AAPVVT..E.....T....A.......A......P......A....A..A....A...A..P....A......K...E....A.....P....K.EE...SE--...................-..E..SDE.........DMG..FGLF..............................
A8A9N2_IGNH4/16-106                    ........................................................................EITEDAVKKVLEA......A.G.V.E.VD.....E.TRVK..A.......L....V.A...A.......LS............E.V...NI.E.E.A.IK.S.AAFP--............................................-VAAAP..A.....A....A.......P......A......A....A..G....G...E..A....K......E...E....K.....K....E.EE...EEEEkk..............eavS..E..EEL.........SAG.lGALF..............................
A0A1U8FRL2_CAPAN/22-113                .......................................................................p-VTAEKIATVVKA......A.N.L.Q.VE.....S.YWPS..L.......F....A.K...L.......CE............K.K...NV.E.D.L.IM.N.VGSGGTaa........................................ptGAVAGA..P.....P....V.......T......G......D....D..A....A...T..A....S......S...T....A.....D....K.KK...EEPK...................E..E..SDD.........EAM..FSLF..............................
A0A3M2T558_9EURO/229-308               .......................................................................f-PTVPAVMHSLVN......S.Y.K.K.VL.....G.VAVA..T.......E....Y.G...W.......PE............I.E...EL.K.D.R.IA.N.PDAY--............................................-ASAAP..A.....A....A.......A......A......P....A..E....A...A..P....A......K...E....E.....E....P.EE...ES--...................-..-..GDE.........GFG..-GLF..............................
A0A423W645_9PEZI/21-107                ........................................................................EITADKLQTLIKS......A.N.V.D.IE.....P.IWTS..L.......F....A.K...A.......LE............G.K...DV.K.D.L.LT.N.VGSGGG............................................AAPAAG..G.....A....A.......A......A......A....G..G....A...A..E....E......T...K....E.....E....E.KV...EEK-...................E..E..SDD.........DMG..FGLF..............................
D7MFV8_ARALL/23-118                    .....................eleasasstyelqrklvqaalsadssggvqssfslvsptsavfqvivgggg-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.---GGG...........................................fAAGGAA..S.....G....G.......G......G......A....G..E....S...A..A....A......P...K....E.....D....E.KK...KEES...................E..E..EEG.........DFG..FDLF..............................
A0A4Q1BRK1_TREME/24-113                ....................................................................ncqg----EKIHALTSA......A.R.V.D.LD.....S.IWAT..L.......L....A.K...A.......LD............G.K...NV.K.D.M.LT.N.VGGGGAp..........................................aAGAVSA..A.....T....G.......G......S......A....D..A....A...P..E....A......A...K....E.....E....E.KK...EEAK...................E..E..SDD.........DMG..FGLF..............................
A0A093Q0C2_9PASS/17-114                ........................................................................SPTSKDLKKILDS......V.G.I.E.TD.....D.ERMN..K.......V....I.S...E.......LN............G.K...NI.E.D.V.IA.Q.GNGKLAsmpa....................................ggavAVSAGG..G.....S....A.......A......P......A....A..A....A...A..P....A......A...A....E.....E....K.KE...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
G0QTQ2_ICHMG/21-107                    .......................................................................e-TSAENIEKVLKA......A.N.L.K.VN.....A.SQNA..A.......F....Q.R...L.......FA............H.T...PA.S.K.L.VP.Q.LGGGV-............................................ASSAPT..Q.....S....A.......Q......A......S....A..P....A...K..A....A......A...K....E.....A....P.KE...EPKK...................E..E..EED........yDMG..-DLF..............................
A0A1X2GV06_9FUNG/20-104                ........................................................................EITEDKLQTLVKA......A.G.V.E.VE.....P.IWFS..L.......Y....A.K...A.......LA............G.Q...DL.N.E.L.LT.K.VGTP--............................................GAGPAV..A.....G....A.......A......A......A....G..G....A...A..A....E......A...V....E.....E....A.KE...EEK-...................E..E..SDD.........DMG..FGLF..............................
A0A7E6CXT0_9CHIR/248-329               .....................................................................tvv----TSVPHSIIS......G.Y.K.Q.VL.....E.LSVE..P.......D....Y.T...F.......PL............A.E...KV.K.A.P.LA.D.PSAF--............................................VAAAPV..A.....T....A.......I......T......A....D..P....A...A..A....A......K...V....E.....A....K.EE...SE--...................-..E..SDD.........DMG..FGLF..............................
A0A6P3XXN6_DINQU/17-114                ........................................................................SPSQNDIEKILSS......V.G.I.E.TD.....T.EKLK..K.......V....I.S...E.......LN............G.K...SI.D.E.L.IT.K.GREKLSsmp......................................vggAAAAGT..A.....A....A.......A......P......A....S..G....A...A..A....P......V...E....E.....K....K.EE...KKPAke...............esE..S..EDD.........DMG..FGLF..............................
A0A1L7X3R8_9HELO/21-109                .......................................................................d-VTADKLQTLIKA......A.K.IeD.VE.....P.IWSS..L.......F....A.K...A.......LE............G.K...DV.K.D.L.LL.N.VGSGG-............................................GAAAAP..T.....A....G.......G......A......A....G..G....E...A..A....A......E...E....A.....K....E.EE...KE-Ea.................kE..E..SDE.........DMG..FGLF..............................
K5XEM2_AGABU/17-111                    .......................................................................s-PDEAAIRKVLDA......G.G.V.E.TD.....E.DQLS..K.......L....L.S...E.......LK............G.K...DI.N.D.L.IA.E.GSSKLAsvp......................................sggGGGGGG..A.....A....A.......A......A......S....G..G....A...A..P....A......A...E....E.....K....K.EE...KEEE..................kE..E..SDD.........DMG..FGLF..............................
A0A177VL13_9BASI/21-108                ........................................................................EVTADKLNALLTA......A.G.V.Q.VQ.....P.IWAT..L.......L....A.K...A.......LA............D.K...DV.K.S.L.LT.N.VGGGSG...........................................pAVSVSA..A.....P....A.......A......G......G....A..A....P...E..A....A......K...E....E.....E....K.KE...EEK-...................E..E..SDD.........DMG..FGLF..............................
C6T463_SOYBN/33-124                    ..........................dlqrklvqaalavdssggvqssfspvsptsavfqvivggavfvggg-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.-GGAVA............................................AAPAGG..A.....A....A.......A......D......A....A..A....A...D..A....A......P...A....A.....E....K.KE...EKVE...................E..E..SDD.........DMG..LGLF..............................
F9XB28_ZYMTI/229-312                   ........................................................................YPTLPSVMHSVVN......S.Y.K.K.VI.....S.VAIE..T.......E....Y.E...W.......DA............I.H...EL.K.D.R.IK.N.PDAY--............................................AS-AAP..A.....A....A.......A......A......T....E..T....A...A..D....A......P...A....A.....A....K.EE...EKE-...................E..S..EDD.........DMG..FGLF..............................
A0A5B0LRL1_PUCGR/229-311               ........................................................................YPTVASVPHSLVN......S.Y.K.N.LI.....A.IALT..T.......D....Y.M...F.......EG............A.Q...KA.K.D.Y.LD.N.PEAF--............................................A--AAA..A.....P....A.......A......A......A....S..A....A...A..P....A......A...A....A.....A....K.EP...EPE-...................E..E..EDE.........DMG..LDLF..............................
A0A2K6FQ69_PROCO/17-114                .......................................................................s-PGAKDIKKILDS......V.G.I.E.AD.....D.DRLN..K.......V....I.S...E.......LN............G.K...NI.E.D.V.IA.Q.GIGKLAsvpa....................................ggavAVSAAP..G.....A....A.......A......P......A....A..G....S...A..P....A......A...A....E.....E....K.KD...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A397XR95_BRACM/22-110                ........................................................................EITAEKIAKLVKA......A.N.V.N.VE.....S.YWPS..L.......F....A.K...L.......CQ............K.K...NI.D.D.L.IM.N.VGASGD............................................AAAPVA..T.....N....V.......P......A......A....A..Q....A...V..P....A......A...E....E.....T....K.KK...KEEV..................kE..E..SED.........DMV..FGLF..............................
A0A2K6S5L2_SAIBB/22-113                .......................................................................t-VTEDKINALIKA......A.G.V.N.VE.....P.FWPG..L.......F....A.K...A.......LA............N.V...NI.G.S.L.IC.N.VGAGGPa..........................................pAAGAAP..A.....G....G.......P......A......P....S..T....A...A..A....P......A...E....E.....K....K.VE...AKKEe.................sE..E..SDD.........NMG..FGLF..............................
A2STT7_METLZ/16-102                    .......................................................................t-VDEESVKAVLSA......A.G.I.A.VD.....D.SRVK..A.......L....I.A...A.......LD............G.V...DI.E.E.A.IS.K.AAAAPV............................................AVAAAP..A.....A....A.......G......A......A....A..A....V...E..E....A......A...A....P.....E....E.NK...EE--...................E..E..ENA.........MAG.lGALF..............................
A0A6J3Q112_TURTR/34-124                .......................................................................t-VTEDKINALIKA......A.D.V.N.VE.....P.FWPG..L.......F....A.K...A.......LA............N.V...NI.G.S.L.IC.N.VGAGGPa..........................................pAAGATP..A.....G....G.......P......A......P....S..T....T...A..A....P......A...E....K.....K....V.EA...KKEK..................sE..E..SDD.........DMS..FGLF..............................
A0A4X2KQF5_VOMUR/21-109                .......................................................................t-VTEDKINALIQA......A.G.V.N.VE.....P.FWPL..L.......F....A.K...A.......LS............N.V...NI.A.S.L.IC.N.VGDGG-............................................PAPAAG..G.....A....A.......P......P......A....S..T....A...A..P....D......E...K....K.....K....K.EE...AKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A367L5F5_9HYPO/17-110                ........................................................................SPSAKDVKEVLSS......V.G.L.E.AD.....D.DRLK..T.......L....L.S...E.......LK............G.K...DI.N.E.L.IT.S.GSEKLAsvp......................................sggGGGGAP..A.....A....G.......G......A......A....A..G....G...A..A....D......A...P....A.....E....A.AK...EEEK...................E..E..SDE.........DMG..FGLF..............................
W5JMB2_ANODA/231-315                   ........................................................................YPTLASVPHSIAN......G.F.R.N.LL.....A.IAAV..T.......E....V.E...F.......KE............A.E...TV.K.E.F.IK.D.PSKF-A............................................AANASA..A.....P....A.......A......A......A....A..S....A...A..P....A......A...K....A.....E....E.KE...ESE-...................-..D..EDE.........DMG..FGLF..............................
A0A6A2ZGM1_HIBSY/23-113                .......................................................................l-ITAEKIATLVKA......A.N.V.S.VE.....S.YRPS..L.......F....A.K...L.......FE............K.C...DI.E.N.L.IT.N.VGAGGGga........................................pvAAAVSV..A.....A....A.......G......A......G....A..S....A...P..A....P......A...E....E.....K....K.KE...EP-E...................E..E..SDD.........DLG..FSLF..............................
A0A2K6UU45_SAIBB/17-114                ........................................................................SPSAKDIKKILDS......V.G.I.E.AD.....D.DRLN..K.......V....I.S...E.......LN............G.K...NI.E.D.V.IA.Q.GIGKLAsvpa....................................ggavAVSAAP..G.....S....A.......A......P......A....A..G....S...A..P....A......A...A....E.....E....K.KD...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
D7G7B6_ECTSI/10-100                    ........................................................................SPTKEDVTTALAA......V.G.I.E.CD.....E.ARLD..Q.......L....I.A...D.......MA............G.K...DI.A.A.L.IE.A.GKGKLAs.........................................fgGGGGGG..G.....G....G.......G......G......G....G..D....A...A..P....A......A...E....E.....K....K.VE...EEE-...................-..E..EEI.........DMG..GGM-dmf...........................
A0A0L0D948_THETB/17-104                ........................................................................SPSAADVEKILNA......V.G.S.E.VD.....S.TCTA..K.......V....I.E...S.......LN............G.Q...SV.E.A.L.IE.A.GQEKFAs..........................................vPTGAAA..P.....A....A.......G......A......A....P..A....A...G..D....A......P...A....A.....A....A.EE...EE--...................E..S..SDG.........SMG..FGLF..............................
A0A154NZP4_DUFNO/231-316               ........................................................................YPTLASAPHSIVN......G.F.K.N.LL.....A.IAAV..T.......D....I.E...F.......AE............A.A...TI.K.E.Y.IK.D.PSKF--............................................AAAAAV..V.....A....P.......V......A......A....A..A....E...A..P....A......A...E....K.....K....E.EK...KEET...................E..S..EDE.........DMG..FGLF..............................
F2X232_AILME/17-114                    ........................................................................SPSAKDIKKILDS......V.G.I.E.AD.....D.DRLN..K.......V....I.S...E.......LN............G.K...NI.E.D.V.IA.Q.GIGKLAsvpa....................................ggavTVSAAP..G.....S....A.......A......P......A....A..G....A...A..P....A......A...A....E.....E....K.KD...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A2C5WV68_9PEZI/17-107                .......................................................................a-PSKEQIVKILSS......V.G.I.E.SD.....D.ERLE..K.......L....L.S...E.......LE............G.K...NI.S.E.L.IA.E.GSAKLAsv........................................psGGAAAA..S.....S....G.......A......A......A....G..G....A...A..E....E......A...K....E.....E....A.KE...EEK-...................E..E..SDD.........DMG..FGLF..............................
A0A6I9SB91_ELAGV/71-162                .......................................................................p-ITAEKIMTLVKS......A.N.V.K.ID.....S.YWAP..L.......F....A.K...L.......LE............K.R...SV.E.D.L.IL.S.VGSGGGga.......................................vafSAAPAG..G.....A....D.......G......A......A....A..P....A...A..T....P......A...A....E.....E....K.KE...EPQ-...................E..E..SDD.........DMG..FSLF..............................
A0A3P6S7H1_LITSI/65-160                ........................................................................SPTAKDIENILGS......V.G.L.D.VD.....M.EDAN..K.......V....V.S...A.......LS............G.K...SI.D.E.V.IT.A.GLEKISsvsf...................................ggtasTVAPVT..S.....A....A.......P......A......G....A..P....E...T..G....S......K...K....E.....E....K.KE...EPK-...................E..E..SDD.........DMG..FGLF..............................
G8JUX7_ERECY/20-104                    ........................................................................EISSEKLLTLAKA......A.N.V.E.IE.....G.IWAD..I.......Y....A.R...A.......LD............S.Q...NL.K.D.L.LV.K.FEGG--............................................-AAAAP..V.....V....G.......A......A......A....G..G....A...A..A....E......E...E....A.....E....E.KE...EEAK...................E..E..SDD.........DMG..FGLF..............................
N4V8B6_COLOR/17-109                    ........................................................................SPSAADVKAVLES......V.G.I.E.AD.....D.ERLN..K.......L....I.S...E.......LE............G.K...DI.N.E.L.IS.E.GSSKLAsvp......................................sggAGGAAP..A.....A....G.......A......A......A....G..G....A...A..A....D......E...P....E.....A....P.KE...EEK-...................E..E..SDD.........DMG..FGLF..............................
A0A6J1JAB2_CUCMA/47-136                .......................................................................a-ITADKIAAVVAA......A.G.L.C.VE.....S.YWPS..L.......F....A.K...L.......AE............K.R...DI.G.D.L.LL.N.VGCGGGa.........................................aaPVSVAA..S.....A....G.......G......A......S....A..S....A...A..A....P......A...V....E.....E....K.KE...EPK-...................E..E..SDD.........DMG..FSLF..............................
A0A5A8CCW5_CAFRO/665-750               .......................................................................t-PTEADVSKILAA......A.G.A.E.AD.....A.EAVE..R.......L....F.K...A.......VA............E.Q...DL.S.K.V.LD.A.GMKKLV............................................KIGGGG..A.....A....A.......P......A......G....G..A....A...A..A....A......A...V....E.....E....E.EE...EEE-...................E..E..ESV.........AAG..-GMF..............................
A0A341D826_NEOAA/22-113                .......................................................................t-VTEDKINALIKA......A.G.V.N.VE.....P.FWPG..L.......F....A.K...A.......LA............N.V...NI.G.S.L.IC.N.VGAGGPa..........................................pAAGATP..A.....G....G.......P......A......P....S..T....T...A..D....P......A...E....E.....K....K.VE...AKKEe.................sE..E..SED.........DMR..FGLF..............................
A0A0E0IXV3_ORYNI/687-772               ........................................................................YPTIAAAPHMFLN......G.Y.K.N.VL.....A.VAVE..T.......E....Y.S...Y.......PH............A.D...KI.K.E.Y.LK.D.PSKF--............................................AVAAPV..A.....A....A.......D......S......G....A..A....A...V..A....A......S...K....E.....E....E.KK...EEPE...................E..E..SDV.........---..----knylgls.......................
D7LPU7_ARALL/17-115                    ........................................................................NPTSNDLKKILES......V.G.A.E.ID.....E.TKID..L.......L....F.S...L.......IK............D.H...DV.T.E.L.IA.A.GREKMAalssg..................................gpavaMVAGGG..G.....G....G.......G......G......A....S..A....A...E..P....V......A...E....S.....K....K.KV...EEVK...................D..E..SSD.........DAG.mMGLF..............................
A4FVF5_XENLA/17-110                    ........................................................................SPSAGDIKSILKS......V.G.I.D.AD.....D.ERVK..K.......V....I.G...E.......LG............G.K...DL.D.D.V.VN.S.GLAKLSsvp......................................sggAAAAAP..A.....S....T.......P......A......A....G..G....A...A..P....A......E...K....K.....E....E.EK...KEES...................E..E..SDD.........DMG..FGLF..............................
A0A2G9GVC5_9LAMI/17-114                ........................................................................SPSADDLKDILAS......V.G.A.D.AD.....E.DRIE..L.......L....L.S...Q.......VK............D.K...DV.T.E.L.IA.A.GREKLAsvpa....................................gggaVAIAAP..A.....G....G.......A......S......G....G..A....A...P..A....A......A...A....E.....T....K.KE...EKVEe.................kE..E..SDD.........DMG..FSLF..............................
A0A498KJ55_MALDO/391-475               .......................................................................a-VTAEKIAALVKS......A.N.V.S.VE.....S.YWPG..L.......F....A.K...L.......AE............K.K...NL.E.D.L.FL.N.ACASGG...........................................sAPVAVT..A.....S....A.......G......G......A....G..G....A...A..S....A......A...A....P.....A....V.EE...KKT-...................-..-..---.........---..----vgedhleaa.....................
A0A0R3SI00_HYMDI/231-320               .......................................................................y-PNFASVGHMIAD......G.F.K.N.LL.....A.LSAA..T.......D....Y.T...F.......KE............S.E...QI.K.E.Y.LN.D.PSKFAT............................................AAPAAV..E.....A....V.......A......P......A....D..A....T...AptK....A......A...E....E.....T....K.KE...ESEE...................E..E..SDE.........DMG..FNLF..............................
A0A6P6EPZ4_OCTDE/232-317               ........................................................................YPTVASVPHSIIN......G.Y.K.R.VL.....A.LSVE..T.......D....Y.T...F.......PL............A.E...KV.K.A.F.LA.D.PSAF--............................................VAAAPV..A.....A....A.......T......T......A....A..P....A...A..A....A......A...P....A.....K....V.ET...KEES...................E..E..SDE.........DMG..FGLF..............................
A0A016VCV0_9BILA/17-92                 ........................................................................SPSAKDILKILGA......G.G.L.D.CD.....M.EDAN..K.......V....V.D...A.......LA............G.K...SI.A.E.L.IE.E.GKKKLSsvp......................................sggSAAPAA..A.....P....A.......A......G......G....G..G....G...S..A....P......K...D....-.....-....-.--...----...................-..-..---.........---..----apr...........................
A0A1J6K3D1_NICAT/234-321               .......................................................................y-PTLAAAPYMFVK......G.Y.K.N.VL.....A.LALQ..T.......D....Y.S...Y.......PQ............A.H...QV.K.E.Y.IK.D.PSKFTV............................................AIAAAA..E.....S....A.......A......S......Q....G..D....G...D..V....V......K...T....K.....Q....D.KK...EDEA...................E..E..SED.........DAI..FGLF..............................
A0A3A5W6R8_9ARCH/16-99                 ........................................................................EIDEKAVTAVLKA......A.G.V.D.AD.....A.ARVK..A.......L....V.A...S.......LS............G.V...DI.A.E.A.MA.T.AVAA--............................................PAAAAP..A.....A....A.......A......A......S....E..D....A...A..P....A......A...E....E.....A....E.EE...EE--...................-..E..AGG.........FEG.lGSLF..............................
G3SDP0_GORGO/231-316                   ........................................................................YPTVASVPHSIIN......G.Y.K.R.VL.....A.LSVE..T.......D....Y.T...F.......PL............A.E...KV.K.A.F.LA.D.PSAF--............................................VAAAPV..A.....A....A.......T......T......A....A..P....A...A..A....A......A...P....A.....K....V.EA...KEES...................E..E..SDE.........DMG..FGLF..............................
U6MU67_9EIME/9-107                     .......................................................................a-PTAADVSRVLEA......V.G.A.E.VN.....P.EVLK..T.......L....I.D...A.......MQ............G.K...TA.H.E.V.IS.A.GLEKLQkvpcg.................................ggaaaaAAPAAA..A.....A....A.......A......G......G....G..D....S...S..S....A......A...K....D.....K....K.KE...EPEE...................E..E..EDA.........DMG..LSLF..............................
A0A7H9HLM3_9SACH/17-110                ........................................................................SPSVADIKSVIEA......V.G.V.E.AE.....E.SRIN..E.......L....L.S...S.......LE............G.K..gSL.E.E.I.IA.E.GQQKFAtvp......................................aggAGVSGG..A.....A....A.......G......G......A....A..G....G...A..E....A......A...E....E.....E....A.AE...EAK-...................E..E..SDD.........DMG..FGLF..............................
A2FUC9_TRIVA/17-102                    .......................................................................k-PTADQVKKILEA......A.G.V.D.ID.....A.AQLE..Q.......V....V.T...K.......MN............E.K...AV.E.E.L.VE.T.GKNEMGk..........................................vA----G..A.....A....P.......A......A......S....A..A....A...P..A....A......A...A....E.....V....P.KE...EAK-...................-..E..EE-.........---..----apmpiglddm....................
K3YIN8_SETIT/234-317                   ........................................................................YPTLAAAPHMFIN......G.Y.K.N.VL.....A.VAVE..T.......D....Y.S...Y.......PH............A.D...KI.K.E.Y.LK.D.PSKF--............................................-AVAAP..V.....A....A.......V......G......S....G..A....A...A..A....P......K...E....E.....E....K.AP...EPA-...................E..E..SDE.........EMG..FSLF..............................
A0A151X8W5_9HYME/231-317               ........................................................................YPTVASAPHSIVN......G.F.K.N.LL.....A.VAAV..T.......E....V.E...F.......AE............A.T...TI.K.E.Y.VK.D.PSKF--............................................AVAAAA..V.....A....T.......P......A......A....A..A....T...D..A....P......A...A....E.....K....K.EE...KKEE..................sD..S..EDD.........DMG..FGLF..............................
A0A061ED56_THECC/66-142                .............................................vvdssggvtssfslitpnstvfqviig-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.GGGGGGf.........................................lgGGAAAP..A.....R....G.......T......T......P....T..V....E...A..P....A......A...K....E.....K....K.KE...EKVK...................E..S..DDE.........DTG..FSLF..............................
A0A6P6SF28_COFAR/234-321               .....................................................................ypa---LSAAPHMLIN......G.Y.K.N.AL.....A.IAVE..T.......E....Y.S...F.......PQ............A.D...EV.K.E.Y.LK.D.PSKFAA............................................AVSAAP..A.....P....A.......P......G......D....G..G....A...A..A....A......N...E....E.....K....K.PE...PVEE...................E..E..EDE.........DLG..LSLF..............................
A0A6A4JGC7_APOLU/1-90                  .......................................................................g----EKIQTILKA......A.A.V.D.IE.....P.YWPG..L.......F....A.K...A.......LE............G.I...NP.K.D.L.IT.S.IGSGVGsg.......................................apaA----G..G.....A....A.......P......A......A....A..A....G...G..A....A......P...A....E.....A....K.KE...EKKKve...............sdP..E..SDD.........DMG..FGLF..............................
A0A4U0VR39_9BASI/229-312               ........................................................................YPTLASVTHSLVN......T.Y.K.R.VL.....A.VALE..T.......D....Y.T...F.......PE............V.E...AL.K.D.R.LA.N.PEAY--............................................AAAAPA..A.....D....A.......G......A......A....A..G....G...A..A....A......K...E....E.....K....P.AE...EEE-...................-..E..SDD.........DLG..FGLF..............................
R1EJ84_EMIHU/17-113                    ........................................................................SPSAADVTSILDS......V.G.V.E.PD.....S.EKLE..K.......L....L.G...S.......LE............G.K...DL.V.E.V.LA.A.GKAKMAampsgg................................ggggggGGGGGG..D.....A....A.......P......A......A....G..E....A...A..A....A......P...A....E.....K....A.PE...PE--...................-..E..EEE.........EMG..FDLF..............................
A0A0D2DFG5_9EURO/229-314               ........................................................................YPTLPSVIHSLVN......G.Y.K.N.LI.....S.VALE..V.......D....Y.S...W.......EA............I.E...EL.K.D.R.IA.N.PDKYA-............................................SAAPAA..A.....A....A.......S......S......G....G..A....A...P..A....A......A...K....E.....E....E.KE...EEKE...................E..S..EDE.........GFG..-GLF..............................
A0A6P8TPK2_GYMAC/22-112                .......................................................................t-VTEDKLNALIKA......A.G.V.T.VE.....P.FWPS..L.......F....A.K...A.......LS............S.I...DI.G.S.L.IC.N.VGAGGGa.........................................paAGGAPA..A.....G....A.......P......A......A....G..G....E...A..P....A......K...E....E.....E....K.KE...ESEA...................E..A..SDD.........DMG..FGLF..............................
H2AX77_KAZAF/229-310                   ........................................................................YPTLPSVGHTLIN......N.Y.K.D.LL.....A.VAIG..S.......G....Y.H...Y.......AE............I.E...EL.V.D.R.IE.N.PDKY--............................................-ASAAP..V.....A....A.......A......G......A....S..E....S...A..P....A......E...A....A.....A....E.EE...EE--...................-..E..SDA.........DMG..FGLF..............................
A0A267ERC2_9PLAT/15-105                ........................................................................EVTGDKISAILKA......A.G.V.T.VE.....P.FWPN..M.......F....A.R...A.......LS............G.V...KV.K.D.L.LS.N.VGSSVGa.........................................apAAGAAA..P.....E....A.......A......A......A....A..A....E...P..A....A......A...K....G.....K....A.KE...PEPE...................S..E..SDD.........DMG..FDLF..............................
A0A4Y9Y6T2_9AGAM/17-110                ........................................................................SPSAADVKKVLGA......V.G.V.E.AD.....E.ERLG..K.......L....I.S...E.......LE............G.K...DI.A.T.L.IN.E.GNSKLAsvp.....................................sggaGGAAAP..A.....A....G.......G......A......A....P..A....A...A..E....E......K...A....E.....E....K.KE...EEK-...................E..E..SDD.........DMG..FGLF..............................
A0A059DCP2_EUCGR/17-105                .......................................................................c-PSADDLKDILGS......V.G.A.E.AD.....D.DRIE..L.......L....L.S...E.......VK............G.K...DI.T.E.L.IA.A.GRERLAs.........................................vpSGGGGA..V.....A....V.......A......A......A....P..G....A...A..E....A......K...K....E.....E....K.VE...EK--...................E..E..SDD.........DMG..FSLF..............................
A0A0D3AWE2_BRAOL/17-112                .......................................................................k-PTKDDLKSIFDS......V.G.A.E.FD.....E.AETD..L.......L....F.S...L.......VK............D.H...DV.A.E.L.IA.A.GREKMGalss....................................ggagVAMVSG..A.....G....G.......D......A......P....S..A....A...E..P....A......A...E....T.....K....K.VE...EEK-...................E..E..SDD.........GEG.mMSLF..............................
A0A6S7PIG6_LACSI/233-320               ........................................................................YPTIAAAPHMLIN......G.Y.K.N.AL.....S.IAVA..T.......D....Y.T...F.......PL............A.D...KV.K.E.Y.LA.D.PSKFAV...........................................aAPVAAA..A.....S....G.......G......A......P....A..A....A...A..A....A......P...V....E.....E....K.KE...EEA-...................E..A..SDD.........DMG..FGLF..............................
A0A195CJ37_9HYME/231-317               ........................................................................YPTVASAPHSIVN......G.F.K.N.LL.....A.VAAV..T.......D....V.E...F.......AE............A.T...TI.K.E.Y.IK.D.PSKF--............................................AVAAAA..V.....A....T.......P......A......A....A..A....T...D..A....P......A...A....E.....K....K.EE...KKEE..................sD..S..EDD.........DMG..FGLF..............................
A0A1U7QK56_MESAU/22-113                .......................................................................t-VTEDKINALIKA......A.G.V.N.VE.....P.FWPG..L.......F....A.K...A.......LA............N.V...NI.G.S.L.IC.N.VGAGGPa..........................................pAAGAAP..A.....G....G.......P......A......P....S..T....A...A..A....P......A...E....E.....K....K.VE...AKKEe.................sE..E..SDD.........DMG..FGLF..............................
M0CQB0_9EURY/16-113                    ........................................................................EINEDNLTDVLDA......A.G.V.D.VE.....E.SRVK..A.......L....V.A...A.......LE............D.V...DI.D.E.A.VE.E.AAAVPA............................................GGAAAG..G.....A....A.......A......A......E....G..G....D...E..E....G......D...E....E.....E....A.SD...V--Pdtt.............dedE..-..-DE.........D--..----edeeasgeglgelf................
A0A200R957_9MAGN/51-120                ..............................................vsssfsmitpssavfqviiggggggg-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.-----Gsf........................................vsGGAAAA..A.....S....S.......G......G......A....A..A....A...E..A....P......A...A....E.....E....K.KE...EKE-...................-..E..SDD.........DMG..FSLF..............................
A0A507DXA6_9FUNG/23-108                ........................................................................EITAEKINSLISA......A.G.V.D.VE.....P.IWAT..L.......F....A.K...A.......LA............G.K...NV.G.D.F.LF.N.VGSAGP............................................AAPAAG..G.....A....A.......A......G......G....A..A....A...E..A....P......K...E....E.....A....K.EE...AK--...................E..E..SDD.........DMG..FGLF..............................
Q12UP7_METBU/16-99                     .......................................................................d-ITEESVSAVLSA......A.G.T.E.VN.....E.SRAK..A.......L....V.A...A.......LE............D.V...DI.E.E.A.MA.T.AAFA--............................................----PA..A.....A....V.......V......A......A....P..V....A...E..T....A......A...E....E.....V....P.AE...ENKA...................E..E..EES........gMAG.lGALF..............................
A0A367XQY6_9ASCO/20-106                ........................................................................EITSEKLLALVTK......A.N.V.E.VE.....G.IWAD..L.......F....A.K...A.......LE............G.K...DL.K.E.F.FF.N.FSAA--............................................PAAAAG..A.....A....G.......A......G......A....A..G...aA...A..E....E......A...A....E.....E....E.KE...EEAK...................E..E..SDD.........DMG..FGLF..............................
U1HEL1_ENDPU/17-113                    ........................................................................SPSASDIKGVLES......V.G.I.D.AE.....D.DRLE..K.......L....L.S...E.......LK............D.K...DI.S.T.L.IQ.E.GSSKLAsvps....................................ggagGGAGAG..G.....A....A.......P......A......A....G..G....A...A..A....A......E...E....E.....K....P.AE...KEEE..................kE..E..SDE.........DMG..FGLF..............................
A0A2H0ZMX0_CANAR/20-107                ........................................................................EISADKLATLTAK......A.D.V.Q.VE.....P.IWTE..I.......F....A.R...A.......LE............G.K...DL.K.E.L.FF.N.IQAAPA...........................................aGAAAAG..A.....G....A.......A......A......A....G..G....A...E..D....A......A...A....E.....E....K.EE...EA-K...................E..E..SDD.........DMG..FGLF..............................
A0A7H8QQJ9_9EURO/21-109                .......................................................................d-ITADKLNTLIKA......A.N.VpD.VE.....P.IWAQ..L.......F....A.K...A.......LD............G.K...DV.K.D.L.LT.N.VGSGG-............................................GAAAAP..A.....A....G.......G......A......A....A..G....G...E..A....A......A...E....E.....A....K.EE...KAEE..................aE..E..SDE.........DMG..FGLF..............................
D4AV09_ARTBC/21-109                    ........................................................................EITSDKLQTLIKA......A.G.VtD.VE.....P.IWTS..L.......F....A.K...A.......LD............G.K...NL.K.D.I.LV.N.VGSGGGa..........................................pAAGGAP..A.....A....G.......G......A......A....A..A....E...A..A....P......A...E....E.....E....K.AE...EAE-...................-..E..SDE.........DMG..FGLF..............................
A0A017S3R6_9EURO/229-310               ........................................................................YPTLPSVMHSLVN......G.Y.K.K.VL.....S.VAVE..T.......E....Y.S...W.......PE............I.D...EL.K.D.R.IA.N.PEAY--............................................---ASA..A.....P....A.......A......A......A....P..S....G...G..D....A......P...A....E.....K....K.EE...EEE-...................E..E..SDA.........DMG..FGLF..............................
I1JPZ4_SOYBN/17-112                    .......................................................................a-PSADDLRDILGS......V.G.A.D.AN.....D.DNIS..N.......F....L.S...E.......VK............G.K...DI.V.E.L.IA.S.GREKLAsvp......................................sggGAAVAV..A.....A....A.......P......G......G....G..P....A...A..P....A......A...A....E.....S....K.KE...EKVEe.................kE..E..SDD.........DMG..FSLF..............................
W4J340_PLAFP/1-47                      ...................................................................qnigg-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.------............................................GVAAAP..A.....G....A.......A......A......V....E..T....A...E..A....K......K...E....D.....K....K.EE...KKEE..................eE..E..EED.........DLG..FSLF..............................
A0A165CDA1_9APHY/229-314               ........................................................................YPTIVSVMHSLVN......A.Y.K.N.VL.....A.VSIA..T.......D....Y.T...F.......EG............S.E...KI.K.E.V.LA.N.PEAFA-............................................AAAAAA..A.....P....A.......A......E......A....A..A....A...E..A....E......A...A....P.....A....A.KE...EEE-...................E..E..SEG.........DMG..FGLF..............................
A0A5N7CRZ9_PETAA/229-311               .......................................................................f-PTLPAVMHHVIN......S.Y.K.K.VL.....A.VAIS..T.......E....I.S...W.......PE............I.E...EL.K.D.R.IA.N.PDAY--............................................AAAAPA..A.....S....A.......A......P......A....A..G....G...A..A....P......A...E....E.....K....K.EE...EE--...................-..E..SDD.........DMG..FGLF..............................
A0A5C7IWG5_9ROSI/17-112                ........................................................................SPSAEDLKKILGS......V.G.A.E.ID.....E.ERIQ..L.......L....L.S...E.......IK............G.K...DL.T.E.L.IA.S.GREKLAsvps....................................ggggAVAFAA..T.....G....A.......A......T......G....G..G....A...A..P....A......A...A....E.....A....K.KE...EKVEe.................kE..E..SDD.........---..----vsfll.........................
A0A1F5LFD3_9EURO/229-312               .......................................................................y-PTIPATMHSLIN......G.Y.K.K.VL.....A.VAVE..T.......A....Y.S...W.......PE............I.D...EL.K.D.R.IA.N.PDAY--............................................ASAAPA..A.....A....A.......A......A......T....S..G....G...D..A....P......A...A....A.....A....P.AE...DEE-...................-..E..SDE.........DMG..FGLF..............................
A0A4U5P4J4_POPAL/19-124                ..............qisdgnieasasstfelqrklvqsalsadssgavqssfsyvtpssavfqvviggstgg-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.-----Affgg....................................ggggGAVAAP..A.....G....G.......A......T......S....A..A....E...A..P....A......A...E....E.....K....K.KE...EEP-...................-..E..SDD.........DMG..FSLF..............................
A0A5N4CV35_CAMDR/1-90                  .......................................................................m---EDKVNALIKA......A.A.I.N.VE.....P.FWPG..L.......F....A.K...A.......LA............N.I...DM.E.S.L.IC.N.IGAGGPa..........................................pAAGAAP..A.....G....G.......P......A......L....S..T....I...T..A....T......A...E....E.....K....K.VE...AKKEe.................sE..E..SDD.........DMG..FGFF..............................
A0A0D2BED2_9EURO/17-112                ........................................................................EPSADDIKGVLSS......V.G.V.D.AD.....D.ERLE..K.......L....I.G...E.......LK............G.K...DI.S.E.L.IA.E.GSTKLAsvp......................................sggAGGAAP..A.....A....G.......G......A......A....A..G....G...A..A....A......A...E...eE.....K....P.AE...KEEE..................kE..E..SDE.........DMG..FGLF..............................
A0A0D2VUN1_CAPO3/231-314               .......................................................................f-PTVASVPHSIVN......A.Y.K.N.VL.....A.VVAE..I.......D....Y.T...F.......KQ............A.E...KL.K.A.Y.LA.N.PSAF--............................................--AAAA..A.....P....V.......A......V......A....A..K....T...E..A....K......K...E....E.....P....K.KE...EKKE...................E..S..EEG.........DMG..FGLF..............................
A0A2T7D2R2_9POAL/21-108                .......................................................................p-ITAEKIATVVKA......A.N.V.K.VE.....S.YWPA..L.......F....A.K...L.......LE............K.R...SV.E.D.L.IL.S.VGSGGG...........................................aAPVAAA..A.....P....A.......G......G......A....A..A....A...A..A....P......A...V....E.....E....K.KE...EAK-...................E..E..SDD.........DMG..FSLF..............................
A0A4W6DP41_LATCA/1-86                  .......................................................................m------LNALIKA......A.G.V.T.VE.....P.FWPS..L.......F....A.K...A.......LS............S.I...DI.G.S.L.IC.N.VGAGGG...........................................aPAGAPA..A.....G....A.......A......A......A....A..G....D...A..P....A......K...E....E.....E....K.KE...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A5J5AKM5_9ASTE/329-414               ..............................................................tgkahsedaw-------------......-.-.-.-.--.....-.----..-.......-....I.S...A.......QE............L.K...KL.D.E.R.LR.N.NLVSNSqviigggg............................gggfigggGAAAAA..A.....P....P.......G......G......A....T..A....A...V..A....P......P...A....E.....E....K.KE...EK--...................E..E..SDD.........IMG..FSLF..............................
A0A6I9T1P4_SESIN/44-130                .......................................................................p-ITAEKIATLVKA......A.N.V.T.VE.....S.YWPS..L.......F....A.K...L.......CE............K.R...NI.D.D.L.VM.N.VGSGGG...........................................gAAIAAA..A.....P....A.......G......G......A....S..G....G...A..P....A......A...E....E.....K....K.EE...PKE-...................-..E..SDD.........DMG..FSLF..............................
I3J3T8_ORENI/22-113                    .......................................................................t-VTEDKLNALIKA......A.G.V.T.VE.....P.FWPS..L.......F....A.K...A.......LS............S.I...DI.G.S.L.IC.N.VGAGGGa..........................................pAGVAAA..A.....G....G.......T......T......A....A..G....D...A..P....A......K...E....E.....E....K.KE...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
F4Q1Q9_CAVFA/17-102                    .......................................................................p-VNADNINKVAKA......A.N.I.T.VR.....S.FEVE..T.......V....V.R...A.......LS............K.K...SV.E.S.I.IA.S.AAVA--............................................APSAAA..A.....A....P.......V......A......A....A..A....A...A..P....V......A...A....A.....K....K.VV...EEKK...................E..E..SDD.........DMG..MGLF..............................
M7T3Z7_9ARCH/16-107                    .......................................................................d-INEENLKKILTA......A.G.V.K.AD.....D.ARVK..A.......L....T.A...S.......LD............G.V...NI.E.E.A.IK.T.AAVPVA...........................................aAPVATP..G.....A....P.......A......V......E....G..E....A...A..E....K......K...E....E.....K....K.KE...KEKPe.................vS..E..EEA.........AAG.lGALF..............................
A0A063BT28_USTVR/22-108                .......................................................................d-ITSDKLQALIKA......A.G.IqD.VE.....P.IWTS..I.......F....A.K...A.......LE............G.K...DI.K.D.L.LV.N.VGSG--............................................GGAAAP..A.....A....A.......G......G......A....A..A....G...G..D....A......A...P....A.....E....E.EK...EEEK...................E..E..SDE.........DMG..FGLF..............................
A0A6I9RRH0_ELAGV/23-121                ........................dleasafstydlqrklvqaalatdssggvnssfsmvtpssavfqviig-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.GGGGGAfi........................................ggAAAGGA..A.....A....G.......S......A......A....G..G....A...A..P....E......A...P....P.....A....E.EK...KEEK...................E..E..SDE.........DMG..FSLF..............................
A0A3Q0EHY5_CARSF/180-265               ........................................................................YPTVASVPHSIIN......G.Y.K.R.VL.....A.LSVE..T.......E....Y.T...F.......PL............A.E...KV.K.A.F.LA.D.PSAFVA............................................--AAPV..A.....A....A.......A......P......A....A..P....A...A..L....A......A...P....A.....K....V.EA...KEES...................E..E..SDE.........DMG..FGLF..............................
A0A2H3CEN0_9AGAR/229-311               ........................................................................YPTIVSVAHSLVN......A.Y.K.N.VL.....A.ISLA..T.......E....Y.T...F.......DG............S.E...KV.K.E.Y.LA.N.PDAF--............................................AV-AAA..P.....A....A.......A......E......A....A..P....A...A..A....A......V...E....E.....K....E.PE...KEE-...................-..E..SDD.........DMG..FGLF..............................
A0A3S0Z9A8_ELYCH/231-315               .......................................................................i-PTAASAPHSIAN......G.F.K.N.LL.....A.VAVM..T.......D....F.T...F.......PE............A.E...QT.K.E.Y.LK.D.PSKF--............................................AA-VAA..A.....A....A.......P......T......S....A..A....A...A..P....A......A...E....T.....K....A.AA...KEES...................E..E..SDD.........DMG..FGLF..............................
A0A0G2K4Q1_RAT/60-92                   ....................................................................piht-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.------............................................------..-.....-....-.......-......A......A....A..P....A...E..E....K......K...V....E.....T....K.KE...ES--...................E..E..SED.........DMG..FGLF..............................
G7KGX1_MEDTR/234-320                   ........................................................................YPTLAAAPHMFVN......A.Y.K.N.VL.....A.VAVA..T.......E....Y.S...F.......PE............A.D...KV.K.E.F.LK.D.PSKFAV............................................AAVAAP..A.....D....V.......S......G......A....T..P....A...P..A....A......A...A....A.....A....A.AA...EPE-...................E..E..SDD.........DIG..FGLF..............................
A0A0V0X2Y9_9BILA/251-339               ........................................................................YPTAASAPHMIAN......A.F.K.N.LL.....S.IAAV..T.......D....I.T...F.......KE............A.E...KL.K.E.Y.LA.D.PSKFAV............................................AAAPAA..A.....A....A.......D......S......S....K..A....E...K..E....D......S...S....S.....K....K.KE...EKVE...................E..E..SDE.........EEG.mGGLF..............................
A0A1S7HIY6_9SACH/20-106                ........................................................................EISSDKLLSLTNA......A.N.V.P.VE.....G.IWAD..I.......F....S.R...A.......LE............A.Q...NL.K.D.L.LV.N.FSAGAS............................................VGGVAG..V.....A....G.......G......A......S....G..E....A...A..G....E......G...E....E.....E....K.EE...EAK-...................E..E..SDD.........DMG..FGLF..............................
A0A3L6QLE0_PANMI/158-238               ...................................................................itpve---------LIKK......G.D.K.N.VL.....A.VAVE..T.......D....Y.S...Y.......TH............A.D...KI.K.E.Y.LK.D.PSKF--............................................-AVAAP..V.....A....T.......A......D......S....G..A....A...A..A....P......K...E....E.....E....K.KA...EEPA...................E..E..SDD.........DMG..FSLF..............................
A0A1C7NK93_9FUNG/20-105                ........................................................................EITADKLQALVAA......A.G.I.E.VE.....P.IWFS..L.......Y....A.K...A.......LA............G.Q...DL.K.A.L.LL.N.VGAP--............................................GAGPAV..A.....A....G.......G......A......A....A..G....G...A..A....D......A...P....A.....E....E.EK...AEEK...................E..E..SDD.........DMG..FGM-l.............................
A0A1J4L1F2_9EUKA/21-105                ........................................................................EVSADNVNKLLSA......A.G.V.K.LE.....S.YWVD..L.......F....A.E...Y.......FK............S.H...DI.S.E.L.VK.G.TCLG--............................................--GAAP..A.....A....G.......A......A......A....A..G....G...A..A....A......E...E....T.....K....E.EK...KEEE...................E..V..---.........---..----velaggfddlf...................
A0A2A9PE40_9HYPO/229-312               .......................................................................f-PTMPSVMHSVVN......G.Y.K.K.LL.....A.VAIE..T.......E....Y.S...W.......PE............I.E...EL.K.D.R.IA.N.PDAY--............................................ASAAPV..A.....A....A.......G......G......A....G..G....G...K..P....A......A...E....E.....K....K.EE...SEE-...................-..D..SDD........pGMG..-GLF..............................
A0A319C0N5_9EURO/17-108                ........................................................................SPSAEDIKSVLSS......V.G.I.D.AD.....E.ERLT..K.......L....I.A...E.......LE............G.K...DL.Q.E.L.IA.E.GATKLAsvp......................................sggAGAAAP..A.....A....A.......A......G......A....A..A....G...G..D....A......P...A....E.....E....K.EE...EKE-...................-..E..SDE.........DMG..FGLF..............................
A0A4U0XIG1_9PEZI/17-112                ........................................................................SPSAEDIKGVLEA......V.G.I.E.AD.....E.TRLD..K.......L....I.E...E.......LK............G.K...DI.N.E.L.IA.E.GSSKLAsvps....................................ggsgGAAASG..G.....A....A.......P......A......A....G..G....A...A..A....A......E...E....E.....A....P.AK...EEEK...................E..E..SDE.........DMG..FGLF..............................
A0A094E2H5_9PEZI/60-137                ......................................................................qr-------------......-.-.-.-.AD.....S.ERLD..A.......L....I.A...E.......LK............G.K...DI.N.T.L.IS.E.GSAKLAsvp......................................sggGGGAAA..A.....G....G.......A......A......A....G..G....A...A..E....A......A...P....A.....E....E.KE...EEK-...................E..E..SDE.........DMG..FGLF..............................
A0A3Q7PBY0_CALUR/8-86                  .......................................................thiysalilqddevpgt-------------......-.-.-.-.--.....-.---E..T.......K....I.N...A.......LA............D.V...NI.R.R.L.IC.N.VGTGG-............................................-PAPAG..G.....P....A.......P......S......T....T..A....A...P..A....E......K...K....V.....E....A.KK...EES-...................E..E..SED.........DMG..FGLF..............................
A0A091D0U3_FUKDA/22-113                .......................................................................t-VMEDKINALIKA......A.G.V.N.GK.....P.FWPG..L.......F....E.K...A.......LA............I.V...NI.G.S.L.TC.N.AGAGGPa..........................................pAAGAAP..A.....G....G.......P......A......A....S..T....T...A..A....P......A...E....E.....K....K.VE...AKKEe.................sE..E..SDD.........NMG..FGVF..............................
I7MA52_TETTS/93-183                    ........................................................................QPSEADVKALIES......V.N.G.T.VD.....A.TKLS..S.......F....M.N...V.......IK............G.K...NI.E.D.V.IK.A.GLSKVGn.........................................igGAAPAA..A.....P....A.......A......A......T....K..A....P...E..A....K......K...E....E.....P....K.KE...EPKK...................-..E..EDD.........FEG.aGDLF..............................
A0A484F2Q4_9EURY/16-100                ........................................................................EITEDSVKAVLAA......A.G.A.D.VD.....D.ARVK..A.......L....I.S...A.......LD............G.V...DI.E.E.A.IA.K.AA-F--............................................AAPAAA..A.....P....A.......A......A......A....E..A....A...P..A....A......A...E....A.....A....P.EE...EDH-...................S..E..EEG.........MAG.lGALF..............................
A0A1S3E015_CICAR/21-111                .......................................................................a-ITAEKINTMLKA......A.G.A.T.VE.....S.YRPS..L.......F....A.K...L.......AQ............N.K...SI.D.D.L.VL.N.AGAAGGav........................................vvVSAPAA..A.....A....A.......G......G......A....A..A....A...A..A....P......A...A....E.....A....K.KE...EAK-...................E..E..SDD.........DMG..FSLF..............................
A0A0D2MQK0_HYPSF/229-311               ........................................................................YPTIVSVSHTLVN......A.Y.K.N.VL.....A.ISLA..T.......E....Y.T...F.......EA............S.E...KI.K.E.Y.LA.N.PDAF--............................................-AVAAP..V.....A....A.......A......A......D....A..P....A...A..A....A......A...V....E.....E....K.EE...EKE-...................-..E..SDD.........DMG..FGLF..............................
A0A1J1H4Q7_PLARL/32-117                ........................................................................SITSDNILKLIKK......S.K.N.T.VL.....P.YLPM..L.......F....E.K...A.......LK............G.K...DI.E.G.L.LT.N.LNVG--............................................GAPSPS..A.....Q....V.......T......T......E....K..P....S...E..E....K......K...E....A.....K....K.EE...KVEE...................E..E..EED.........DLG..FSLF..............................
A0A1L9PUF3_ASPVE/17-113                ........................................................................EPSGEDIKEVLAS......V.G.I.Y.AD.....E.SRLG..Q.......L....L.D...E.......LR............G.R...DI.N.E.L.IA.E.GTSKLAtigs....................................nasgGGDNVP..D.....T....E.......K......G......A....D..D...gS...G..S....A......N...G....G.....S....D.AD...GDED...................E..D..EDG.........DFG..LGLF..............................
B6H919_PENRW/229-311                   ........................................................................YPTLPSVMHSLIN......G.Y.K.K.VL.....A.AAIS..T.......D....Y.S...W.......AE............I.D...EL.K.D.R.IA.N.PDAY--............................................-ASAAP..V.....A....A.......A......A......T....S..G....G...E..A....A......A...A....A.....A....P.AE...EEE-...................-..E..SDE.........DMG..FGLF..............................
A0A4P1RD60_LUPAN/17-112                .......................................................................a-PSAHDLKNILSS......V.G.A.E.AD.....D.DRIE..L.......L....L.T...E.......VK............G.K...DI.T.E.L.IA.T.GREKLAsvp.....................................sgggAVAVAA..A.....P....A.......G......G......A....A..A....A...A..P....A......A...E....A.....K....E.EK...KAEE..................kE..E..SDD.........DMG..FSLF..............................
I2GVW8_TETBL/16-105                    .......................................................................t-PSADKVQAVLES......V.G.I.E.VE.....A.DKVS..S.......L....M.T...A.......LE............G.K...SV.E.E.L.VA.E.GTEKMAsv........................................paAGPAAS..G.....S....A.......G......A......A....A..G....A...A..D....A......A...E....E.....A....A.AE...EAE-...................-..E..SDD.........DMG..FGLF..............................
A0A2K5N115_CERAT/13-96                 .....................................................................alt----------LHA......T.G.V.N.VE.....P.FWSS..L.......F....A.M...A.......LA............N.V...NT.G.S.L.IY.N.VGAGGPa..........................................pAAGATP..A.....G....D.......P......A......H....S..T....T...A..A....P......A...K....E.....K....K.VE...AKK-...................E..E..SEEc.......dDMG..FS--rf............................
U1QTC0_9EURY/16-113                    ........................................................................EINEQNLTDVLEA......A.G.V.S.VE.....Q.SRVK..A.......L....V.A...A.......LE............D.V...DI.D.E.A.VD.E.AAAVPAg.........................................gaATGGAA..A.....G....G.......A......E......T....V..E....E...D..D....D......D...E....E.....V....E.EE...EAEE...................-..E..DDDdd....dddDAG..----eglgelf.......................
A0A654GPP4_9CEST/17-117                .......................................................................h-PAAEDIKAILDS......V.G.I.E.CE.....E.ERVN..N.......L....L.A...Q.......LK............G.K...NP.H.D.L.IA.A.GRAKLStvsvaap.............................aahaaggaAAPSAP..A.....A....A.......K......E......D....G..G....K...K..E....K......A...E....E.....K....K.PE...PE--...................E..E..SDD.........DMG..FSLF..............................
A0A0D3DC34_BRAOL/17-112                ........................................................................NPNKGDLKNIFDS......V.G.A.E.FD.....E.TKTD..L.......F....F.S...L.......VK............D.H...DV.T.E.L.IA.A.GREKMGals.....................................sgggAVAMVA..G.....A....G.......G......D......A....P..S....A...A..E....P......A...T....E.....S....K.KV...EEEK...................E..E..SDD.........GEG.mMSLF..............................
A0A7H8QHC0_9EURO/229-312               .......................................................................f-PTVPSVLHSVVN......T.Y.K.K.VL.....A.IAIE..T.......E....I.S...W.......PE............I.E...EL.K.D.R.IA.N.PDAY--............................................AA-AAP..A.....A....A.......A......A......A....T..D....G...G..A....A......P...A....A.....K....E.EE...EEE-...................E..E..SDE........gGFG..-GLF..............................
A0A5N7B1R9_9EURO/21-107                ........................................................................EVTADKLQTLLTA......A.K.VpE.VE.....P.IWTS..I.......F....A.K...A.......LE............G.K...DI.K.D.L.LT.N.VGSA--............................................-GAAAP..A.....G....A.......A......A......A....G..G....A...A..A....P......A...E....A.....A....A.EE...KEEE..................kE..E..SDE.........DMG..FGLF..............................
C6H5J3_AJECH/21-109                    ........................................................................EITADKLQTLLKA......A.N.VqD.VE.....P.IWST..L.......F....A.K...A.......LE............G.K...DV.K.D.L.LL.N.IGSGGG............................................AAAAVA..S.....G....A.......G......P......V....A..A....E...T..G....G......A...E....E.....K....V.EK...EEEK...................E..E..SDE.........DMG..FGLF..............................
A0A2K5JI75_COLAP/22-113                .......................................................................t-VTEDEINALIKA......A.G.V.N.VE.....P.FWPG..L.......F....A.K...A.......LA............N.V...NI.G.S.L.IC.N.VGAGGPa..........................................pAAGAAS..A.....G....G.......P......A......P....S..T....A...A..A....P......A...E....E.....K....K.VE...AKKEe.................sE..E..SDD.........DIG..FGLF..............................
J9K3E2_ACYPI/23-110                    .......................................................................d-ITGEKIQTVLKA......A.N.V.E.VE.....P.YWPG..L.......F....A.K...A.......LE............N.A...NV.K.D.L.IT.N.IGSAVG............................................AVPAAG..A.....A....A.......A......A......P....A..A....E...A..K....E......E...K....K.....E....E.KK...EE-E..................sE..E..EDD.........DMG..FGLF..............................
A0A4Z1NNC7_9PEZI/17-110                ........................................................................SPSAKDITELLQS......V.G.V.D.PD.....T.ERLE..K.......L....I.S...E.......LK............G.K...DI.N.E.L.IT.E.GSAKLAsvps....................................ggagGGAAAP..A.....A....G.......-......G......A....A..P....A...A..E....A......A...K....E.....E....E.KE...EEK-...................E..E..SDD.........DMG..FGLF..............................
A0A6J1PBK3_BICAN/22-111                .......................................................................a-VTGEKISTILKA......A.N.V.D.VE.....P.YWPG..L.......F....A.K...A.......LE............G.V...NV.R.D.L.IT.N.IGSGVG............................................AAPAGG..A.....P....A.......A......A......A....S..A....A...A..P....A......A...E....A.....A....K.EE...KKEEe.................pE..E..SDD.........DMG..FGLF..............................
A0A0Q4B8R9_9ARCH/231-332               ........................................................................YPTKQTINPLLVK......A.Y.R.-.-E.....A.TAVS..M.......K....A.A...I.......PT............R.D...NI.K.L.L.LA.K.ANAEMLavasripgl..........................eddrlkqqlTAQVAA..A.....P....A.......P......Q......E....K..K....A...E..E....K......K...D....E.....D....K.PE...V---...................S..E..EEA.........AAG.lSALF..............................
A0A3Q2ZEU3_KRYMA/17-114                .......................................................................s-PEAKDLKKILES......V.G.I.E.AD.....D.TRMT..K.......V....I.S...E.......LK............G.K...NV.N.E.V.IA.S.GYGKLAsmpa...................................ggavaVASSAG..A.....G....S.......G......G......A....A..A....P...A..A....A......A...E....E.....K....K.EE...KKEE..................sE..E..SDD.........DMG..FGLF..............................
A0A6H5JK28_9PHAE/110-193               .......................................................................f-PTLASLPHSIAN......A.F.R.A.LV.....G.VVIE..Gc.....dT....Y.S...F.......EQ............A.D...TI.K.A.I.LA.D.PSAF--............................................----AA..S.....S....G.......G......G......G....G..D....G...D..A....P......A...A....A.....A....P.VE...EEE-...................-..E..EEV.........DMG..GGM-smf...........................
A0A2U3V2E1_TURTR/22-113                .......................................................................t-VTEDKINALIKA......A.G.V.N.VE.....H.LWPG..L.......F....A.K...A.......LA............N.V...NI.G.L.L.MR.N.VRTGGPa..........................................pAADAAL..A.....G....G.......P......A......P....S..I....T...V..A....P......A...E....E.....K....K.AE...TKKE...................-..E..SEEs......ydGMC..FGLF..............................
M1D5E9_SOLTU/21-107                    .......................................................................p-ITAEKISTLVKA......A.N.V.T.VE.....P.YWPL..L.......F....A.K...L.......AE............K.R...NL.G.D.L.IM.N.VGAGGG...........................................gGAVAVA..A.....P....T.......G......G......A....A..A....A...A..P....A......A...E....E.....K....K.EE...PKE-...................-..E..SDD.........DMG..FSLF..............................
A4I2U1_LEIIN/238-323                   .......................................................................i-PTSSTIGPMLVD......A.F.K.N.LL.....A.VSVA..T.......S....Y.E...F.......EEh..........nG.K...EL.R.E.A.AI.N.GLLA--............................................--GSGS..A.....A....A.......E......P......A....A..A....A...P..A....A......P...S....A.....A....A.KE...EPE-...................E..S..DED.........DFG.mGGLF..............................
A0A6J1CC92_MOMCH/49-139                .......................................................................s-VTAEKIATLVKA......A.G.L.T.VE.....S.YWPS..L.......F....A.K...L.......SS............K.R...NI.D.D.L.IL.N.VGSAAAs.........................................apLSMASS..S.....S....A.......D......A......S....A..A....P...A..P....A......P...A....P.....V....E.KK...EEAV...................E..E..SED.........DLV..FGLF..............................
A0A6P9E0H4_JUGRE/234-320               .......................................................................y-PTLTAAPHAFIN......A.Y.K.N.AL.....G.VAVA..T.......E....Y.S...F.......PQ............A.E...QV.K.E.Y.LK.D.PSKFAA............................................MLAPVA..V.....A....D.......S......G......A....A..P....S...A..T....A......K...V....E.....E....K.KE...EPE-...................E..E..SDD.........DMV..LGLF..............................
A0A060S2P3_PYCCI/21-109                ........................................................................EITPDKILTLTSA......A.H.V.E.LE.....P.IWAT..L.......L....A.K...A.......LE............G.K...NV.K.D.L.LS.N.VGAGGAg..........................................pAAAAAP..A.....A....G.......A......S......A....G..A....A...A..E....A......P...K....E.....E....E.KK...EEK-...................E..E..SDD.........DMG..FGLF..............................
A0A6P5N2H7_ARADU/24-119                ..............................................diedsasstydlqrklvnaaraadss-------------......-.-.-.-.--.....-.GAVQ..S.......S....F.S...F.......VS...........pS.S...AV.F.Q.V.VV.G.GAVFVGg..........................................gAVTAAP..A.....G....G.......A......A......A....E..S....A...A..A....P......A...A....E.....K....K.EK...KVEK...................-..E..EDE.........DFG..MSLF..............................
Q7PNA9_ANOGA/23-112                    .......................................................................a-VTDEKIATILKA......A.N.V.D.IE.....P.YWPG..L.......F....A.K...A.......LE............G.I...DV.K.S.L.IT.S.IGSGVG............................................SGGGAP..A.....A....A.......A......G......G....A..G....A...A..P....A......A...A....E.....K....K.EE...KKEEe.................pE..E..SDD.........DMG..FGLF..............................
V8NRP9_OPHHA/69-153                    .......................................................................t-ITEDKINVLIKA......A.G.M.N.VE.....P.FWLG..L.......F....E.K...A.......PT............N.I...DI.G.S.L.IC.N.VGVGGG...........................................aPAASAP..T.....G....G.......G......T......P....A..G....G...A..A....P......A...E....E.....K....K.EE...EKK-...................E..E..SEE.........PM-..----tt............................
A0A2J8XS55_PONAB/17-114                ........................................................................SPSAKDIKKILDS......V.G.I.E.AD.....D.DRLN..K.......V....I.S...E.......LN............G.K...NI.E.D.V.IA.Q.GIGKLAsvpa....................................ggavAVSAAP..G.....S....A.......A......P......A....A..G....S...A..P....A......A...V....E.....E....K.KD...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A2N1JFU1_9BASI/21-109                ........................................................................EISSDKIVELTTA......A.G.S.P.VE.....P.IWAT..L.......L....A.K...A.......LE............G.K...DI.K.D.M.LT.N.IGTAGAa.........................................apAAGGAP..A.....A....G.......G......A......A....A..P....A...D..A....P......A...E....E.....K....K.EE...EK--...................E..E..SDD.........DMG..FGLF..............................
A0A182XZS7_ANOST/37-127                .......................................................................a-VTDEKIATILKS......A.N.V.E.IE.....P.YWPG..L.......F....A.K...A.......LE............G.I...DV.K.S.L.IT.S.IGSGVG...........................................sGGGAAP..A.....A....A.......A......A......G....A..G....A...A..P....A......A...A....E.....K....K.EE...KKEEe.................pE..E..SDD.........DLG..FGLF..............................
G3HDY7_CRIGR/192-273                   ...........................yptvasvphsiingykrvlxxxxxxxxxxxxxxxxxxxxxxxxxx-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.------............................................-XGPPP..P.....P....S.......L......P......A....A..A....A...A..P....A......K...A....E.....A....R.EE...SE--...................-..E..SDE.........DMG..FGLF..............................
A0A0B0MIG5_GOSAR/166-252               .......................................................................f-PTLAAAPHMFIN......A.Y.K.T.AL.....S.LAVA..T.......E....Y.T...F.......PQ............A.E...KI.K.E.Y.LK.D.PTKFAV...........................................aVGGDAG..A.....P....A.......T......S......A....K..E....E...K..A....E......Q...S....E.....P....A.KE...EEE-...................-..E..SDE.........DLV..AGLF..............................
H0XF20_OTOGA/17-114                    ........................................................................SPSAKDIKKILDS......V.G.I.E.AD.....D.DRLN..K.......V....I.S...E.......LN............G.K...NI.E.D.V.IA.Q.GIGKLAsvpa....................................ggavAVSAAP..G.....A....V.......V......P......A....A..G....S...A..P....A......A...A....E.....E....K.KD...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A2H3E459_ARMGA/229-311               ........................................................................YPTIVSVAHSLVN......A.Y.K.N.VL.....A.VSLA..T.......E....Y.T...F.......DG............S.E...KV.K.E.Y.LA.N.PDAF--............................................AV-AAA..P.....A....A.......A......E......A....A..P....A...A..A....A......V...E....E.....K....E.PE...KEE-...................-..E..SDD.........DMG..FGLF..............................
A0A3L6R9C2_PANMI/17-111                .......................................................................s-PIADDVKNILES......V.G.A.E.AD.....E.EKLD..F.......L....L.T...E.......LK............D.K...DI.T.E.V.IA.A.GREKFAsvp......................................sggGAIAVG..A.....P....A.......A......A......A....G..G....A...A..P....A......E...E....A.....K....K.EE...KVEE..................kE..E..SDD.........DMG..FSLF..............................
B9SNZ6_RICCO/35-121                    ................................qrklvnlaassdssggvqssfsyvtpssavfqviiggggg-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.---G-Gfi........................................ggGAAAAA..A.....P....A.......G......G......A....A..A....A...A..E....A......P...A....E.....E....K.KK...EEPA...................E..E..SDD.........DMG..FSLF..............................
Q29N41_DROPS/22-111                    .......................................................................a-VTGEKISTILKA......A.N.V.E.VE.....P.YWPG..L.......F....A.K...A.......LE............G.I...NV.K.D.L.IT.S.IGSGVGa.........................................apAGGAAA..P.....A....A.......A......D......A....P..A....A...E..S....K......K...E....E.....K....K.KE...EES-...................D..V..SDD.........DMG..FGLF..............................
A0A238C5U1_9BILA/23-118                ........................................................................SPTAKDIENVLGS......V.G.L.D.VD.....M.EDAN..K.......V....V.S...A.......LS............G.K...SI.D.E.V.IA.A.GLTKISsvp.....................................sgsaASAAAP..V.....A....S.......Ti....pT......G....T..L....E...A..E....S......K...K....E.....E....K.KE...EPK-...................E..E..SDE.........DMG..FGLF..............................
H2P057_PONAB/231-311                   ........................................................................YPTVASVPHSVIN......G.Y.K.Q.VL.....A.LSVE..T.......D....Y.T...F.......PL............A.E...KV.K.A.F.LA.D.SSAF--............................................--VAAA..T.....T....A.......A......P......A....A..A....A...A..P....A......K...V....E.....A....K.EE...SE--...................-..E..SDE.........DMG..FGLF..............................
B4N0U4_DROWI/22-112                    .......................................................................a-VTGEKISTILKA......A.N.V.E.VE.....P.YWPG..L.......F....A.K...A.......LE............G.V...NV.K.D.L.IT.N.IGSGVGaa........................................paGGAAAP..A.....A....A.......A......A......P....A..G....G...E..A....K......K...E....E.....K....K.KE...EES-...................D..V..SDD.........DMG..FGLF..............................
B7GA61_PHATC/17-105                    ........................................................................SPTKDDITQALSA......V.G.V.E.VD.....G.ADLD..R.......M....L.A...D.......LE............G.Q...DL.E.A.L.LE.S.GNALLA...........................................tFGGGGG..G.....G....G.......A......A......A....A..G....G...E..A....A......V...E....E.....K....V.EE...KEE-...................-..E..EEM.........DLG..GGM-dmf...........................
A0A1L8I062_XENLA/231-313               ........................................................................YPTVASVPHSVIN......G.Y.K.R.VL.....A.IAVE..T.......D....Y.S...F.......PL............A.D...KV.K.A.F.LA.D.PSAF--............................................-VVAAP..A.....A....Q.......A......A......A....A..P....A...A..E....A......A...K....D.....E....K.QE...ESE-...................-..E..SDD.........DMG..FGLF..............................
A0A6P6TNA6_COFAR/17-93                 .......................................................................c-PSAKDIKAILAS......I.G.V.D.VD.....D.EKID..L.......L....L.S...Q.......VD............G.K...DI.T.K.M.IA.A.GREKLAsvp.....................................agggGGVAVA..A.....A....A.......A......G......G....A..A....A...A..P....A......A...E....D.....K....K.--...----...................-..-..---.........---..----..............................
A0A6P7Y273_9AMPH/17-95                 .......................................................................r-PNSKDLKKILDS......V.G.I.E.TD.....D.ERIN..K.......V....I.G...E.......LN............G.K...NI.E.E.V.IA.Q.GNGKLAsmpa....................................ggavAVSAGA..S.....S....A.......A......P......A....T..G....A...A..P....A......A...A....E.....E....K.K-...----...................-..-..---.........---..----..............................
A0A6A3TGI9_9STRA/231-311               .......................................................................l-PTLASIPHSIAN......A.F.K.D.LV.....A.IAVE..C.......E...eF.S...F.......EK............A.E...PY.K.A.F.LA.D.PSAF--............................................---AVA..A.....P....A.......G......G......A....A..A....A...V..E....K......K...E....E.....A....V.E-...----...................E..E..EEV.........DMG..GGM-dmf...........................
A0A6P6SGQ7_COFAR/17-115                .......................................................................c-PSAEHVSNILSS......V.G.A.E.AD.....E.DKIE..L.......L....L.S...Q.......VN............G.K...DI.T.E.L.IA.A.GREKLAsvpag..................................gggavAVAAAS..A.....G....G.......G......G......A....A..A....A...A..P....A......A...E....S.....K....K.EE...KVEE..................kE..E..SDE.........DMG..FSLF..............................
A0A0D3HR34_9ORYZ/795-880               ........................................................................YPTXAAAPHMFLN......G.Y.K.N.VL.....A.VAVE..T.......E....Y.S...Y.......PH............A.X...KI.K.E.Y.LK.D.PSKF--............................................AVAAPV..A.....A....A.......D......S......G....A..A....A...V..A....A......S...K....E.....E....E.KK...EEPE...................E..E..SDV.........---..----knylgls.......................
A0A399GB34_9PLEO/21-110                .......................................................................d-ITADKLQSLIKA......A.K.IeE.VE.....P.IWTT..L.......F....A.K...A.......LE............G.K...DV.K.D.L.LL.N.VGSGGG............................................AAPAAG..G.....A....A.......P......A......A....G..G....A...A..D....A......A...P....A.....A....E.EK...KEEE..................kE..E..SDE.........DMG..FGLF..............................
A0A6A5C0J5_NAEFO/17-109                ........................................................................SPSKKDIEKILGA......V.G.A.E.VD.....A.EQVD..K.......L....L.K...E.......LE............G.K...NV.F.D.V.IA.Q.GKEKLAsv........................................ptGGAAAG..G.....A....T.......G......G......A....A..A....V...E..E....K......K...E....E.....K....K.EE...KKES...................E..S..EDD........gDAF..GGLF..............................
L5LJH3_MYODS/63-135                    .......................................................................s-VTEDKINTLIKA......A.G.V.N.VE.....P.FWPG..L.......F....A.K...A.......LA............N.V...KI.G.S.L.IC.N.VGADGPa..........................................pAASAAP..A.....G....G.......P......A......P....S..T....A...A..A....P......A...E....E.....K....-.--...----...................-..-..---.........---..----dt............................
A0A6P4DF40_ARADU/17-112                .......................................................................a-PCAADLKGILSS......V.G.A.E.AD.....D.DSIT..L.......L....L.S...E.......VK............G.K...DI.T.E.V.IA.A.GREKLAsvpa...................................ggggaV---AV..A.....A....A.......P......S......G....G..A....A...A..P....A......A...A....E.....A....K.KE...EKVEe.................kE..E..SDD.........DMG..FSLF..............................
A0A2I0WBT7_9ASPA/23-114                .......................................................................p-ITAEKISTLVKA......A.K.I.S.VE.....S.YWAT..L.......F....A.K...L.......LE............K.K...SV.E.D.I.IL.S.VGSGGGga.......................................avaVATPAA..G.....G....G.......G......G......A....A..P....E...A..A....P......A...A....E.....E....K.KE...EPK-...................E..E..SDD.........DMG..FSLF..............................
M4E983_BRARP/17-112                    ........................................................................NPTKGDLKNIFDS......V.G.A.E.FD.....E.TKTD..L.......F....F.S...L.......VK............D.H...DV.T.E.L.IA.A.GREKMGalss....................................ggaaVAMVAG..A.....G....G.......D......A......P....S..A....A...E..P....A......A...E....S.....K....K.VE...EE-K...................E..E..SDD.........GEG.mMSLF..............................
A0A068XUG9_ECHMU/22-120                ........................................................................EVTADKLNTLLKA......A.N.C.KfVE.....S.YVTS..L.......F....A.N...A.......LS............G.R...NI.K.D.I.VS.A.TSSVSVa.........................................paPAVAPG..P.....A....A.......S......K......A....S..G....A...A..P....A......A...Ec.vpE.....S....K.KE...EEKKke...............esE..E..SDG.........DMG..FDLF..............................
A0A078IFI2_BRANA/35-119                ...................................qrklvqtalsadssggvqssfslvspssavfqviigg-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.-GSGGGf..........................................aAGGGAA..A.....G....G.......G......G......G....G..E....A...A..A....A......T...K....E.....E....E.KK...KEES...................E..E..EEG.........DFG..FDLF..............................
A0A4X2M2D4_VOMUR/17-114                .......................................................................s-PNSKDLTKILDN......T.D.I.E.TE.....D.ERLK..K.......V....I.S...E.......LN............G.K...NT.E.D.V.IT.Q.GSSKLAsmpa....................................ggavADAASA..G.....S....T.......A......P......A....V..G....S...A..A....P......A...A....E.....E....K.KE...EKKEe.................sE..E..SHE.........DMG..FGLF..............................
A0A2P5EC79_TREOI/17-114                ........................................................................NPSADDIKHILGS......V.G.A.E.AD.....E.DKIK..L.......L....L.S...S.......VE............G.K...DI.S.E.L.IA.A.GREKLAycvp....................................sgggAAVAAA..A.....T....A.......D......G......A....A..A....A...P..A....E......A...A....E.....T....K.KE...EKEEl.................iE..E..SDE.........EGI..LSLF..............................
A0A6P3ZZZ8_ZIZJJ/21-110                .......................................................................p-ITAEKIATIVES......A.N.L.K.ID.....S.YWPG..L.......F....S.K...L.......FE............K.R...SI.E.D.L.IL.N.AVSGGV...........................................pAAVAAP..V.....S....G.......G......S......G....D..S....A...A..P....A......A...P....A.....A....E.EK...KDEP..................lD..E..SDD.........DLG..FSLF..............................
A0A453HLF7_AEGTS/235-320               ........................................................................YPTLAAAPHMFLN......G.Y.K.N.VL.....A.LAVE..T.......D....Y.S...F.......PH............A.D...QI.K.E.Y.LK.D.PSKF--............................................AVAAVP..S.....G....G.......G......A......A....A..A....G...A..A....T......A...E....E.....K....K.EE...ESD-...................S..G..SDA.........EEG.fMNLF..............................
A0A6J1DWE3_MOMCH/234-319               .......................................................................f-PTLAAAPHMLIN......A.Y.K.N.LL.....A.VAVA..T.......D....Y.S...F.......PQ............A.E...KV.K.E.Y.LE.D.PSKFA-............................................VAVAVS..A.....A....D.......T......G......S....A..P....A...A..A....A......A...V....E.....E....K.KE...EPA-...................E..E..SDD.........DLG..FSLF..............................
A0A427A297_ENSVE/48-131                ...................................................................sggvq------------S......S.F.S.M.VS.....P.SSAV..F.......Q....V.K...Y.......LE............A.F...LL.N.V.V.IG.G.GGGAFIgg.......................................gapSGGASA..G.....S....G.......G......S......A....P..A....T...E..A....P......P...A....E.....E....K.KE...EK--...................E..E..SDD.........DMG..FSLF..............................
A0A0L0SPN6_ALLM3/231-310               .......................................................................v-PTVASVPHSLIN......A.Y.K.N.VL.....S.IALA..T.......E....I.S...F.......PL............A.D...AV.K.D.R.IN.N.PEAY--............................................-----A..A.....A....A.......P......A......A....S..E....A...A..P....A......A...A....A.....A....V.VE...EEE-...................E..E..EDD.........DMG..FGLF..............................
L0AAV7_CALLD/21-108                    ......................................................................ql--NEDNLKKVVES......L.G.L.Q.AD.....D.AKVK..M.......L....V.A...S.......LS............E.L...KL.D.E.V.LK.S.AAVAVS............................................APVSAP..V.....S....A.......P......A......E....A..E....K...K..E....E......K...K....E.....E....K.KE...EENK...................-..E..VDV.........SEG.lSGLF..............................
A0A6J1SFT5_FRAOC/22-112                .......................................................................a-VTGEKIQTILKA......A.S.V.E.VD.....P.YWPG..L.......F....A.K...A.......LE............G.V...SI.K.D.L.IT.N.VGSGVG............................................AAPAA-..G.....A....A.......P......A......A....A..A....A...G..G....A......A...K....E.....E....K.KE...EKKKve...............sdP..E..TDD.........DMG..FGLF..............................
A0A1B7NG81_9AGAM/17-89                 ........................................................................SPSAGDVQKVLNA......V.G.I.E.SD.....E.DRLE..K.......L....I.S...E.......LD............G.K...DI.N.A.L.IA.E.GSAKLS............................................------..-.....-....-.......-......-......-....-..-....-...-..-....-......-...-....-.....-....-.--...----...................-..-..---.........---..----svsldqkntkelitygrsrfllaals....
A0A2V1APR2_9ASCO/29-118                .......................................................................s-PAASDIKKVLES......V.S.I.E.VE.....D.DKVE..K.......L....L.A...E.......VE............G.K...NA.E.E.L.IA.E.GNEKLSs..........................................vPTGAPA..G.....G....A.......A......A......A....G..G....A...A..P....E......A...A....A.....E....K.EE...EAAA...................E..E..SDD.........DMG..FGLF..............................
A0A4S3JS17_9EURO/17-108                .......................................................................a-PSAADIKAVLSS......V.G.I.D.AD.....E.ERLT..K.......L....V.A...E.......LE............G.K...DL.Q.E.L.IA.E.GSSKLAsv.......................................psgGAAAAG..G.....A....A.......P......A......A....A..G....G...A..D....A......P...A....A.....E....E.KE...EEK-...................E..E..SDE.........DMG..FGLF..............................
A0A4X2LR94_VOMUR/193-268               ........................................................................YPTVASVLYLIIN......G.Y.K.W.VL.....A.VAVE..T.......E....Y.T...F.......PL............A.E...KV.K.A.F.LA.D.PSTF--............................................-VVAAP..A.....A....A.......T......-......-....-..-....-...-..P....A......K...V....E.....G....K.EE...SE--...................-..E..SDE.........DMG..FGLF..............................
A0A3R7KRR7_TRYRA/21-106                ......................................................................kt--NVENLLKVTKT......A.G.V.E.VS.....K.GMAT..A.......F....A.N...L.......LQ............S.V...NV.N.E.L.LA.N.VSFAG-............................................GAPAAA..G.....A....A.......P......A......A....G..A....A...A..P....A......A...A....A.....E....A.KK...EEE-...................E..E..EDD.........DMG..FGLF..............................
A0A6P7ZGA7_9AMPH/231-313               ........................................................................YPTIASVPHSIIN......G.Y.K.R.VL.....A.VAVE..T.......D....Y.S...F.......PL............A.D...KV.K.A.F.LA.D.PSAF--............................................VV-TAP..V.....T....T.......S......A......T....P..A....A...A..A....P......P...K....E.....E....V.KE...ESE-...................-..E..SDE.........DMG..FGLF..............................
A0A2K5HM78_COLAP/23-114                .......................................................................s-VTEDKIKALIKA......A.G.V.N.VE.....P.FRPG..L.......F....A.K...A.......LA............N.V...SI.G.S.L.IC.N.VGAGGPa..........................................pAAGAAP..A.....G....G.......P......A......P....S..T....A...A..A....A......A...E....E.....K....K.VE...AKKEe.................sE..D..SDD.........DMG..FGLF..............................
RLA1_SCHPO/21-108                      ........................................................................EITSDKLLSLTKA......A.N.V.D.VE.....P.IWAT..I.......F....A.K...A.......LE............G.K...DL.K.E.L.LL.N.IGSGAG............................................AAPVAG.gA.....A....A.......P......A......A....A..D....G...E..A....P......A...E....E.....K....E.EA...KE-E...................E..E..SDE.........DMG..FGLF..............................
F2U1N9_SALR5/229-310                   .......................................................................l-PNAASVPHMVAN......G.Y.K.N.VL.....A.VAVA..T.......E....I.S...F.......PL............A.E...KA.K.A.F.LA.D.PSAF--............................................---IVA..A.....P....A.......A......A......T....G..G....A...E..E....K......K...D....E.....P....E.PE...PEE-...................-..E..SDD.........DMD.gFSLF..............................
A0A5N6ZXZ7_9EURO/229-312               .......................................................................f-PTLPAVMHSLVN......S.Y.K.K.VL.....A.VAVS..T.......E....F.S...W.......PE............I.D...EL.K.D.R.IA.N.PDAY--............................................ASAAPA..A.....G....A.......G......A......A....A..G....G...A..A....P......A...E....E.....K....K.EE...EEE-...................-..E..SDE.........DMG..FGLF..............................
A0A341CR56_NEOAA/34-125                .......................................................................t-VTEDKINALIEA......A.S.V.N.VE.....L.FWPG..L.......F....A.K...A.......LA............S.V...NI.G.S.L.IC.N.VGAGGPa..........................................pASGAAP..A.....G....G.......P......A......P....S..T....T...A..A....P......A...E....E.....K....K.VE...AKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A5J5BAB8_9ASTE/33-120                .....................................................................rrr------LPTLVKA......A.N.V.S.VE.....S.YWPG..L.......F....A.K...L.......VE............K.R...NI.E.D.L.IM.N.AGSGGGga........................................avAVTAAP..G.....G....A.......A......A......A....A..P....A...A..A....A......A...V....E.....E....K.KE...EPK-...................E..E..SDD.........DMG..FSLF..............................
A0A5N5QWZ9_9AGAM/246-328               ........................................................................YPTIASVTHSLVN......A.Y.K.N.LL.....A.IAVT..T.......E....Y.S...F.......EA............A.E...KV.K.E.Y.LA.N.PEAF--............................................-AAAAP..V.....A....A.......A......P......T....T..T....A...T..E....E......K...P....A.....E....K.EE...EKE-...................-..E..SDD.........DMG..FGLF..............................
A0A4D8ZCA8_SALSN/17-110                ........................................................................SPSAEDVKGILSS......V.G.A.D.CD.....E.ERIE..L.......L....L.S...Q.......VA............G.K...DI.T.E.L.IA.A.GREKLAsvp.....................................agggGVAVSA..A.....T....G.......G......A......G....G..G....A...A..P....A......A...A....E.....A....K.KE...EKVEe.................kE..E..SDD.........---..----vsiv..........................
A0A4D8ZHL7_SALSN/201-285               ........................................................................YPTLAAAPHMFVN......A.Y.K.N.AL.....A.IAVE..T.......E....Y.S...F.......PQ............A.D...KV.K.E.F.LA.D.PSKF--............................................LVAAAP..A.....A....A.......G......G......D....A..P....A...V..A....A......K...E....E.....V....K.KD...EPE-...................E..E..SDE.........DMG..LGLF..............................
A4SAM0_OSTLU/232-312                   ........................................................................YPTLASVPHSIVN......A.Y.K.N.VL.....A.ISIG..T.......D....Y.T...F.......EL............A.Q...KV.K.D.Y.LA.N.PGAF--............................................AS-AAP..A.....A....G.......G......D......A....A..A....G...G..A....A......K...A....A.....A....V.EE...EEE-...................-..-..-EA.........EMD..FDLF..............................
A0A518SD21_9EURY/16-111                ........................................................................EINEDNLTSVLES......A.G.V.D.VE.....E.SRVK..A.......L....V.A...A.......LE............D.V...DI.E.E.A.IE.T.AAAAPA...........................................aGGAAAG..G.....S....A.......E......G......G....A..E....E...E..S....E......D...E....A.....E....E.AE...AEEEd................eaE..E..EDEe......asGEG.lGDLF..............................
B4LE06_DROVI/231-316                   ........................................................................YPTIASAPHSIAN......G.F.K.N.LL.....A.IAAT..T.......E....V.E...F.......KE............A.T...TI.K.E.Y.IK.D.PSKF--............................................AAAAAT..S.....A....P.......A......A......A....G..G....A...A..E....K......K...E....E.....A....K.KV...ESES...................E..E..EDD.........DMG..FGLF..............................
A0A0G4KSX6_9PEZI/192-274               .......................................................................f-PTLPSVIHSLVN......S.Y.K.K.VL.....A.VAIE..T.......E....I.S...W.......PE............I.E...SL.K.D.R.IA.N.PDAY--............................................---AAA..A.....P....A.......A......S......S....G..A....V...E..T....K......A...E....E.....K....A.EE...KEE-...................E..E..SDE.........DGG.fGGLF..............................
A0A195BNB3_9HYME/231-317               ........................................................................YPTVASAPHSIVN......G.F.K.N.LL.....A.VAAV..T.......E....V.E...F.......AE............A.T...TI.K.E.Y.VK.D.PSKFVV............................................AAAAVA..T.....P....A.......A......A......A....A..D....-...-..A....P......A...A....E.....K....K.EE...KKEE..................sD..S..EDD.........DMG..FGLF..............................
A0A0C2YUF0_9AGAM/21-110                ........................................................................EITAEKITTLTTA......A.G.V.D.FE.....A.IWAN..L.......L....A.K...A.......LE............G.K...DI.K.E.L.LL.N.VGAGGGap........................................aaGAVTAG..G.....A....A.......P......A......A....A..E....A...E..A....P......K...E....E.....E....K.KE...EK--...................E..E..SDD.........DMG..FGLF..............................
A0A2J7QH48_9NEOP/17-115                ........................................................................NPNSADIEKILSS......V.G.I.E.AD.....S.EKLK..K.......V....I.S...E.......LN............G.K...NI.E.E.L.IA.A.GREKLAtvpag..................................ggaaaPAAGGG..P.....A....V.......P......A......A....A..A....A...V..P....E......K...E....E.....K....K.V-...---Ekk..............vesD..S..EDD.........DMG..FGLF..............................
A0A6Q2YUZ2_ESOLU/17-87                 ........................................................................SPSSKDIKNILGS......V.G.I.E.AE.....S.ERLD..K.......V....V.N...E.......LS............G.K...NI.N.D.V.MN.S.GLSKLAs.........................................vpSGGAVA..A.....P....A.......A......S......A....A..G....A...A..P....A......A...-....-.....-....-.--...----...................-..-..---.........---..----gk............................
A0A1E3H9Z9_9TREE/229-313               .......................................................................i-PTIASVVHSLVN......S.Y.K.N.VL.....N.VSLA..T.......D....Y.E...F.......EG............S.Q...KI.K.E.Y.LA.N.PEAF--............................................AVAAAP..A.....A....A.......E......G......A....A..A....G...G..D....A......P...A....A.....K....E.EA...KDE-...................E..S..EDD.........DMG..FGLF..............................
A0A238F902_9BASI/229-310               ........................................................................YPTIASVTHSLVN......S.Y.K.N.LL.....A.IALA..T.......D....V.T...F.......EG............A.E...KV.K.E.Y.LA.N.PEAF--............................................---AAA..A.....P....A.......V......T......E....S..A....A...A..P....A......K...A....E.....E....K.EP...EKE-...................E..E..SDD.........DMG..FGLF..............................
A0A074XFT6_AURPU/17-108                ........................................................................QPSAEDIKSVLSS......V.G.V.D.AE.....G.ERLD..K.......L....I.S...E.......LE............G.K...NI.Q.E.L.IS.E.GSAKLAsv.......................................psgGAGAAA..G.....S....A.......P......A......A....G..A....A...A..E....A......A...P....A.....E....E.KA...EEK-...................E..E..SDD.........DMG..FGLF..............................
A0A4P9XCV8_9FUNG/23-106                ........................................................................EITADKLTTLINA......S.G.A.E.VE.....P.IWPT..I.......F....A.K...A.......LV............G.K...DL.E.G.F.LF.S.VGSA--............................................AAAPAA..G.....G....A.......A......A......A....G..G....A...A..E....E......K...K....E.....E....K.VE...EA--...................E..E..SDD.........DMG..FGLF..............................
A0A0D9WTS8_9ORYZ/58-119                ............................................................vtpnsavfqvii-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.-G.A.VGGGAAi..........................................gGGAAAG..G.....A....A.......A......G......G....A..A....A...E..A....P......K...A....E.....E....K.KE...EEK-...................E..E..SED.........DLG..FSLF..............................
Q5ANH5_CANAL/17-110                    ........................................................................SPSASDITALLES......V.G.V.E.AE.....E.SRLQ..A.......L....L.K...D.......LE............G.K...DL.Q.E.L.IA.E.GNTKLAsvp.....................................sggaAAGGAS..A.....S....A.......G......A......A....A..G....G...A..A....E......A...E....E.....E....K.EE...EAK-...................E..E..SDD.........DMG..FGLF..............................
A0A1R2BCH2_9CILI/246-329               .......................................................................i-PTVVSAPHSVIS......G.F.K.N.LV.....A.LAYG..G.......N....Y.T...F.......AQ............G.A...GL.L.E.V.LK.D.PSKL--............................................ASLAAP..T.....S....A.......A......P......T....A..V....T...A..A....K......E...E....A.....K....K.EE...PAD-...................E..E..A-G........iDMG..-GMF..............................
A0A165UA00_9AGAM/17-111                ........................................................................SPTADDVKKVLSA......V.G.I.E.AD.....E.ERLE..K.......L....I.S...E.......LE............G.K...DV.N.E.L.IA.E.GSSKLAsvp.....................................aggaAVSAAP..A.....A....G.......A......A......A....A..G....A...A..A....A......E...E....A.....E....E.KK...EEEK...................E..E..SDD.........DMG..FGLF..............................
F4WNI7_ACREC/22-109                    .......................................................................a-VTGEKIQTILKA......A.N.V.N.VE.....S.YWPG..L.......F....A.K...A.......LE............G.I...SV.K.E.L.IT.N.IGSGVGa..........................................aPVGAVP..A.....A....A.......A......P......V....S..T....E...A..A....P......A...K....E.....E....K.KK...EEPE...................E..E..SDD.........DMG..F---v.............................
A0A067Q3X5_9AGAM/17-111                ........................................................................NPSAADIKKVLSS......V.G.I.E.AD.....E.DRLK..T.......L....L.S...E.......LK............G.K...DI.N.T.L.IA.E.GSSKLAsvp.....................................sggaVASSGA..A.....S....G.......G......G......G....A..P....A...A..A....A......A...E....E.....K....E.EE...KEEE...................K..E..SDD.........DMG..FGLF..............................
L8HQG6_9CETA/67-158                    .......................................................................r-PREDKINALIKA......A.G.V.N.VE.....P.FWPG..L.......F....A.K...A.......LA............N.V...NI.G.S.L.IC.N.VGAGGPa..........................................pAAGAAP..A.....G....G.......P......A......P....S..T....A...A..A....P......A...E....E.....K....K.VE...AKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A5A7PM87_STRAF/426-513               ...................................................................eglaf------------A......I.G.A.E.AD.....D.DMVE..L.......L....L.S...Q.......VK............G.K...DI.T.E.L.IA.A.GREKLAsvp......................................aggGAVAVA..S.....S....A.......S......G......S....A..A....A...P..A....V......A...E....T.....K....K.EE...KVEE..................kE..E..SDD.........DLG..FSLF..............................
F4PNB1_CAVFA/622-701                   ........................................................................YPTVASVPHSVMD......A.Y.K.S.LL.....A.IALT..T.......E....I.T...F.......PA............A.D...KF.K.A.A.LS.A.A-----............................................PVAAAP..V.....A....A.......A......P......A....A..A....S...A..P....A......-...-....A.....K....V.KE...EPK-...................E..E..SDD.........DMG..MGLF..............................
M2XVP1_GALSU/18-114                    .......................................................................k-PTADDIKKILTS......V.G.V.E.VE.....E.DRVT..Q.......V....V.E...A.......LN............G.K...DL.D.E.L.ME.Q.GLQKMTtvps....................................gataALAAAV..G.....A....A.......P......A......A....T..G....G...E..S....K......E...S....A.....K....A.AE...KEEA..................aE..E..SDE.........DLG..FGLF..............................
A0A670IAX3_PODMU/22-112                .......................................................................t-VTEDKINALIKA......A.G.V.N.VE.....P.FWPG..L.......F....A.K...A.......LA............N.I...DI.G.S.L.IC.N.VGVGGG...........................................aPAASAP..A.....G....G.......G......A......P....A..G....A...A..A....P......A...E....E.....K....K.EE...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A024UC28_9STRA/26-113                ........................................................................EITSEALSTVIAA......S.G.N.E.VE.....P.YWPT..L.......F....A.G...L.......LS...........kD.G...KM.L.E.L.IT.S.GGAI--............................................GGGAAA..A.....P....A.......A......A......A....A..A....D...A..G....A......A...A....P.....A....K.KE...EKK-...................E..E..EDA.........DLG..GGM-dmf...........................
A0A093NXI2_PYGAD/17-114                ........................................................................SPTSKDLKKILDS......V.G.I.E.TD.....D.ERMN..K.......V....I.S...E.......LN............G.K...NI.E.D.V.IA.Q.GNGKLAsmpa....................................ggavAASAGG..G.....S....A.......A......P......A....A..A....A...A..P....A......A...A....E.....E....K.KE...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
B9PJK1_TOXGV/19-112                    .......................................................................a-PTKKQVEKTLSS......V.G.I.D.VE.....D.DIMD..A.......F....F.K...A.......VE............G.K...TP.H.E.L.IA.A.GMEKLQkvp.....................................sggvAAAAAP..A.....A....G.......A......A......D....A..G....A...G..A....A......A...K....K.....E....E.EK...KEE-...................E..E..EED.........DMG..FSLF..............................
A0A285N6F7_9EURY/16-115                ........................................................................EINEDNLTGVLEA......A.G.V.D.VE.....E.SRVK..A.......L....V.A...A.......LE............D.V...DI.D.E.A.VD.E.AAAV--............................................PAAGGA..A.....G....G.......A......A......G....D..A....A...A..D....D......D...D....E.....D....V.EE...ADEElpdta........ddddddD..E..EE-.........---..----dasgeglgelf...................
A0A0D0D097_9AGAR/229-311               ........................................................................YPTIVSVMHTLVN......A.Y.K.N.LI.....A.VSLA..T.......D....Y.T...F.......EG............S.E...KI.K.E.Y.LE.N.PEAF--............................................-AVAAP..A.....A....A.......A......A......A....P..A....A...E..A....A......K...E....E.....A....K.EE...EAE-...................-..E..SDE.........DMG..LGLF..............................
A0A2K5MZV3_CERAT/17-114                ........................................................................SPSAKDIKKILDS......V.G.I.E.AD.....D.DRLN..K.......V....I.S...E.......LN............G.K...NI.E.D.V.IA.Q.GIGKLAsvpa....................................ggavAVSAAP..G.....S....A.......A......P......A....A..G....S...A..P....A......A...A....E.....E....K.KD...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A7N5JYN0_AILME/17-97                 ........................................................................SPSAKDIKKILDS......V.G.I.E.AD.....D.DRLN..K.......V....I.S...E.......LN............G.K...NI.E.D.V.IA.Q.GIGKLAsvpa....................................ggavTVSAAP..G.....S....A.......A......P......A....A..G....A...A..P....A......A...-....-.....-....-.--...----...................-..-..---.........---..----gkwrleq.......................
L0KZG3_METHD/16-101                    ........................................................................EITEDTITAVLQA......A.S.T.E.VN.....E.SRVK..A.......L....I.A...A.......LE............D.V...DI.E.E.A.MA.T.AAVA--............................................---AAP..A.....A....A.......A......P......A....A..A....A...E..A....P......A...A....E.....A....Q.KE...EDTK...................E..E..AEEs.......gMAG.lGALF..............................
A0A087TID0_STEMI/17-104                ........................................................................NPSVGDIEKILGS......V.G.I.E.VD.....K.ERAK..K.......V....I.S...E.......LS............G.K...DI.N.E.V.IQ.S.GKSKLAsmpsg..................................ggvvvSGVAAP..A.....A....A.......A......E......S....S..P....A...K..E....D......K...K....E.....A....K.KE...ESE-...................-..E..S--.........---..----e.............................
RLA6_SCHPO/17-109                      ........................................................................SPSASDIESVLST......V.G.I.E.SE.....S.ERVE..A.......L....I.K...E.......LD............G.K...DI.D.E.L.IA.A.GNEKLAtv........................................psGGAAAA..A.....A....P.......A......A......A....G..G....A...A..P....A......A...E....E.....A....A.KE...EAKE..................eE..E..SDE.........DMG..FGLF..............................
A0A1X7RAJ0_9SACH/229-311               ........................................................................YPTLPSVGHTLIN......N.Y.K.D.LL.....A.VAIG..S.......G....Y.H...Y.......AE............I.E...EL.V.D.R.IE.N.PDKY--............................................-ASAAP..V.....A....A.......A......A......S....A..S....A...D..A....G......A...E....A.....A....A.EE...EES-...................-..E..EDD.........DMG..FGLF..............................
A0A319A0L1_9EURO/229-311               .......................................................................f-PTLPSVIHSVVN......S.Y.K.K.VL.....A.VAIE..T.......E....I.S...W.......PE............I.E...EL.K.D.R.IA.N.PDAY--............................................AS-AAP..A.....A....A.......A......A......P....A..G....G...D..A....P......A...A....E.....A....P.AE...EAE-...................-..E..SDE.........DMG..FGLF..............................
A0A498JQY0_MALDO/21-112                .......................................................................p-ITAEKITTLAKA......A.N.V.S.VE.....S.YWPG..L.......F....A.K...L.......AE............K.R...DI.D.D.L.IL.N.VGVGGGasa......................................vaaAAPGVG..T.....A....A.......A......P......-....A..A....A...A..A....P......P...P....E.....E....K.KE...EPK-...................-..E..ESD.........DEG.lFNLF..............................
A0A3Q4HJH9_NEOBR/169-251               ........................................................................YPTLASVPHTVIN......G.Y.K.R.VL.....A.VAVE..T.......D....Y.S...F.......PL............A.D...KV.K.A.F.LA.D.PSAF--............................................-AVAAP..A.....A....A.......A......E......T....A..A....A...P..A....A......A...K....E.....E....A.KE...ESE-...................-..E..SDE.........EMG..FGLF..............................
A0A093XNG5_9PEZI/54-141                .......................................................................d-ITAEKLQTLIAA......A.K.VvD.VE.....P.IWTS..L.......F....A.K...A.......LE............G.K...DV.K.D.L.LL.N.VGSGGG............................................APAAGG..A.....A....A.......G......G......A....A..A....A...T..E....D......A...P....A.....E....E.KE...EEK-...................E..E..SDE.........DMG..FGLF..............................
A0A6P6U1E3_COFAR/17-113                .......................................................................c-PSAKDIKAILAS......V.G.A.D.AD.....D.EKID..L.......L....L.S...Q.......VD............G.K...DI.T.E.L.IA.A.GREKLAsvpa...................................gggagV--AVA..A.....A....A.......P......A......G....G..A....A...A..A....P......A...A....E.....D....K.KE...EKVEe.................kE..E..SDD.........DMG..FSLF..............................
A0A2C9UCL2_MANES/21-111                .......................................................................p-ITAEKIAQLVKA......A.N.V.S.VE.....S.YWPS..L.......F....A.K...L.......LE............K.R...NL.E.D.L.IM.N.VGSGGGa.........................................gpVAAAVP..A.....A....A.......G......G......A....A..A....A...A..A....P......P...P....E.....E....K.KK...EEPE...................E..E..SDD.........DMG..FSLF..............................
A0A3P3R9T0_9EURY/16-110                ........................................................................EITEDNVTDVLEA......A.N.V.D.VE.....E.SRVK..A.......L....I.A...A.......LE............D.V...DI.E.E.A.VE.Q.AAAV--............................................PAGGAG..A.....T....G.......G......A......E....A..E....A...E..A....A......E...E....E.....E....E.EE...EAEAae..............eeeE..E..EDDe......asGEG..----lgqlf.........................
A0A0K0CUE7_ANGCA/18-89                 ................................................................dnetavct-----------GA......G.G.L.D.CD.....M.EDAS..K.......V....V.D...A.......LA............G.K...SL.N.E.V.IE.V.GKKKLSsmp.....................................svgvS----T..A.....A....A.......A......P......S....A..A....A...A..P....S......-...-....-.....-....-.--...----...................-..-..---.........---..----sapqgkl.......................
A0A671E1K9_RHIFE/17-114                ........................................................................SPSAKDIKKILDS......V.G.I.E.AD.....D.DRLN..K.......V....I.S...E.......LN............G.K...NI.E.D.V.IA.Q.GIGKLAsvpa....................................ggavAVSAAP..G.....A....A.......A......P......A....A..G....S...A..P....A......A...A....E.....E....K.KD...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A371DXW1_9APHY/229-309               ........................................................................YPTIVSVLHSLVN......S.Y.K.N.LI.....A.IALA..T.......E....Y.T...F.......EG............A.E...KA.K.E.Y.LA.N.PDAF--............................................VVAAAP..A.....A....E.......A......A......P....V..E....E...A..A....P......A...K....-.....-....E.EE...K---...................E..E..SDD.........DMG..FGLF..............................
A0A151ZJ20_9MYCE/227-306               ........................................................................YPTVASIPHSIVN......A.F.K.N.LL.....A.VTFE..T.......E....Y.T...F.......DA............A.T...KF.K.A.A.AA.A.T-----............................................--PVAT..V.....A....A.......T......P......V....A..A....T...T..A....K......K...V....E.....A....K.VE...EKK-...................E..E..SDE.........DMG..MSLF..............................
A0A660KM69_9ROSI/17-111                .......................................................................c-PSADDIKEILAS......V.G.A.E.AD.....D.ERIE..L.......L....L.S...E.......VK............G.K...DI.T.E.L.IA.A.GREKLAsv.......................................pggGGVAIA..A.....P....V.......A......G......G....G..G....A...P..A....A......A...A....E.....P....K.KE...EKVEe.................kE..E..SDD.........DMG..FSLF..............................
H3AB03_LATCH/17-111                    ........................................................................SPSAKDIKKILSS......V.G.I.E.AE.....D.DRLN..K.......V....I.S...E.......LS............G.K...DI.N.D.V.VN.A.GLSKLAcvp......................................agtAVAPAA..A.....G....A.......A......P......A....A..G....D...V..P....A......A...E....K.....K....E.EE...KKEE..................sE..E..SDE.........DMG..FGLF..............................
A0A1V9YFB0_9STRA/29-111                ........................................................................EVSAENINAALDA......S.K.N.K.VA.....A.YLPT..L.......F....A.D...A.......IE...........kG.L...KV.E.K.L.LA.G.PSAG--............................................---AAA..A.....P....A.......A......G......G....A..A....P...A..A....A......A...V....E.....A....K.KE...EVE-...................E..E..ADL.........GGG..MDMF..............................
A0A1U7LUW1_NEOID/172-253               ........................................................................YPTLVSVMHSLVN......S.Y.K.N.VL.....G.VSIA..T.......D....Y.T...F.......DG............S.E...QI.K.G.Y.LA.N.PSAF--............................................-AMAAP..A.....A....A.......A......E......P....F..G....S...A..-....K......P...E....D.....K....P.AE...EEE-...................-..E..SDE.........DMA..FGLF..............................
A0A0F9XN31_TRIHA/21-107                ........................................................................EITADKLQTLIAA......A.K.V.E.VE.....P.IWTS..I.......F....A.K...A.......LE............G.K...DI.K.D.L.LV.N.VGSGG-............................................GAAAAP..G.....A....A.......A......A......A....G..G....A...V..A....D......A...P....A.....E....E.AK...EEEK...................E..E..SDE.........DMG..FGLF..............................
RLA22_ARATH/17-114                     ........................................................................SPTSADIKTILGS......V.G.A.E.TE.....D.SQIE..L.......L....L.K...E.......VK............G.K...DL.A.E.L.IA.A.GREKLAsvps...................................gggggVAVASA..T.....S....G.......G......G......G....G..G....G...A..S....A......A...E....S.....K....K.EE...KKEE..................kE..E..SDD.........DMG..FSLF..............................
A0A671L6T8_9TELE/220-301               ........................................................................YPTLASIPHSIIN......G.Y.K.R.VL.....A.VAVE..T.......D....C.S...F.......PL............A.E...KV.K.A.F.LA.D.PSAF--............................................-AVAAP..A.....A....S.......A......V......E....V..K....S...A..A....K......E...E....A.....P....K.EE...SE--...................-..E..SDE.........DMG..FGLF..............................
A0A251TCE4_HELAN/61-156                ........................................................................SPSADDLKNILGS......V.G.A.D.AD.....E.DTIE..L.......L....L.K...E.......VK............G.K...DI.T.E.L.IA.S.GREKLAsvp.....................................sgggGVAVAA..A.....T....G.......G......G......A....A..P....A...A..A....A......A...E....T.....K....K.EE...KVEE..................kE..E..SDD.........DMG..FSLF..............................
A0A1E5REY8_9ASCO/16-107                .......................................................................t-PSADSIKSVLES......V.G.I.E.VE.....D.EKVS..T.......L....L.S...S.......LE............G.K...SV.E.E.L.IA.E.GNEKLAsv.......................................ptsAPAGAA..G.....S....S.......G......A......A....A..G....G...A..D....A......A...E....E.....E....A.QE...EEA-...................E..E..SDE.........DMG..FGLF..............................
N1PQL2_DOTSN/21-111                    .......................................................................d-ITADKLQSLITA......A.K.VpD.IE.....P.IWTT..L.......F....A.K...A.......LE............G.K...DV.K.E.L.LL.N.VGSGGGa.........................................apAAGGAA..P.....A....A.......A......G......G....A..D....A...P..A....A......E...A....E.....K....P.KE...EEK-...................E..E..SDE.........DMG..FGLF..............................
A0A139A309_GONPJ/26-117                ........................................................................EITAEHITSLLEA......A.S.I.E.VD.....S.FYPR..V.......F....A.K...A.......LA............G.K...DL.S.F.L.TK.I.GAAGPAaa........................................paAAAAAP..A.....A....A.......A......A......P....A..A....A...A..A....A......P...A....A.....A....K.VE...EKKE...................E..E..EDD.........DMG..FGLF..............................
A0A2G3CRU5_CAPCH/234-317               ........................................................................YPTIAAASHMFVN......G.Y.K.N.VL.....G.VAVE..T.......E....Y.T...Y.......SQ............A.E...QV.K.E.Y.LK.D.PSKFAV............................................GTVGVA..E.....S....G.......A......T......F....Q..G....V...V..E....S......K...E....E.....D....D.ES...----...................-..E..SDE.........EEA.lFNLF..............................
A0A1Y1UL69_9FUNG/57-146                ........................................................................SPSAADVKKIINT......I.G.A.E.VD.....D.EKVD..A.......V....V.A...A.......LN............G.K...DI.D.E.V.IA.D.GFSKLSa.........................................apVASGSA..A.....S....G.......A......A......A....S..G....A...G..A....A......A...E....E.....T....K.EE...SEE-...................E..E..SDS.........DMG..FGLF..............................
A0A2U1MNZ9_ARTAN/36-88                 ......................................................................dy--DAEKIVELLRA......E.N.V.S.VE.....S.YWPG..L.......F....A.K...L.......CE............K.K...NL.D.E.L.IM.N.IGAAA-............................................------..-.....-....-.......-......-......-....-..-....-...-..-....-......-...-....-.....-....-.--...----...................-..-..---.........---..----tdeklsv.......................
I2GVA9_TETBL/17-108                    .......................................................................t-PSVADIKAVVET......V.G.V.E.AN.....D.ARIK..E.......L....L.A...S.......LE............G.K..gSL.A.E.I.IA.E.GQKKFAsv........................................paGGAAAA..T.....S....G.......A......A......A....A..G....G...A..A....A......A...E....E.....E....K.EE...EAK-...................E..E..SDD.........DMG..FGLF..............................
A0A5C3QH39_9AGAR/21-109                ........................................................................EITSDKILALTNA......A.S.V.E.LE.....P.IWAS..L.......L....A.K...A.......LE............G.K...NV.K.D.L.LS.N.VGAGGG...........................................aPAAGSA..P.....A....A.......G......G......A....G..G....A...A..P....E......A...E....K.....K....E.EK...VEEK...................E..E..SDD.........DMG..FGLF..............................
A0A1X0NTR3_9TRYP/20-106                ......................................................................kc--DASSLLAVTKA......A.G.V.E.VS.....K.GMAG..A.......Y....A.A...V.......LE............T.V...NI.N.D.V.LS.N.IAFGG-............................................GAPAAG..G.....A....A.......A......P......A....A..A....G...G..A....A......A...P....A.....A....K.KE...EKVE...................E..E..EDD.........DMG..FGLF..............................
A0A0F4G702_9PEZI/21-110                ........................................................................EITADKLQSLISA......A.K.VaD.VE.....P.IWTS..L.......F....A.K...A.......LE............G.K...DV.K.E.L.LL.N.VGSGGGa..........................................aPAAAGG..A.....S....A.......A......A......A....G..G....E...A..E....A......A...P....E.....A....A.KE...EEK-...................E..E..SDE.........DMG..FGLF..............................
M4D695_BRARP/17-112                    ........................................................................SPTSADIKQILGS......V.G.C.E.SE.....D.SQIE..L.......L....L.K...E.......VS............G.K...DL.C.D.L.IA.A.GREKLAsvps....................................ggggVAMAAA..P.....S....A.......G......G......G....G..G....A...P..A....A......A...A....K.....K....E.EK...KEEK...................E..E..SDD.........DMG..FSLF..............................
A0A1Y3N6M7_PIRSE/228-312               ........................................................................YPTVASVPHSLAN......G.Y.K.N.LI.....A.ISLV..S.......D....Y.C...L.......DS............V.K...EL.K.E.L.LD.N.PEALA-............................................-SLQAA..S.....A....S.......A......A......A....T..T....E...D..T....G......A...G....A.....A....A.EE...EEE-...................E..E..SDS.........DMG..FGLF..............................
A0A4Z2HE25_9TELE/53-119                ............................................lqlktfssfdtheapgrrqpallenkda-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.------............................................---ICA..A.....S....G.......R......P......A....A..R....R...D..A....S......E...K....E.....K....E.KE...KEEE..................eE..E..EEE.........EEG..GSLF..............................
A0A504XRE9_LEIDO/18-83                 ........................................................................SPSQADVEAICKA......V.H.V.D.VD.....Q.ATLA..F.......V....M.E...S.......VT............G.R...DV.A.T.L.IA.E.GAAKMSa..........................................mPAASSG..A.....A....A.......G......A......D....A..-....-...-..-....-......-...-....-.....-....-.--...----...................-..-..---.........---..----drgt..........................
A0A395HG37_ASPHC/229-312               .......................................................................f-PTLPSVIHSVVN......S.Y.K.K.VL.....A.VAIE..T.......E....I.S...W.......PE............I.E...EL.K.D.R.IA.N.PDAYA-............................................AAAPAA..D.....A....S.......A......P......A....A..G....G...A..P....A......A...E....E.....A....A.EE...AE--...................-..E..SDD.........DMG..FGLF..............................
A0A653D3Y2_CALMS/169-250               ........................................................................YPTAASVPHNIAN......G.F.K.N.LL.....A.IAVV..T.......E....I.E...F.......KE............A.T...TI.K.E.Y.LK.D.LCKF--............................................----AA..V.....A....A.......A......P......A....T..K....A...A..K....A......A...E....T.....K....K.EE...KEES...................D..Q..SDD.........EMG..FGLF..............................
A0A2P6VJE0_9CHLO/21-105                ........................................................................EITAENIAALTKA......A.G.I.E.VE.....P.YWPG..L.......F....A.K...L.......VE............K.K...SV.D.D.F.IV.N.VGAG--............................................GGAPAA..A.....A....G.......P......A......A....S..G....A...A..A....A......A...A....E.....K....V.EE...KVE-...................E..E..EDE.........DMG..FSLF..............................
A0A6J0BQI5_NEOLC/231-315               ........................................................................YPTIASAPHSIAN......G.F.K.N.LL.....A.LAAT..T.......D....V.E...F.......KE............A.T...TI.K.E.Y.IK.D.PSKF--............................................AA-AAA..A.....T....A.......P......V......A....A..A....A...A..P....A......A...E....K.....K....E.EK...KEES...................E..E..EDD.........DMG..FGLF..............................
V9F855_PHYPR/231-311                   .......................................................................i-PTLASIPHSIAN......A.F.K.D.LV.....A.IAVE..C.......E...eF.S...F.......EK............A.E...PY.K.A.F.LA.D.PSAF--............................................---AVA..A.....P....A.......G......G......A....-..-....-...-..A....A......T...E....E.....K....K.EE...AVE-...................E..E..EEV.........DMG..GGM-dmf...........................
A0A0D7BGG0_9AGAR/229-311               ........................................................................YPTIVSVVHSLVN......S.Y.K.N.LL.....A.VSIA..T.......E....Y.T...F.......EG............S.A...KA.K.E.Y.LA.N.PEAF--............................................AV-AAA..P.....A....A.......A......A......E....A..A....A...A..P....A......A...E....E.....K....K.EE...EEE-...................-..E..EDD.........DMG..FGLF..............................
A0A422NFR1_TRYRA/238-325               ........................................................................IPTAATLPHMIMD......A.F.K.N.LL.....G.VSVA..T.......E....Y.E...F.......DEf..........dG.K...NL.R.Q.A.AL.E.GKLGGG............................................AADAAA..P.....A....A.......A......A......A....A..A....A...A..P....A......A...A....A.....A....E.PE...D---...................E..E..DDD.........DFG.mAGLF..............................
A0A540NQQ4_MALBA/21-110                .......................................................................p-ITSEKIATLVKA......A.N.I.T.VE.....S.YWPG..L.......F....A.K...L.......AE............K.K...NI.D.D.L.IL.N.VGAGGGg.........................................aaVAVAAP..G.....G....G.......A......A......A....P..A....A...A..A....P......A...A....E.....E....K.KE...EPK-...................E..E..SDD.........DMG..FSLF..............................
A0A2R6S280_ACTCC/44-117                ..................................................sadssggvqtsfslitpssavf-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.Q.V.II.G.GGAFIG...........................................gGASAAA..A.....P....A.......G......A......A....S..A....A...E..A....P......P...P....E.....E....K.KA...EKE-...................E..S..EDE.........DMG..FSLF..............................
I1H2D6_BRADI/17-109                    ........................................................................SPTKDDVRAILGS......V.G.A.E.VE.....E.YKLD..I.......L....F.K...E.......VE............G.K...DI.S.E.L.LA.A.GREKFAfap.....................................rggaAMDAVP..A.....A....A.......A......A......A....E..E....K...K..D....G......K...V....E.....A....K.VE...EDE-...................E..E..EDL.........DM-..FSLF..............................
A0A2J6SGP2_9HELO/17-112                ........................................................................SPSAKDIKGVLES......V.G.I.E.AD.....D.ERLS..T.......L....I.S...E.......LK............G.K...DI.Q.E.L.IT.E.GSSKLAsvp.....................................sggsGGGAAA..A.....S....G.......G......A......A....T..G....G...A..A....A......E...E....-.....T....K.EE...PKEEe.................kE..E..SDE.........DMG..FGLF..............................
A0A167XV60_9PEZI/17-109                ........................................................................SPSAKDIKNVLES......V.G.I.E.AD.....D.DRLA..K.......L....L.E...E.......LK............G.K...DV.N.E.L.IA.E.GSTKLAsvp......................................sggGGGAAA..G.....G....A.......A......A......G....G..A....A...A..E....E......A...K....E.....E....P.KE...EEK-...................E..E..SDD.........DMG..FGLF..............................
A0A1D5PMT8_CHICK/17-114                ........................................................................SPTSKDLKKILDS......V.G.I.E.TD.....D.ERLN..K.......V....I.S...E.......LN............G.K...NI.E.D.V.IA.Q.GNGKLAsmpa....................................ggavAVSTGG..V.....S....A.......A......P......A....A..G....A...A..P....A......A...A....E.....E....K.KE...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
Q0PXZ8_DIACI/22-112                    .......................................................................t-VTGEKIQTVLKA......A.G.V.E.VE.....P.YWPG..L.......F....A.K...A.......LE............G.V...NV.K.E.L.IS.N.VGSGAGa..........................................gPAAAAP..A.....A....A.......Q......A......A....A..P....A...A..A....E......A...K....E.....D....K.KK...KEES..................dE..G..SDD.........DMG..FGLF..............................
A0A6I9LC57_PERMB/28-97                 ....................................................................ndev-------------......-.-.-.-.--.....-.----..-.......-....M.V...A.......LA............D.V...NI.G.S.L.IC.N.AGAGGPa..........................................pAAGATP..A.....G....G.......P......A......P....S..T....A...A..V....P......A...E....K.....K....K.VE...AKKEe.................sE..V..SDD.........DMG..FGLF..............................
A0A151NXJ6_ALLMI/43-118                ........................................................................SPTSKDLKKILDS......V.G.I.E.TD.....D.ERVN..K.......V....I.S...E.......LN............G.K...NI.E.D.V.IA.Q.GNSKLAsmpa....................................ggavAVAAGA..G.....S....A.......A......P......A....G..G....A...A..P....A......A...-....-.....-....-.--...----...................-..-..---.........---..----ai............................
A0A4Y7L3T0_PAPSO/234-319               ........................................................................YPTLAAAPHIFIN......A.Y.K.N.LL.....A.VALA..T.......E....Y.S...F.......PQ............A.E...QV.K.E.Y.LK.D.PSKFAT............................................AAPVAA..S.....G....S.......A......A......A....P..A....A...A..A....A......K...V....E.....E....K.KD...EPA-...................E..E..SDD.........DMA..----mki...........................
A0A3P9DP53_9CICH/169-252               ........................................................................YPTLASVPHSVIN......G.Y.K.R.VL.....A.VAVE..T.......D....Y.S...F.......PL............A.D...KV.K.A.F.LA.D.PSAF--............................................AVAAPA..A.....A....A.......E......T......A....A..A....P...A..A....A......A...K....E.....E....A.KE...ES--...................E..E..SDG.........EMG..FGLF..............................
A0A2G3CXU2_CAPCH/21-109                .......................................................................p-ITSEKIATVVKA......A.N.I.S.VE.....S.YWPS..L.......F....A.K...L.......FE............K.R...DI.E.D.L.IL.N.VGTGGGp.........................................avAVAAAP..V.....A....G.......G......G......A....A..A....A...A..P....A......A...A....E.....K....K.EE...TK--...................E..E..SDD.........DLG..LNLF..............................
A0A087UME9_STEMI/2-70                  ......................................................................qp----EKISTILKA......A.N.V.D.VE.....S.YWPG..L.......F....S.R...A.......LE............G.I...DI.K.Q.L.IT.N.VGSGV-............................................--GAAP..T.....A....A.......P......A......S....G..G....A...A..A....E......A...A....G.....G....E.KK...E---...................-..-..---.........---..----a.............................
A0A395H949_9EURO/17-108                ........................................................................SPSTEDIKGVLSA......V.G.I.D.AD.....E.ERLQ..K.......L....I.A...E.......LE............G.K...DL.Q.E.L.IA.E.GSTKLAsv.......................................psgGAGAAA..A.....P....A.......A......G......G....A..A....A...A..A....D......A...P....A.....E....E.KE...EEK-...................E..E..SDE.........DMG..FGLF..............................
A0A165GAE5_9APHY/17-81                 ........................................................................SPSADDVKKVLGA......V.G.I.E.SE.....D.DRLG..K.......L....I.S...E.......LE............G.K...DI.N.E.L.IA.E.GSSKLAs.........................................vrP-----..-.....-....-.......-......-......-....-..-....-...-..-....-......-...-....-.....-....-.--...----...................-..-..---.........---..----shlflrspadsacv................
V7BL51_PHAVU/17-113                    ........................................................................SPSAAVIKDILGS......V.G.A.E.AD.....D.DRIE..L.......F....L.S...E.......VK............G.K...DI.V.E.V.IA.A.GREKLAsvps....................................ggggGVAVAA..A.....S....G.......G......G......G....A..A....A...A..P....A......A...E....A.....K....K.EE...KVEE..................kE..E..SDD.........DMG..FSLF..............................
A0A0C2YV85_HEBCY/17-110                ........................................................................SPSAADVKKLLGV......V.G.I.E.TD.....D.DRLS..A.......L....I.S...E.......LK............G.K...ST.A.E.L.IA.E.GSSKLAsv.......................................psgGGGGGA..A.....A....A.......P......A......A....G..G....A...A..A....A......V...E....E.....K....K.EE...KVEE..................kE..E..SDD.........DMG..FGLF..............................
R8BRB9_TOGMI/21-109                    ........................................................................EITADKITTLLKA......A.A.IeE.VE.....P.IWAQ..L.......F....A.K...A.......LE............G.K...DV.K.D.L.LS.N.VGSGGG...........................................aAAAAGG..A.....P....A.......A......G......G....A..G....A...A..E....E......A...A....E.....E....A.KE...EEK-...................E..E..SDE.........DMG..FGLF..............................
A0A2U3V7H1_TURTR/22-113                .......................................................................t-VTEDKINALIKA......A.G.V.N.VE.....P.FWPG..L.......F....A.K...A.......LA............N.V...NI.G.S.L.IC.N.VGAGGPa..........................................pAAGAAP..A.....G....G.......P......A......P....S..T....T...A..A....P......A...E....E.....K....K.VE...AKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A6P5ZIL8_DURZI/17-112                ........................................................................SPSADDLKAILGS......V.G.A.E.AD.....D.DRIE..L.......L....L.S...E.......VK............G.K...DI.T.E.L.IA.S.GREKLAsvp.....................................sgggA-VAVA..A.....P....T.......A......G......G....G..A....A...A..A....P......A...A....E.....A....K.KE...EKVEe.................kE..E..SDD.........DMG..FSLF..............................
A0A109FEK9_9BASI/17-109                ........................................................................SPSAEDIKTILGA......A.D.V.S.VD.....E.ERLS..K.......L....L.S...E.......LE............G.K...DI.N.E.V.IA.E.GSKKLAsv.......................................psgGAAPAA..A.....A....G.......G......A......A....A..A....G...G..D....A......A...P....A.....A....E.KA...EEEK...................E..E..SDD.........DMG..FGLF..............................
A0A0R3UK10_9CEST/17-121                .......................................................................r-PQESDLKTILSS......V.G.I.E.CE.....Q.ERVK..L.......L....L.D...Q.......LH............G.K...NM.N.E.L.IN.A.GKEKMStvsfsga.............................vapssgaaPAAAAP..A.....A....S.......G......A......A....P..A....G...K..P....A......A...E....A.....P....P.KE...EPKEe.................sE..E..SDA.........DMG..FSLF..............................
W2SC27_9EURO/21-113                    .......................................................................d-ITADKLTTIIKA......A.G.VaD.VE.....P.IWSS..L.......F....A.K...A.......LE............G.K...DV.K.D.L.LL.N.VGSGGGaa.......................................aapAAGGAG..G.....A....A.......A......G......G....D..A....A...D..A....P......A...A....E.....E....K.KE...EEK-...................E..E..SDD.........DMG..FGLF..............................
A0A5B6WLN2_9ROSI/234-320               ........................................................................YPTLAAAPHMFIN......G.Y.K.N.VL.....A.VAVA..T.......E....Y.S...F.......PQ............A.D...KV.K.E.Y.LA.D.PSKFAV............................................AAAPVA..A.....A....G.......G......G......A....A..P....A...A..A....P......A...E....E.....E....K.KP...EPE-...................E..E..SDD.........DMG..FSLF..............................
B8CG46_THAPS/231-316                   .......................................................................i-PTQASVTHSIAN......A.F.K.A.IL.....S.VTVE..L.......E....N.Y...S.......FD............K.A...DIyK.A.Y.LA.D.PSAFAG............................................SGGGGG..G.....G....G.......D......G......G....E..T....S...A..A....A......A...V....E.....E....V.EE...EEA-...................-..-..---.........---..----ppavdmfggg....................
A0A168CTC5_9EURO/21-109                ........................................................................EITAEKLQTLIKA......A.N.VqE.VE.....P.IWAS..I.......F....A.K...A.......LE............G.K...DV.K.D.I.LT.N.VGSAGA............................................AAPAAA..A.....A....A.......A.....gG......A....V..A....A...E..A....A......P...A....E.....E....K.AE...EKE-...................E..E..SDE.........DMG..FGLF..............................
A4S7T7_OSTLU/17-106                    ........................................................................SPSEADVKAILAG......A.A.A.E.VD.....D.SKLS..A.......F....F.K...E.......IE............G.K...DV.A.E.L.IA.E.GNAKLAsvp.....................................sgggG--GGG..G.....G....G.......D......G......G....G..D....A...G..G....A......A...A....A.....A....A.PE...AE--...................E..E..EEA.........DMD..FEL-..............................
A0A165T2J2_9AGAM/7-97                  .....................................................................htq---SDKIIALTSA......A.D.V.E.LE.....P.IWAT..L.......L....A.R...A.......LE............G.K...NV.K.D.I.LS.N.VGAGGAg..........................................pAVGAAP..A.....A....G.......A......A......A....A..G....G...A..A....A......A...E....E.....K....A.EE...KEEE..................kE..E..SDD.........DMG..FGLF..............................
A0A672ZBE8_9TELE/22-112                .......................................................................t-VTEDKLNALIKA......A.G.V.T.VE.....P.FWPS..L.......F....A.K...A.......LS............S.V...DI.G.S.L.IC.N.VGAGGG...........................................aPAGAPA..A.....G....A.......A......A......A....A..G....D...A..P....A......K...E....E.....E....K.KE...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A4D6H965_9EURY/16-113                ........................................................................EINEANLTDVLDA......A.G.V.D.VE.....E.SRVK..A.......L....I.A...A.......LE............D.V...DI.D.E.A.VD.Q.AAAVPA............................................TGGAAT..Tdd.veS....A.......D......E......G....G..D....E...D..A....A......E...E....E.....E....A.AD...EE-Dag...............ddD..E..DDE.........ASG..----eglgelf.......................
C1GLK3_PARBD/21-110                    .......................................................................d-ITSEKLQSILKA......A.N.VeD.VE.....P.IWSS..L.......F....A.K...A.......LQ............G.K...NV.K.D.I.LL.N.VGSGGG............................................AAPAAA..G.....N....A.......P......A......A....A..G....G...A..A....A......A...E....E.....K....V.EE...KEEE..................kE..E..SDE.........DMG..FGLF..............................
G4MKJ9_MAGO7/229-312                   .......................................................................f-PTWPSVIHSVVN......S.Y.K.N.IL.....S.IALE..T.......E....Y.S...F.......PA............V.E...EL.K.D.R.IA.N.PDAY--............................................-ASAAP..A.....A....G.......G......A......G....G..G....D...A..P....A......A...E....A.....K....K.DE...SEE-...................E..Q..SDE.........DMG..FGLF..............................
V4KPP2_EUTSA/17-114                    ........................................................................SPTSADIKDILGS......V.G.A.E.TE.....D.AQIE..L.......L....L.K...E.......VK............G.K...DL.A.E.L.IA.A.GREKLAsvps...................................ggggvAMASAP..S.....A....G.......G......G......G....G..G....A...A..P....A......A...E....A.....K....K.EE...KKEE..................kE..E..SDD.........DMG..FSLF..............................
A0A2T7ED55_9POAL/52-146                ........................................................................SPTADDVKNILES......V.G.A.E.AD.....E.EKLD..F.......L....L.T...E.......LK............D.K...DI.T.E.V.IA.A.GREKFAsvp......................................sggGAIAVG..A.....P....A.......A......A......A....G..G....A...A..P....A......E...E....A.....K....K.EE...KVEE..................kE..E..SDD.........DMG..FSLF..............................
A0A200QQZ5_9MAGN/21-108                .......................................................................s-ISAEKIATLVKS......A.N.V.D.VE.....P.FWPS..L.......F....A.K...L.......LQ............K.I...NV.E.D.GnVG.S.GGGAAA............................................VAVAAP..S.....G....G.......G......A......A....A..A....T...A..A....P......A...A....E.....E....K.KE...EPK-...................E..E..SDD.........DMG..FSLF..............................
A0A1S3LEC7_SALSA/81-176                ........................................................................SPSSKDIKTILGS......V.G.I.E.AE.....D.ERLD..K.......V....V.N...E.......LN............G.K...DI.N.E.V.MN.S.GLSKLAsvp......................................aggA-VAAP..A.....A....A......gS......A......A....A..G....V...S..P....T......A...A....E.....E....K.KE...EKEEs.................eE..G..SDD.........DMG..FGLF..............................
A0A1A6GCN7_NEOLE/30-86                 .......................................................................t-VMEDKINALIKA......A.G.V.N.VE.....S.FWPG..L.......F....A.K...A.......LA............N.V...NI.G.S.L.IC.N.IG----............................................PGGPAP..A.....A....G.......A......A......-....-..-....-...-..-....-......-...-....-.....-....-.--...----...................-..-..---.........---..----pdf...........................
A0A195B898_9HYME/22-109                .......................................................................a-VTGEKIQTILKA......A.N.V.N.VE.....S.YWPG..L.......F....A.K...A.......LE............G.I...NV.K.E.L.IT.N.IGSGVGa..........................................aPVGAAP..A.....A....A.......A......P......V....S..T....E...A..A....P......T...K....E.....E....K.KK...EEPE...................E..E..SDD.........DMG..F---v.............................
A0A5M6C704_9TREE/229-314               .......................................................................i-PTIASVAHSLVN......S.Y.K.N.IL.....G.VSLA..T.......D....Y.E...F.......EG............S.A...KI.K.E.Y.LA.N.PEAF--............................................AAAAAP..A.....A....S.......T......E......A....A..S....G...G..D....A......A...P....A.....A....A.KE...EEKE...................E..S..EDD.........DMG..FGLF..............................
A0A2V0PQA9_9CHLO/17-107                ........................................................................NPTAADVKKILGS......V.G.V.E.AD.....A.ANVE..K.......L....L.G...E.......LA............G.K...DI.A.E.L.IA.A.GREKLQs.........................................vpSGGGAV..A.....A....A.......P......A......A....G..G....A...A..P....A......A...G....K.....A....E.AK...KEEP...................S..E..EDE.........DMG..FSLF..............................
A0A4U0VIG9_9PEZI/259-343               ........................................................................YPTLPSVMHSMLN......S.Y.K.N.LL.....A.IAVE..T.......E....Y.E...W.......PA............I.S...QL.K.A.V.IK.D.PSLA--............................................QSSAPA..A.....S....A.......P......A......D....A..P....A...A..E....A......P...K....E.....E....E.KK...EDE-...................E..E..EDE.........DMG..FGLF..............................
A0A2U3YCF3_LEPWE/17-114                ........................................................................SPSAKDIKKILDS......V.G.I.E.AD.....D.DRLN..K.......V....I.S...E.......LN............G.K...NI.E.D.V.IA.Q.GIGKLAsvpa....................................ggavAVSAAP..G.....S....A.......A......P......A....A..G....A...A..P....A......A...A....E.....E....K.KD...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A1D2VIL8_9ASCO/12-104                ........................................................................NPTAKEIKKVLKS......V.N.A.E.ID.....E.TKLD..K.......F....L.D...E.......VS............G.K...TP.E.E.L.IA.E.GNSKLSsv........................................pgGSSGSA..A.....G....G.......A......T......T....T..D....S...T..D....K......A...E....E.....K....E.EE...ADES..................eE..E..SDD.........DMG..FGLF..............................
A0A395TAT1_9HYPO/228-310               .......................................................................f-PTLPSVLHSLVN......S.Y.K.K.VL.....A.VAVV..T.......E....V.T...W.......PE............I.E...QL.K.D.R.IA.N.PDAY--............................................-ASAAP..A.....A....A.......A......A......G....G..A....A...A..P....A......E...E....E.....K....K.DE...SEE-...................E..E..DEE.........GFG..-GLF..............................
J3MJT3_ORYBR/17-122                    ........................................................................SPSKDDVRAILAS......V.G.A.D.VVgdrdaN.AKLD..L.......L....F.A...Q.......VA............G.K...DV.A.E.L.IA.V.GSEKFAfap......................................cggAAAAAA..A.....P....P.......A......G......A....A..A....E...E..K....E......K...E....E.....E....E.EE...EEEKave.............kveE..E..DDD........dDIV..FSLF..............................
A0A0D9Y5M9_9ORYZ/53-118                ........................................................ssfamvspssavfqvi-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.IG.A.VGGGAA...........................................iGGAAAG..G.....A....A.......A......G......G....A..A....A...E..A....P......K...S....E.....E....K.KE...EEK-...................E..E..SED.........DLG..FSLF..............................
A0A0V1I0I6_9BILA/231-318               ........................................................................YPTAASAPHMIAN......A.F.K.N.LL.....S.IAAV..T.......D....I.T...F.......KE............A.E...KL.K.E.Y.LA.D.PSKF--............................................AVAAAP..A.....A....A.......A......A......A....D..S....K...A..A....K......D...D....S....sS....K.KE...EKVE...................E..E..SDE.........EEG.mGGLF..............................
A0A0R3PL14_ANGCS/17-112                .......................................................................s-PKLEDIKNILDA......V.G.V.D.TD.....A.EAAN..L.......V....I.S...R.......LQ............G.K...NI.E.Q.V.IA.E.GAADLVtisg....................................gvpaASTPAA..A.....A....V.......D......A......P....A..A....A...A..P....A......A...E....T.....K....P.AK...KEEK...................E..E..SDD.........DMG..FGLF..............................
A0A0U5G341_9EURO/229-313               ........................................................................YPTLPSVIHSVLN......S.Y.K.N.VL.....S.VAVE..T.......E....Y.S...W.......PE............I.E...EL.K.D.R.IA.N.PEAY--............................................-AAAAP..A.....A....G.......A......A......A....G..G....A...A..P....A......A...A....A.....E....A.AP...AEEE...................E..Q..SDE.........DMG..FGLF..............................
J4UJH5_BEAB2/17-110                    ........................................................................SPSAKDITGVLSA......V.G.I.E.AD.....E.ERVK..T.......L....L.S...E.......LK............D.K...DI.N.E.L.IA.E.GSSKLAsvp.....................................sggaGGAAAA..G.....G....A.......A......A......A....G..G....A...A..D....A......P...A....A.....E....E.KE...EEK-...................E..E..SDE.........DMG..FGLF..............................
A0A0D3C2E8_BRAOL/17-112                .......................................................................c-PTSADIKVILNS......V.G.C.E.TE.....D.SQIE..L.......L....L.K...E.......VN............G.K...DV.A.E.L.IA.V.GREKLAsvps....................................ggggVAMASA..P.....S....A.......G......G......G....G..G....A...A..P....A......E...D....K.....K....E.EK...KEEK...................E..E..SDD.........DMG..FSLF..............................
A0A1V6QLN2_9EURO/17-107                .......................................................................a-PSSADIKSVLSS......V.G.I.D.AE.....G.DRLE..K.......V....I.A...E.......LQ............G.K...DL.Q.E.L.IS.E.GSAKLAsv........................................psGGAGAA..A.....P....A.......A......A......A....A..G....G...A..D....A......P...A....E.....E....K.VE...EKE-...................E..E..SDE.........DMG..FGLF..............................
A0A670ZIR1_PSETE/22-112                .......................................................................t-VTEDKINALIKA......A.G.V.N.VE.....P.FWPG..L.......F....A.K...A.......LT............S.I...DI.G.S.L.IC.N.VGVGGG...........................................aPAASAP..A.....G....G.......G......T......P....A..G....G...A..A....P......A...E....E.....K....K.EE...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A093BVF1_TAUER/207-293               ........................................................................YPTIASVPHSIVN......G.Y.K.R.VL.....A.VAVE..T.......D....Y.T...F.......PL............A.E...KV.K.A.F.LA.D.PSAFVAa..........................................iPV--VA..E.....A....A.......A......P......A....A..A....A...A..A....A......P...A....K.....E....A.AK...EES-...................E..E..SDE.........DMG..FGLF..............................
A0A091CK14_FUKDA/177-262               ........................................................................YPNVASVPHSIIN......G.Y.K.P.VL.....A.FSVE..T.......D....Y.T...F.......PL............V.E...KV.K.A.F.LA.G.PSAF--............................................VAVPPV..T.....A....A.......T......T......A....A..P....A...A..A....A......A...P....A.....K....V.EA...TEKS...................E..E..SDD.........DMG..FGLF..............................
A0A1U8N2L0_GOSHI/234-320               ........................................................................YPTLAAAPHMFIN......G.Y.K.N.VL.....A.VAVA..T.......E....Y.S...F.......PQ............A.D...KV.K.E.Y.LA.D.PSKFAV............................................VAAPVA..G.....G....G.......G......G......A....A..P....A...A..A....P......A...E....E.....E....K.KP...EPE-...................E..E..SDD.........DMG..FSLF..............................
A0A3B6RNX6_WHEAT/36-119                .......................................rqlvsaacaedksggvqssftmvspksaifqvv-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.IG.G.AS-AGPi.........................................ggGGAAGG..A.....A....A.......S......G......G....A..A....A...E..A....P......K...A....E.....E....K.KE...EEK-...................E..E..SED.........DLG..FSLF..............................
A0A024W572_PLAFA/231-315               .......................................................................v-ITEASYPHVFVE......A.F.K.N.IV.....A.LIID..S.......D....Y.T...F.......PL............M.E...NI.K.K.M.VE.N.PEAF--............................................AAVAAP..A.....S....A.......A......K......A....D..E....P...K..K....E......E...A....K.....K....V.EE...EEE-...................E..E..EDG.........FMG..FGMF..............................
A0A0D2N385_GOSRA/17-115                ........................................................................NPSADDLKAILGS......V.A.A.E.AD.....D.DKIE..M.......L....L.S...E.......VK............G.K...DI.T.E.L.IA.S.GREKLAsvpsg.................................ggggggVAVAAP..T.....T....G.......G......G......A....G..D....A...P..A....A......E...T....K.....K....E.EK...VEEK...................E..E..SDD.........DMG..FSLF..............................
A0A1X2G9F4_9FUNG/20-104                ........................................................................EITEDKLQTLVKA......A.G.V.E.VE.....P.IWFS..L.......Y....A.K...A.......LA............G.Q...DL.N.E.L.LT.K.VGTP--............................................GAGPAV..S.....A....G.......A......A......A....G..G....A...A..A....E......A...V....E.....E....A.KE...EEK-...................E..E..SDD.........DMG..FGLF..............................
A0A445CPM4_ARAHY/21-112                .......................................................................p-VTAENISSLLKS......A.K.V.S.VE.....S.YWPS..L.......F....A.K...L.......AE............K.R...NV.E.D.L.IA.S.GGGGGApv........................................avAAAPVA..A.....A....G.......G......G......G....G..A....A...A..A....P......A...A....E.....E....K.KK...EEPQ...................E..E..SDD.........DMG..FSLF..............................
A0A7F8RI09_LEPWE/23-106                .......................................................................g--TETKINALIKA......A.S.M.N.VE.....P.FWPG..L.......F....A.K...A.......LA............D.V...SI.R.R.L.TC.N.VGTG--............................................G--PAP..A.....G....G.......P......A......P....S..T....S...A..A....P......A...E....K.....K....V.EA...KKEE..................sE..E..SDD.........DMG..FGL-l.............................
A0A6G1CZ77_9ORYZ/17-68                 ........................................................................SPTKDDVRAILGA......V.G.A.D.VD.....E.DKLD..L.......L....F.A...R.......IA............D.K...DV.T.E.L.IA.V.GREKFA............................................------..-.....-....-.......-......-......-....-..-....-...-..-....-......-...-....-.....-....-.--...----...................-..-..---.........---..----faddd.........................
A0A078JT63_BRANA/15-83                 ..................................................................nespsa-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.G...DL.K.K.I.LE.S.VEKMAAlss.....................................ggptVAVAAG..G.....G....G.......A......A......A....P..A....A...E..P....A......A...A....E.....K....K.KE...EEK-...................E..E..SED.........DGG.mMSLF..............................
A0A0S3STC7_PHAAN/17-113                ........................................................................SPSAAVIKEILGS......V.G.A.E.AD.....S.DRIE..L.......F....L.S...E.......IK............G.K...DI.V.E.V.IA.A.GREKLAsvps....................................ggggAVAVAA..A.....P....G.......G......G......G....A..A....A...A..P....A......A...E....A.....K....K.EE...KVEE..................kE..E..SDD.........DMG..FSLF..............................
A0A0E0CLG0_9ORYZ/586-681               ........................................................................NPSAEDLSTILES......V.G.A.E.VD.....H.GKMD..L.......L....L.S...Q.......LA............G.K...DI.T.E.I.IA.S.GREKFAsvp......................................cggGGIAVA..A.....A....A.......P......A......A....G..G....G...A..A....P......Q...S....E.....A....K.KE...EKVEe.................kE..E..SDD.........DMG..FSLF..............................
A0A6P7M4I2_BETSP/17-114                ........................................................................NPESKDIKKILDS......V.G.I.E.AD.....N.TRLD..K.......V....I.T...E.......LK............G.K...NV.N.D.V.IA.T.GYSKLAsvpa....................................ggavAVASSA..A.....A....G.......S......G......G....A..A....A...P..A....A......A...A....E.....E....K.KE...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A6P5RZH9_PRUAV/17-113                .......................................................................t-PSAEDLKDILGS......V.G.A.E.TD.....D.DRIQ..L.......L....L.S...E.......VK............G.K...DI.T.E.L.IA.S.GREKLAsvp.....................................sgggGAVAVA..A.....P....G.......G......G......G....G..A....A...A..P....A......A...A....E.....P....K.KE...EKVEe.................kE..D..TDD.........DMG..FSLF..............................
A0A0M9FQ02_9TRYP/85-173                .......................................................................p-VTADNISAAVKA......A.G.V.E.VR.....P.TLPI..I.......F....A.R...F.......LE............K.K...SV.D.S.L.MA.A.AAAVAPa..........................................aAEAPAA..A.....A....G.......G......A......A....P..A....A...G..G....K......A...K....E.....E....K.KK...EVE-...................E..E..GDD.........DMG..FGLF..............................
K7MZ77_SOYBN/17-112                    .......................................................................a-PSADDLRTILGS......V.G.A.D.AN.....D.DNIS..N.......F....L.S...E.......VK............G.K...DI.A.E.L.IA.A.GREKLAsvp......................................sggGAAVSV..A.....A....A.......P......G......G....G..A....A...A..P....A......A...A....E.....S....K.KE...EKVEe.................kE..E..SDD.........DMG..FSLF..............................
A0A094HEI7_9PEZI/63-140                ......................................................................qr-------------......-.-.-.-.AD.....S.ERLD..A.......L....I.S...E.......LK............G.K...DI.N.T.L.IS.E.GAAKLAsvp......................................sggGGGAAA..A.....G....G.......A......A......A....G..G....A...T..E....D......A...P....V.....E....E.KE...EEK-...................E..E..SDE.........DMG..FGLF..............................
A2EIR1_TRIVA/17-105                    .......................................................................t-PSAADVKAILES......V.G.A.A.VD.....E.QKLN..H.......V....I.A...K.......FE............G.K...NI.E.E.L.IE.E.GAKKMI............................................STGAAV..A.....A....A.......P......A......A....G..A....A...G..A....A......A...E....E.....A....P.KE...EAKE...................E..E..PAAp.......lDLG..-D--mf............................
A0A067S6N2_GALM3/41-133                ......................................................................tq---ADKIIALTNA......A.G.V.E.LE.....P.IWAT..L.......L....E.K...A.......LA............G.K...NI.M.E.L.LT.D.IGARGAs..........................................aS-GGSA..V.....A....T.......A......A......T....S..G....E...S..P....P......A...A....P.....N....I.EE...KEENe.................gD..D..SDD.........DLG.iT---gfllf.........................
A0A392TXT2_9FABA/1-40                  ......................................................................vv-------------......-.-.-.-.--.....-.----..-.......-....-.-...-.......--............-.-...--.-.-.-.--.-.------............................................-VAAAP..A.....S....G.......G......G......A....A..P....A...A..A....E......A...K....K.....E....E.NV...EEK-...................D..E..SDD.........DMS..FKL-..............................
A0A074WAS3_9PEZI/21-108                ........................................................................EITADKLNTLISA......A.K.L.E.VE.....P.IWTQ..L.......F....A.K...A.......LE............G.K...DV.K.E.L.LL.N.VGSGS-............................................GAAAAP..A.....A....G.......G......A......A....A..G....G...A..A....A......E...D....A.....P....A.EE...KAEE..................kE..E..SDD.........DMG..FGLF..............................
A0A0S3SHC8_PHAAN/21-111                .......................................................................a-VTADSIATLLKT......A.K.V.Q.VD.....S.FWPT..L.......F....A.K...L.......AE............K.K...NL.G.D.L.IA.N.AAGGGApv........................................avAAAPVA..A.....A....G.......G......G......A....A..A....A...A..P....A......A...E....E.....K....K.KE...EPE-...................E..E..SDD.........DMG..FGLF..............................
A0A0E0EHH4_9ORYZ/234-318               ........................................................................YPTIAAAPHMFLN......G.Y.K.N.VL.....A.VAVE..T.......E....Y.S...Y.......PH............A.D...KI.K.E.Y.LK.D.PSKF--............................................AVAAPV..A.....A....D.......S......G......A....A..A....P...S..A....A......K...E....E.....E....K.KE...EPE-...................E..E..SDG.........DLG..MSLF..............................
B3S1Z8_TRIAD/22-109                    ........................................................................EITADKITALLKA......A.K.V.D.YE.....P.YWPN..L.......F....A.K...A.......LA............G.R...NI.K.D.L.IT.N.VGSGAA............................................AAPAAA..A.....A....G.......G......G......D....A..T....D...A..P....A......A...E....K.....E....A.EK...EVEE...................E..E..SDD.........DMG..FGLF..............................
A0A2X0LVZ8_9BASI/229-310               ........................................................................YPTIASVTHSLVN......S.Y.K.N.LL.....A.IALA..T.......D....V.T...F.......EG............A.E...KV.K.E.Y.LA.N.PEAF--............................................---AAA..A.....P....A.......A......T......E....S..A....A...A..P....A......K...A....E.....E....K.EP...EKE-...................E..E..SDD.........DMG..FGLF..............................
B0DA55_LACBS/229-311                   ........................................................................YPTIVSVTHTLVN......A.Y.K.N.LI.....A.ISLA..T.......E....Y.T...F.......EG............S.E...KV.K.E.Y.LA.N.PDAF--............................................---ASA..A.....P....A.......E......E......A....A..P....A...A..A....A......A...V....V.....E....E.KE...PEKE...................E..E..SDD.........DMG..FGLF..............................
A0A251SQ67_HELAN/56-152                ........................................................................SPSAEDLKKILGS......V.G.A.D.AD.....D.DKIE..L.......L....L.S...E.......VK............G.K...DI.T.E.L.IA.S.GREKLAsvps....................................ggggVAVAAA..A.....G....G.......G......G......A....A..P....A...A..A....A......A...E....S.....K....K.EE...KVEE..................kE..E..SDD.........DMG..FSLF..............................
A0A4D9E3F7_9SAUR/22-111                .......................................................................t-VTEDKMNALMKA......A.G.V.N.VE.....P.FWPG..L.......F....A.K...A.......LA............N.I...DI.G.S.L.IC.N.VGAGGA............................................PAAAAP..S.....G....G.......A......A......P....A..G....G...A..A....P......A...E....E.....K....K.EE...EKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A5J9SIL3_9POAL/234-318               ........................................................................YPTLAAAPHMFIN......G.Y.K.N.VL.....A.VAVE..T.......D....Y.S...Y.......PH............A.D...KI.K.E.Y.LK.D.PSKF--............................................AVAAPV..A.....A....A.......A......G......G....G..T....A...A..A....P......K...E....E.....E....K.KD...EPA-...................E..E..SDD.........DMG..FSLF..............................
A0A0L0C8Z6_LUCCU/22-112                .......................................................................a-VTGEKISTILKA......A.N.V.E.VE.....P.YWPG..L.......F....A.K...A.......LE............G.I...NV.K.D.L.IT.N.IGSGVGa.........................................gaPAGAAA..A.....G....G.......D......A......A....P..A....A...G..E....A......K...K....E.....E....K.KK...EEEP...................E..E..SDD.........DMG..FALF..............................
A0A087VLU5_BALRE/213-295               ........................................................................YPTIASVPHSIVN......G.Y.K.R.VL.....A.VAVE..T.......D....Y.T...F.......PL............A.E...KV.K.A.F.LA.D.PSAF--............................................-VAAVP..V.....P....A.......P......P......P....A..A....A...A..A....P......A...K....E.....A....A.KE...ESE-...................-..E..SDE.........DMG..FGLF..............................
X6NNN7_RETFI/14-130                    .......................................................................p----QDIAKILDS......V.G.I.E.AN.....K.EKLN..A.......L....F.E...D.......LEk..........sG.K...TV.D.E.A.IQ.Q.GLDKLAavpadrttfcvkkkq..............pkknlaaiftinkggAGVAVA..A.....G....A.......A......P......A....A..G....G...A..A....A......A...T....E.....A....K.KE...EEEE...................E..E..KES.........ED-..----gittl.........................
A0A1G4JZC9_9SACH/17-107                .......................................................................a-PSADNVKAVLES......V.G.I.E.IE.....E.EKVS..S.......L....L.S...A.......VE............G.K...SV.E.E.L.IA.E.GNEKLAa.........................................vpASSGAA..A.....S....S.......G......A......A....T..G....G...A..A....E......E...A....A.....E....E.AA...PEAE...................E..E..SDD.........DMG..FGLF..............................
A0A078G324_BRANA/22-110                ........................................................................EITAEKIAKLVKA......A.N.V.N.VE.....S.YWPS..L.......F....A.K...L.......CQ............K.K...NI.D.D.L.IM.N.VGASGD............................................AAAPVA..T.....N....V.......P......A......A....A..Q....A...V..P....A......A...E....E.....T....K.KK...KEEV..................kE..E..SED.........DMV..FGLF..............................
S7Q1Q1_MYOBR/22-112                    .......................................................................m-VTEGKINALIKA......A.G.V.N.GE.....P.FWPG..L.......L....A.K...A.......LA............N.V...NI.G.S.L.VC.N.VEAGGPa..........................................pAASAAP..A.....G....G.......P......A......P....S..T....A...A..A....P......A...E....K.....K....V.EA...KKEE..................sK..E..SDD.........DMG..FGLF..............................
A0A1X2G5R7_9FUNG/17-106                ........................................................................QPSAADIKNLLNT......V.G.V.E.TD.....D.ERLS..S.......L....I.Q...A.......LE............S.K...DI.A.Q.L.IE.E.GKEKMAs.........................................vpTGGAVA..A.....G....A.......G......A......A....A..G....A...A..A....D......A...P....E.....E....A.KE...EEK-...................E..E..SDE.........DMG..FGLF..............................
A0A6N0NRF6_9EURY/16-104                ........................................................................EVNEDNLQDIVDA......A.G.L.D.IE.....D.TEIK..A.......L....V.A...A.......LE............D.V...DI.E.E.A.ME.T.AVAT--............................................GA-APA..A.....S....E.......S......A......E....E..G....G...E..E....A......A...E....E.....E....E.EE...AEEEd................esS..E..EEA.........AEG.lGSMF..............................
J3LDF6_ORYBR/17-112                    ........................................................................NPSAEDLSTILES......V.G.A.E.VD.....Q.GKME..F.......L....L.S...Q.......LA............G.K...DI.T.E.I.IA.S.GREKFAsvp.....................................cgggGVAVAA..A.....A....P.......V......V......G....G..G....A...A..P....Q......A...E....A.....K....K.EE...KVEE..................kE..E..SDD.........DMG..FSLF..............................
A7E8S1_SCLS1/17-111                    ........................................................................SPSAKDITTVLES......V.G.I.E.ID.....Q.ERLD..T.......L....I.K...E.......LD............G.K...DI.N.E.L.IA.E.GSSKLAsvp......................................sggSGAAAP..A.....A....G.......G......A......A....A..S....G...G..A....A......A...E....E.....K....A.EE...KAEE..................kE..E..SDE.........DMG..FGLF..............................
A0A2Y9K3H1_ENHLU/22-113                .......................................................................t-VTEDKINALIKA......A.G.V.N.VE.....P.FWPG..L.......F....A.K...A.......LA............N.V...NI.G.S.L.IC.N.VGAGGPa..........................................pAAGAAP..A.....G....G.......P......A......P....S..T....T...A..A....P......A...E....E.....K....K.VE...AKKEe.................sE..E..SDD.........DMG..FGLF..............................
A0A2I2F2Z6_9EURO/17-106                ........................................................................SPSAADIKGVLSA......V.G.I.D.AD.....E.DRLS..K.......L....L.S...E.......LE............G.K...DI.N.E.L.IA.Q.GSEKLAs.........................................vpSGGAGA..A.....A....A.......A......P......A....A..A....A...G..G....D......A...P....A.....Q....E.KE...EEK-...................E..E..SDE.........DMG..FGLF..............................
D3ZJT4_RAT/193-278                     ........................................................................EPTVTSVPHSIIN......G.S.K.R.VL.....A.LSVE..T.......D....Y.T...F.......PL............A.E...KV.K.A.F.LA.D.PSAF--............................................AAAAPV..A.....A....A.......T......T......A....A..P....A...A..A....A......A...P....A.....K....A.KA...KEES...................E..E..SDE.........DVR..FGLF..............................
C6T1E4_SOYBN/17-113                    .......................................................................t-PSADDIKEILGS......V.G.I.E.AD.....E.DRIE..S.......F....L.S...E.......VK............G.K...DI.V.E.L.IA.A.GKEKLAsvps....................................ggggAVAVAA..A.....P....G.......G......G......G....G..G....A...A..P....A......A...E....V.....K....K.EE...KVEE..................kE..E..SDD.........DMG..FSLF..............................
L9XJ51_9EURY/16-116                    ........................................................................EINEDNLTDVLDA......A.G.V.D.VE.....E.SRVK..A.......L....V.A...A.......LE............D.V...DI.D.E.A.VS.E.AAVAPA............................................-AGGAA..A.....G....G.......A......A......A....A..G....G...D..E....G......G...D....E.....G....D.AE...ETSDvpdtt.........dddddD..-..---.........---..----dedeeaggeglgelf...............
A0A1U7YB93_NICSY/22-111                .......................................................................p-ITAEKIATVVKA......A.N.I.S.VE.....S.YWPS..L.......F....A.K...L.......FE............K.R...DV.E.D.L.IL.N.VGIGGGg.........................................aaVAVAAP..V.....A....G.......G......G......A....A..A....A...A..P....A......A...E....E.....K....K.EE...KKE-...................E..S..DDE.........DLG..LSLF..............................
A0A4X2LGD8_VOMUR/29-120                .......................................................................m---EDKINALMKA......A.R.V.N.VE.....P.FWPV..L.......F....A.K...T.......LS............N.V...NI.A.S.L.IC.N.VGVDGPap........................................taGGAAPA..G.....G....A.......A......P......A....S..T....A...A..P....A......Q...K....E.....K....K.GE...VKKEe.................sK..E..SDD.........DMG..FGLF..............................
Q6BGT0_DEBHA/20-104                    ........................................................................EITSDKLLAITKA......A.G.A.S.VE.....D.VWAD..V.......Y....A.K...A.......LE............G.K...DL.K.E.L.LF.S.FAAA--............................................APAAAP..A.....G....G.......A......A......A....A..A....G...D..A....P......A...A....A.....E....E.AE...EEA-...................E..E..SDG.........DMG..MGLF..............................
A0A1U8K049_GOSHI/23-110                .......................................................................i-----TIATLVKA......A.N.V.S.VE.....S.YWPS..L.......F....A.K...L.......FE............K.C...NI.E.D.L.IT.N.VGAAGAga.......................................avaAAAPVA..A.....G....A.......G......G......G....A..A....A...P..P....P......A...E....E.....K....K.KE...EPE-...................E..E..SDD.........DMG..FSLF..............................
F4IGR5_ARATH/35-126                    ...................................................................vldcv-----------VI......V.G.A.E.TE.....D.SQIE..L.......L....L.K...E.......VK............G.K...DL.A.E.L.IA.A.GREKLAsvps...................................gggggVAVASA..T.....S....G.......G......G......G....G..G....G...A..P....A......A...E....S.....K....K.EE...KKEE..................kE..E..SDD.........DMG..FSLF..............................
A0A167A7K5_METRR/17-109                ........................................................................SPSAKDIKNVLSA......V.G.I.E.AD.....D.ERLK..T.......L....L.T...E.......LK............G.K...DV.S.E.L.IA.A.GSEKLAsv.......................................psgGAGGAA..A.....A....G.......G......A......A....A..G....G...A..A....A......E...E....K.....A....E.EK...EEEK...................E..E..SDE.........DMG..FGLF..............................
R7TGE7_CAPTE/231-306                   ........................................................................YPTLASVPHSVVN......G.F.K.N.LL.....A.VAAA..T.......D....V.E...F.......KE............A.E...TV.K.E.F.LK.D.PSKF--............................................---AVA..T.....S....A.......A......P......A....A..A....A...E..E....K......K...E....E.....A....K.KE...SEE-...................E..D..SD-.........---..----rk............................
A0A7N5JLF0_AILME/231-309               ........................................................................YPTIASVPHSVIN......G.Y.K.R.VL.....A.VAVE..T.......N....Y.S...F.......PL............A.D...KV.K.A.F.LA.D.PSAF--............................................-VVAAP..V.....A....A.......V......A......-....-..A....A...A..A....V......K...E....E.....K....K.VE...ES--...................E..E..SDD.........DMG..FG--..............................
A0A5N6PUI7_9ASTR/21-109                .......................................................................p-ITAEKIAAILKA......A.K.V.E.CE.....S.YWPS..L.......F....A.K...L.......AE............K.K...NI.E.D.L.IV.N.VGAGGGg.........................................gaPAVAAP..A.....G....G.......A......A......A....A..A....A...A..P....P......P...E....E.....K....K.EE...P--K...................E..E..SDD.........DMG..FSLF..............................
A0A1Y2BVI4_9FUNG/23-113                ........................................................................EITAEKLNTLIAA......A.G.I.E.IE.....S.IWPS..L.......F....A.K...A.......LA............G.K...DL.S.A.F.LF.A.VGSGAGa..........................................gAAAPAA..A.....A....A.......A......P......A....A..G....A...A..A....A......A...P....A.....A....K.EE...KKEE..................kE..E..SDD.........DMG..FGLF..............................
A0A663M1W1_ATHCN/231-317               ........................................................................YPTIASVPHSIIN......G.Y.K.R.VL.....A.VAVE..T.......D....Y.T...F.......PL............A.E...KV.K.A.F.LA.D.PSAFVA............................................AMPVVA..E.....A....A.......A......P......A....A..A....A...A..A....A......P...A....K.....E....A.AK...EES-...................E..E..SDE.........DMG..FGLF..............................
I2H6R1_TETBL/229-311                   ........................................................................YPTLPSVGHTLIN......N.Y.K.D.LL.....A.VAIA..S.......K....Y.I...Y.......PE............I.E...EL.M.D.R.IE.N.PEKY--............................................AS-AAP..A.....A....A.......A......A......S....G..S....-...S..D....A......A...P....A.....A....A.AE...EDE-...................E..S..EDD.........DMG..FGLF..............................
A0A150VEX9_9PEZI/21-110                ........................................................................EITADKLQSLISA......A.K.VpD.VE.....P.IWCQ..L.......F....A.K...A.......LE............G.K...DV.K.D.L.LL.N.VGSGGG............................................AAAAAP..A.....Ag..gA.......P......A......A....T..E....E...A..A....P......A...A....E.....E....K.KE...EEK-...................E..E..SDE.........DMG..FGLF..............................
A0A251UIM0_HELAN/8-94                  .......................................................................l---AEKIATILKA......A.N.V.E.CE.....S.YWPS..L.......F....A.K...L.......AE............K.K...NI.E.D.L.IV.N.VGAGGGg.........................................gaPAVAAP..A.....A....G.......G......A......A....A..A....A...A..P....P......P...E....E.....K....K.EE...PK--...................E..E..SDD.........DMG..FSLF..............................
A0A0P7B2G0_9HYPO/21-107                ........................................................................EITADKLQTLIKA......A.K.VeD.VE.....P.IWTS..I.......F....A.K...A.......LE............G.K...DV.K.D.L.LV.N.VGSGGG............................................AA-AAS..G.....G....A.......A......A......T....G..G....D...A..A....E......A...V....E.....E....K.AE...SEK-...................E..E..SDE.........DMG..FGLF..............................
A0A094ASH8_9PEZI/229-310               .......................................................................f-PTLPSVMHSVVN......S.Y.K.N.VL.....S.VAIS..T.......E....Y.S...W.......TE............I.E...EL.K.E.R.IA.N.PEKF--............................................---ASA..A.....P....V.......A......S......D....A..P....K...A..A....A......A...E....E.....K....K.EE...SEAE...................-..-..ESG.........DEG.fGGLF..............................
A0A388MF19_CHABU/234-322               ........................................................................YPTLASLPHSIVN......A.Y.R.N.VL.....A.IALA..T.......D....Y.S...F...