GenomeNet

Database: Pfam
Entry: SSL_OB
LinkDB: SSL_OB
Original site: SSL_OB 
#=GF ID   SSL_OB
#=GF AC   PF09199.13
#=GF DE   Staphylococcal superantigen-like OB-fold domain 
#=GF PI   DUF1954;
#=GF AU   Sammut SJ;0000-0003-4472-904X
#=GF SE   pdb_1m4v
#=GF GA   27.00 27.00;
#=GF TC   81.20 92.20;
#=GF NC   22.40 19.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF CL   CL0658
#=GF RN   [1]
#=GF RM   12082105
#=GF RT   The Three-dimensional structure of a superantigen-like protein,
#=GF RT   SET3, from a pathogenicity island of the Staphylococcus aureus
#=GF RT   genome. 
#=GF RA   Arcus VL, Langley R, Proft T, Fraser JD, Baker EN; 
#=GF RL   J Biol Chem. 2002;277:32274-32281.
#=GF RN   [2]
#=GF RM   15213171
#=GF RT   Structural relationships and cellular tropism of staphylococcal
#=GF RT   superantigen-like proteins.
#=GF RA   Al-Shangiti AM, Naylor CE, Nair SP, Briggs DC, Henderson B,
#=GF RA   Chain BM;
#=GF RL   Infect Immun. 2004;72:4261-4270.
#=GF RN   [3]
#=GF RM   17848512
#=GF RT   Structural basis for evasion of IgA immunity by Staphylococcus
#=GF RT   aureus revealed in the complex of SSL7 with Fc of human IgA1.
#=GF RA   Ramsland PA, Willoughby N, Trist HM, Farrugia W, Hogarth PM,
#=GF RA   Fraser JD, Wines BD;
#=GF RL   Proc Natl Acad Sci U S A. 2007;104:15051-15056.
#=GF RN   [4]
#=GF RM   17996251
#=GF RT   Crystal structures of the staphylococcal toxin SSL5 in complex
#=GF RT   with sialyl Lewis  X reveal a conserved binding site that shares
#=GF RT   common features with viral and bacterial sialic acid binding
#=GF RT   proteins.
#=GF RA   Baker HM, Basu I, Chung MC, Caradoc-Davies T, Fraser JD, Baker
#=GF RA   EN;
#=GF RL   J Mol Biol. 2007;374:1298-1308.
#=GF RN   [5]
#=GF RM   18045383
#=GF RT   The crystal structure of staphylococcal superantigen-like
#=GF RT   protein 11 in complex with sialyl Lewis X reveals the mechanism
#=GF RT   for cell binding and immune inhibition.
#=GF RA   Chung MC, Wines BD, Baker H, Langley RJ, Baker EN, Fraser JD;
#=GF RL   Mol Microbiol. 2007;66:1342-1355.
#=GF RN   [6]
#=GF RM   20133685
#=GF RT   Structural basis for inhibition of complement C5 by the SSL7
#=GF RT   protein from Staphylococcus aureus.
#=GF RA   Laursen NS, Gordon N, Hermans S, Lorenz N, Jackson N, Wines B,
#=GF RA   Spillner E, Christensen JB, Jensen M, Fredslund F, Bjerre M,
#=GF RA   Sottrup-Jensen L, Fraser JD, Andersen GR;
#=GF RL   Proc Natl Acad Sci U S A. 2010;107:3681-3686.
#=GF RN   [7]
#=GF RM   21217642
#=GF RT   Substrate recognition by complement convertases revealed in the
#=GF RT   C5-cobra venom factor complex.
#=GF RA   Laursen NS, Andersen KR, Braren I, Spillner E, Sottrup-Jensen L,
#=GF RA   Andersen GR;
#=GF RL   EMBO J. 2011;30:606-616.
#=GF RN   [8]
#=GF RM   22949551
#=GF RT   Structural and functional properties of staphylococcal
#=GF RT   superantigen-like protein        4.
#=GF RA   Hermans SJ, Baker HM, Sequeira RP, Langley RJ, Baker EN, Fraser
#=GF RA   JD;
#=GF RL   Infect Immun. 2012;80:4004-4013.
#=GF DR   INTERPRO; IPR015282;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This OB-fold domain folds into a five-stranded beta-barrel [1].
#=GF CC   Members of this family are found in various staphylococcal
#=GF CC   toxins described as staphylococcal superantigen-like (SSL)
#=GF CC   proteins that are related to the staphylococcal enterotoxins
#=GF CC   (SEs) or superantigens. These SSL proteins of which 11 have so
#=GF CC   far been characterised have a typical SE tertiary structure
#=GF CC   consisting of a distinct oligonucleotide/oligosaccharide binding
#=GF CC   (OB-fold), this domain, linked to a beta-grasp domain, family
#=GF CC   Stap_Strp_tox_C, Pfam:PF02876. SSLs do not bind to T-cell
#=GF CC   receptors or major histocompatibility complex class II molecules
#=GF CC   and do not stimulate T cells. SSLs target components of innate
#=GF CC   immunity, such as complement, Fc receptors, and myeloid cells
#=GF CC   2,3,4,5,6,7,8]. SSL protein 7 (SSL7) is the best characterised
#=GF CC   of the SSLs and binds complement factor C5 and IgA with high
#=GF CC   affinity and inhibits the end stage of complement activation and
#=GF CC   IgA binding to FcalphaR [8].
#=GF SQ   11
#=GS Q2G1S5_STAA8/41-124  AC Q2G1S5.1
#=GS Q2G1S5_STAA8/41-124  DR PDB; 3V05 B; 41-124;
#=GS Q2G1S5_STAA8/41-124  DR PDB; 4RGT B; 41-124;
#=GS Q2G1S5_STAA8/41-124  DR PDB; 4RFB C; 41-124;
#=GS Q2G1S5_STAA8/41-124  DR PDB; 4RGT A; 41-124;
#=GS Q2G1S5_STAA8/41-124  DR PDB; 4RFB A; 41-124;
#=GS Q2G1S5_STAA8/41-124  DR PDB; 3V05 D; 41-124;
#=GS Q2G1S5_STAA8/41-124  DR PDB; 4RFB D; 41-124;
#=GS Q2G1S5_STAA8/41-124  DR PDB; 3V05 C; 41-124;
#=GS Q2G1S5_STAA8/41-124  DR PDB; 4RFB B; 41-124;
#=GS Q2G1S5_STAA8/41-124  DR PDB; 3V05 A; 41-124;
#=GS Q2G0X8_STAA8/42-126  AC Q2G0X8.1
#=GS SSL3_STAA8/169-253   AC Q2G0X7.1
#=GS SSL3_STAA8/169-253   DR PDB; 5D3I B; 139-223;
#=GS SSL3_STAA8/169-253   DR PDB; 5D3D A; 139-223;
#=GS SSL3_STAA8/169-253   DR PDB; 5D3D B; 139-223;
#=GS SSL3_STAA8/169-253   DR PDB; 5I4D B; 169-253;
#=GS SSL3_STAA8/169-253   DR PDB; 5I4D A; 169-253;
#=GS SSL5_STAA8/45-128    AC Q2G1S6.1
#=GS SSL1_STAA8/40-123    AC Q2G0X9.1
#=GS SSL1_STAA8/40-123    DR PDB; 4O1N F; 16-99;
#=GS SSL1_STAA8/40-123    DR PDB; 4O1N C; 16-99;
#=GS SSL1_STAA8/40-123    DR PDB; 4O1N A; 16-99;
#=GS SSL1_STAA8/40-123    DR PDB; 4O1N B; 16-99;
#=GS SSL1_STAA8/40-123    DR PDB; 4O1N E; 16-99;
#=GS SSL1_STAA8/40-123    DR PDB; 4O1N D; 16-99;
#=GS SSL11_STAA8/41-119   AC Q2G0X4.1
#=GS SSL10_STAA8/43-123   AC Q2G2X7.1
#=GS SSL10_STAA8/43-123   DR PDB; 6UCD A; 13-93;
#=GS SSL10_STAA8/43-123   DR PDB; 6LWT B; 43-123;
#=GS SSL10_STAA8/43-123   DR PDB; 6LWT A; 43-123;
#=GS SSL10_STAA8/43-123   DR PDB; 6UCD B; 13-93;
#=GS Q2G2X9_STAA8/44-126  AC Q2G2X9.1
#=GS Q2G2X9_STAA8/44-126  DR PDB; 3R2T B; 44-126;
#=GS Q2G2X9_STAA8/44-126  DR PDB; 3R2T A; 44-126;
#=GS SSL7_STAA8/44-126    AC Q2G2Y0.1
#=GS Q2G2X8_STAA8/44-126  AC Q2G2X8.1
#=GS SSL4_STAA8/121-205   AC Q2G1S8.1
#=GS SSL4_STAA8/121-205   DR PDB; 3URY A; 121-205;
#=GS SSL4_STAA8/121-205   DR PDB; 4RCO B; 121-205;
#=GS SSL4_STAA8/121-205   DR PDB; 4RCO A; 121-205;
#=GS SSL4_STAA8/121-205   DR PDB; 3URY B; 121-205;
Q2G1S5_STAA8/41-124             .KSLKYYYSKPSIELKNLDGLYRQK.VTDKGVYVWKDRKDYFVGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTN
#=GR Q2G1S5_STAA8/41-124  SS    .HHHHHHHCS-EEEESS-SEEEE-S.TTSSEEEEEETTEEEEEE--SGGGGGS-SEEE-SEEEEEE--SSEETTEEEEES-EEE--
Q2G0X8_STAA8/42-126             .KKLKAYYNQPSIEYKNVTGYISFIqPSIKFMNIIDGNSVNNIALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIGGITSAN
SSL3_STAA8/169-253              .EDLRAYYTKPSFEFEKQFGFMLKPwTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQLKKYSVGGITKTN
#=GR SSL3_STAA8/169-253   SS    .HHHHHHTTS--EEEEEEEEBE-SSSSSS-EEEE-SSSS-EEEE--TCHHHH-SS--EEEEEEEE-----TT-SSSEEES-EEE--
SSL5_STAA8/45-128               f-DLRDYYSGASKELKNVTGYRYSK.GGKHYLIFDKNRKFTRVQIFGKDIERFKARKNPGLDIFVVKEAENRNGTVFSYGGVTKKN
SSL1_STAA8/40-123               s-ELKHYYNKPILERKNVTGFKYTD.EGKHYLEVTVGQQHSRITLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVTKSN
#=GR SSL1_STAA8/40-123    SS    H-HHHHHHTS-EEEEEEEEEEEEEE.TTEEEEEEEETTEEEEEEE-STHHHHS-SEEEEEEEEEEE--SS--SSSEEEES-EEE--
SSL11_STAA8/41-119              .QDLSEYYNRPFFEYTNQSGYKEEG.K----VTFTPNYQLIDVTLTGNEKQNFGEDIS-NVDIFVVRENSDRSGNTASIGGITKTN
SSL10_STAA8/43-123              e-ALYRYYTGKTMEMKNISALK---.HGKNNLRFKFRGIKIQVLLPGNDKSKFQQRSYEGLDVFFVQEKRDKHDIFYTVGGVIQNN
#=GR SSL10_STAA8/43-123   SS    H-HHHHHSTS-EEEEECEEEEE---.ETTTEEEEEETTEEEEEE--GGGGGG--SSEEEEEEEEEE-SEE-TTSEEEEES-EESS-
Q2G2X9_STAA8/44-126             n-KLHQYYSGPSYELTNVSGQSQGY.YDSNVLLFNQQNQKFQVFLLGKDENKYKEKTH-GLDVFAVPELVDLDGRIFSVSGVTKKN
#=GR Q2G2X9_STAA8/44-126  SS    H-HHHHHHCS--EEEEEEEE--EEE.TTEEEEEE--TT--EEEE--STTTTTTSS-EE-EEEEEE--SEE-TTS-EEEE--EEE--
SSL7_STAA8/44-126               .KDLHRYYSSESFEFSNISGKVENY.NGSNVVRFNQENQNHQLFLLGKDKEKYKEGIE-GKDVFVVKELIDPNGRLSTVGGVTKKN
Q2G2X8_STAA8/44-126             n-MLHQYYSEESFEPTNISVKSEDY.YGSNVLNFKQRNKAFKVFLLGDDKNKYKEKTH-GLDVFAVPELIDIKGGIYSVGGITKKN
SSL4_STAA8/121-205              .KDLRAYYTKPSLEFKNEIGIILKKwTTIRFMNVVPDYFIYKIALVGKDDKKYGEGVHRNVDVFVVLEENNYNLEKYSVGGITKSN
#=GR SSL4_STAA8/121-205   SS    .HHHHHHTTS--EEEEEEEEEE-S--SSSEEEEE-SSSS-EEEEE-TTHHHHS-SEEEEEEEEEE-----TT--SSEEE--EEE--
#=GC SS_cons                    HHHHHHHHTS-EEEEEEEEEEEECCSTTSEEEEEEETTEEEEEEE-STHHHHSSSEEEEEEEEEEE-SCCTTTSSEEEES-EEES-
#=GC seq_cons                   ..cL+pYYopPShEhcNloGhh.ph.tspphlphp.spphhpltLlGKDcpKY+-sha.slDVFlVhEtpchpGphYSlGGlTKsN
//
DBGET integrated database retrieval system