GenomeNet

Database: Pfam
Entry: Spike_torovirin
LinkDB: Spike_torovirin
Original site: Spike_torovirin 
#=GF ID   Spike_torovirin
#=GF AC   PF17072.8
#=GF DE   Torovirinae spike glycoprotein
#=GF AU   Llagostera M;0000-0001-8177-8321
#=GF AU   Mitchell A;0000-0001-8655-7966
#=GF SE   Manual
#=GF GA   35.00 35.00;
#=GF TC   37.00 38.90;
#=GF NC   34.60 31.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF CL   CL0595
#=GF RN   [1]
#=GF RM   15731234
#=GF RT   B-cell responses in patients who have recovered from severe
#=GF RT   acute respiratory syndrome target a dominant site in the S2
#=GF RT   domain of the surface spike glycoprotein.
#=GF RA   Zhong X, Yang H, Guo ZF, Sin WY, Chen W, Xu J, Fu L, Wu J, Mak
#=GF RA   CK, Cheng CS, Yang Y, Cao S, Wong TY, Lai ST, Xie Y, Guo Z;
#=GF RL   J Virol. 2005;79:3401-3408.
#=GF DR   INTERPRO; IPR031412;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   The spike glycoprotein is a corona viral transmembrane protein
#=GF CC   that mediates the binding of virions to the host cell receptor
#=GF CC   and is involved in membrane fusion. The torovirinae spike
#=GF CC   proteins appear distinct from other coronaviridae spike
#=GF CC   proteins, such as human SARS coronavirus [1]. This entry also
#=GF CC   includes some alloherpesvirus fusion glycoproteins.
#=GF SQ   37
#=GS A0A6G0HF40_LARCR/662-927    AC A0A6G0HF40.1
#=GS A0A0E3J9I3_9NIDO/16-625     AC A0A0E3J9I3.1
#=GS A0A384ZVC6_9VIRU/16-1137    AC A0A384ZVC6.1
#=GS SPIKE_BEV/28-1550           AC P23052.1
#=GS A0A2H5AJI8_9VIRU/65-530     AC A0A2H5AJI8.1
#=GS A4FTJ4_9VIRU/32-1371        AC A4FTJ4.1
#=GS D2E8B8_ANHV1/10-1359        AC D2E8B8.1
#=GS A0A6G0HEI2_LARCR/639-921    AC A0A6G0HEI2.1
#=GS A0A4V6ATJ7_COLLU/721-1021   AC A0A4V6ATJ7.1
#=GS A0A6G0HFZ9_LARCR/427-776    AC A0A6G0HFZ9.1
#=GS A0A4U5ULG7_COLLU/162-397    AC A0A4U5ULG7.1
#=GS A0A6G0HFE6_LARCR/620-885    AC A0A6G0HFE6.1
#=GS A0A6G0HFE6_LARCR/916-1308   AC A0A6G0HFE6.1
#=GS A0A2H5AJI8_9VIRU/587-1349   AC A0A2H5AJI8.1
#=GS A0A6G0HEI2_LARCR/953-1344   AC A0A6G0HEI2.1
#=GS K7PC08_9VIRU/31-1378        AC K7PC08.1
#=GS A0A4U5ULG7_COLLU/417-635    AC A0A4U5ULG7.1
#=GS A0A444V833_ACIRT/402-695    AC A0A444V833.1
#=GS A0A6G0HFZ9_LARCR/139-391    AC A0A6G0HFZ9.1
#=GS A0A6G0HF40_LARCR/959-1350   AC A0A6G0HF40.1
#=GS K7PBM0_9VIRU/27-1368        AC K7PBM0.1
#=GS Q14VR2_RAHV1/6-1142         AC Q14VR2.1
#=GS A0A6G0HEG0_LARCR/2-384      AC A0A6G0HEG0.1
#=GS A0A0E3J9I3_9NIDO/594-1199   AC A0A0E3J9I3.1
#=GS A0A6G0HFM4_LARCR/661-926    AC A0A6G0HFM4.1
#=GS VG46_ICHVA/15-1320          AC Q00104.1
#=GS A0A4U5ULI2_COLLU/607-907    AC A0A4U5ULI2.1
#=GS A0A1X9T5E6_9VIRU/409-1167   AC A0A1X9T5E6.1
#=GS Q14W34_9VIRU/16-1167        AC Q14W34.1
#=GS A0A1X9T5E6_9VIRU/6-415      AC A0A1X9T5E6.1
#=GS A0A4V6ATJ7_COLLU/1006-1396  AC A0A4V6ATJ7.1
#=GS A0A444V833_ACIRT/694-975    AC A0A444V833.1
#=GS SPIKE_WBV24/13-1197         AC Q008X4.1
#=GS A0A097P9K3_9NIDO/28-1542    AC A0A097P9K3.1
#=GS A0A6G0HFM4_LARCR/1056-1306  AC A0A6G0HFM4.1
#=GS A0A4U5ULI2_COLLU/888-1282   AC A0A4U5ULI2.1
#=GS SPIKE_BRV1/28-1552          AC O90304.1
A0A6G0HF40_LARCR/662-927               ...........................................................................ssssssfsgghhrvvklddivteipesqykdpasgskncldpq----------------.------..----------------------------------------------.....----------------..------..---------....-----.----------.------------------..--------.---------------..---------------------------...----------------------------........---.......-------.-------...---------------...........------------------------................----------..-----......--------------...-..------............--------------------------------------------...--------.--------..-.------------------------.------.-----------------------------------------------....--------------------------....-----..----------------------------.------------..........--------------------------------.......--------------------......---------...........................--------...------------------...................-YNIGLSN.TIV..CPGLIAAHG.ALGVFKEPYKELYSTSYD.KIFiGNLYKLEsCTP....GEPNKK..AKVS--AEPPQ.VAININTLIPTTD...............SNH................YMVGI..................................LDT-.ERVVeYAP.PVNKVC...........vSYNTGENTHS......MNVVSVDDGyAVDKPmVE......................................VEHgVIVKPTEVLYMVSNFTPGIDYINLNVSCVNYDVSALRPCLIAICG...GDNSCRKDYGRLCNSAH...EIVNDA---...-----------......................---------------.---------------------...............................................---------------------------------------------------...........--------....------------------------------------------------------------.......------------------------------------------------------------...................-------....-----------------............--------------.........------------.----..-----------------------..------------.--------.------------.--........-----------..-----------------.---------.------.------------------------.......-------------------....---------------.-------...------------------------------.....------------rragelmreglealavq................................................
A0A0E3J9I3_9NIDO/16-625                ..................................................................................................................vsaq----INTTLPDC----.PIPTCT..YTPPTTTPFDHTSLHSFFTHDTNYAFLLSL-KYNGTFIPATMAMPA.....NNLSQTYTLNYKNVFV..NVPDSQlpPPQRSNTQL....AVVAT.----TASCLT.ATYTAIPGTIPA-LAATD.mYCVKFTQS.SNFVYLYDTTVNTP-..VGVLLKNPTAPVVTTILSTIMVNRPTT...VSTSQLLSNIYSLMRTRSNVIQQQFTCT........SC-.......LFAIDAStGRAATSPtthLLNNWSPSF---FET...........KTAMLDHVSMNTIY-----QTA--................RGVTRETFTSyiLNAAK......TAAYARGSPAYYIF...SfaAIARYH............-QAMVTPYNYNIGKLCEATAACCLSNG----IEHFDIYTWLFHY...YGFMKSKV.YSETFTTNpvL.TSVINLATSIKGKHSSYCDLTPYS.SFTAYN.-LIMLQDV--VEQYQGTRTTSTYANNFLNLTDINGYLPYSTHTPLPQ....NYQNYMPFATYLLATFYSSFTLQQKF....DFHRFlqSVCYYDSGFISRNQAYHSICHIITLKTS.SSVPYPAELQWP..........---FTALPSSGYDSYPVSTGLGTVAVGNTNPL.......DYPGICYQSVCLTHPTINFR......LLLSELPI-...........................KWEVRPEG...------------------...................--------.---..---------.------------------.---.-------.---....------..-----------.-------------...............---................-----..................................----.----.---.------............----------......---------.-----.--......................................---.---------------------------------------------...-----------------...---------...-----------......................---------------.---------------------...............................................---------------------------------------------------...........--------....------------------------------------------------------------.......------------------------------------------------------------...................-------....-----------------............--------------.........------------.----..-----------------------..------------.--------.------------.--........-----------..-----------------.---------.------.------------------------.......-------------------....---------------.-------...------------------------------.....------------iyvtsrndptclnfktsqlgtvfitlydsnaxctlqqttysrsavlrqv................
A0A384ZVC6_9VIRU/16-1137               ......................................................................................................................LFVLILTLFVTKCTTL.YYDGCV..SINKTTVYDEFNNTI-ASNFQVGSRYSIKLSQRVHGFNSARRQRGG.....GSLCEYVCKDGASAFF..EYNG--..--DDVVCAL....EIIEK.-----ECENC.PHVCSQHLTIGGRLTSKD..ACYTDTSSlAKDDADTVDLLRAFW..KAMISGTLTNIASSILFQDR-LAQETK...NCLKGYTGHMMPQQSGNCPDSIGDFCLN........DY-.......CVSRYGM.GRGFTNQ...FVKPGQSSF--IPSS...........VPLGVCRFTNNVDY--FPP-ELCS................ECIIP-VDIK..TQ-QV......LHPLPVG-------...-..-CKKLV............-ASL----------------------K-LTAYTNQEMLNAAV-F...LTTNKFGF.TGLEFETE..-.---GFNAALSTFLEMLHTDISQRP.GLLTLD.VNVMLTSTGAVTDYRKQLTDTK----------A---AAYPDARIVWL....NVGAARETD---FGSSSPAEVLLNAM....VLWRS..---------------------RFSTGII.------------..........------------DPSV------KDTQNVLSSK.......TVHAA-YSIPLRKADLIAFQ......HDVLGTNEY...........................RLNDLTNG...--------KKSY------...................YYYVGEER.LIF..CPGVQMYTN.NNLYLGYPYKNTSSVPFL.NIY.HADSDFE.CKQ....GPPVPE..NKCK--GPLPT.LAFSVLKQQE--E...............QAN................PGEVY..................................WEPD.ENCY.WGP.NGPKLC............SFSEVNKQVT......STMYMINDA.VVDEI.QE......................................FPT.HYLGFKGFYKVIDAFGDIVEIFALDQICGGVDINKVPTCVQAVCD...RDQSCIDTNAQNACYMD...TAVRDSVKA...LIDEFEYAKTR......................YKDTISIAETWRK--.----MSATRPKRFWAEIMAGA...............................................-----ALALAGAAFGMASVALYKADVAMYKANQAFDMGLKNQIAITKVGLD...........VDILKTTL....DIQKGELVKIKNTVVQLGNSVVRLSASMQAEIESVNGRISFLEASVNTRFTQVATYINEV.......VSSLGNAITLQGRAAIYFQQLNALSNTVIQSTSKLTSQTIMYSDCLQSIFNGKLYGCKIK...................DPFLTIN....PDYAVVKSVYGAVF--D............GSYLSVMFKIPKSV.........KQTALYTIAIKP.IMIN..NSPHIVDSSNTMVGADGRFYIKP..YCEGVYCMPLEE.DTRFAACF.AEIRANNSAGVE.KL........CVMIACQQAGC..ADKLKMK-TVTGELQLS.AEPLVSFTF.KSPKFF.--QVAFDP-LVIQNMTGYANITSI.......DDILIDIIENSNNMSIYVD....NATKIVDEL----LN.KIGGSKA...VMDIL-----FGGGSGLFPSSGLSTSTIII.....I-VCVVIAAAF-a................................................................
SPIKE_BEV/28-1550                      ......................................................................................................................LIFSEPVPYPFSLDVLrSFSQHVvlRNKRAVTTISWSYSYQITTSSLSVNSWYVTFTAPLGWNYYTGQSFGtvlnqNAMMRASQSTFTYDVI..SYVG--..QRPNLDCQV....NSLVN.GGLDGWYSTVrVDNCFNAPCHVGGRPGCSigLPYMSNGV.CTRVLSTTQSPGLQY..-EIYSGQQFAVYQITPYTQYTITMPSG...--ILGYCQQTPLYVDCGTWTPFRVHSYGcdkvtqncKYTltsnwvvAFQNKAT.AVILPSE...LIVPVAQKVTRRLGVntpdyfwlvkqAYHYLSQANLSPNY--ALFSALCN................SLYQQSATLS..-TLCF......GSPFFVAQECYNNA...L..YLPDAV............FTTLFSTLFSWDYQINYPLNQVLTQNETFLQLPATNYQGQTLSQgrmLNLFKDAI.VFLDFFDT..K.FYRTNDAPSSDIFVVVARQAQLIRyGNFRIE.QINGYFQVKCSSNIISTLEPHPAGVIMIARHHSMWSVAARNSTSFYC....VTHSLTTFGKLDISTSWFFHTLALPS....GPVSQ..VSMPLLSTAAVGVYMHPMIEHWIPLLTL.AQSQYQPSFFNIg.......inKTITLTTQLQAYAQVYTAWFLSVIYVRLPEAR.......RLTLGVQLVPFIQALLSIKQ......ADLDA----...........................TDVDSVAR...YNVLSLMWGRKYAVVN--...................YNQLPEWTyPLFkgEIGESMWFRkKIMPTTEGCQTSAHFSSI.TGY.LQFSDYVyIPKynkvSCPISTlaPSVLQVYEVQSlFVILIQCVSGSYDwypgl....sggtafVYKsyklg.....tvcvllPSDVLstgpnigfysg............talsivtvqttNDVL.PNCIgLVQdNIFTPChpsgcpvrnsydNYIVCFDSSTy...tfKNYHRTTPP.VMNVP.IQevplqmeiptvilqsyelkhtesvllqdieggiivdhnTGS.IWY-PDGQAYDVSFYVSVIIRYAPPKLELPSTLANFTSCLDYICF...GNYQCRTEAQTFCTSMDyfeQVFNKSLISlktALQDLHYVLKLvlpettlelteltrrrrravyeFDDTISLLSESFERFmSPASQAYMANMLWWDDAFDGFslpqrtgsilsr......................spslssvsswnsyTSRTPLISNVKTPKTTFNVKLSMPKLPKASTLSKIGSVLSSGLSIASLGLS..........iFSIVEDRRv..tELTQQQIMALEDQITILTDYTEKNFKEIQSSLNTLGQQVQDFSQQVTMSLQQLSNGLEQI.......TQQLDKSIYYVTATQQYATYMSSLINHLTELAAAVYKTQDMYVTCIHSLQSGVLSPNCITpsqifqlyq.varnlsgqcQPIFSERe..vSRFYSLPLVTDAMVHNDtywfswsipitcSNIQGSVYKVQPGY.........---IVNPTHPTS.LQYD..LPSHVVTSNAGALRFDDHYCDR-..YNQVYLCTKSAF.DLQPSNYL.TMLYSNISENVSlTFhpeprpdpCVYLSSSALYCyySDQCNQCVVAVGNCSNQ.TVTYRNYTY.------.PIMDPQCRGFDQITISSPIDIGVDftalpsrPPLPLHLSYVNVTFNVTIP....------HGLNWTDLVlDYSFKDK...IYEISKNITDLHQQILQVSSWASGWFQRIR.....DFLYNLLPTWIT.................................................................
A0A2H5AJI8_9VIRU/65-530                ...............................................................................................................evfdatm----------------.------..------------------------SYTLTTFGRIATVNGTTTA---.....ATGCSHLCPPGVTLPVvaRVMGTP..THRKFGLSFv..rPLITN.ASVLEGCVEV.GYECDEPITPNSPLNPLS..IFFHGSPE.LKEALFGNITCTTPWtlACAVIEVLTALRDNTPPDPGALGALRGseyNCLLAYLGLGDLPAKSPCWAQLGPMCYS........GYGv....pvCVSAHRK.LYGLIKA...EEPELRQSMDCTISS...........KIHSRGEVIGRKIVGDMIA-GGCD................NVIVACDLPW..TFKST......IDDLTIPNECKLSAftnI..SLPKFYsgrn...atgrvALELRFDAISWRAWFSRQWERARVVARIVDT-MNKEYRMLIINW...IPTPDGMG.ILYSFMSE..LsQYIMTLKGRRLQLGLVISGSPPIL.ETYDLKwLKRIVNRFYVSAPIQVQSTITA-LKCPTQLDPSITSCGLPDRNCPGH....AGYQHLTYTAAYLTRRIPTKQLSFTL....DLTGQawE---------------------------.------------..........--------------------------------.......--------------------......---------...........................--------...------------------...................--------.---..---------.------------------.---.-------.---....------..-----------.-------------...............---................-----..................................----.----.---.------............----------......---------.-----.--......................................---.---------------------------------------------...-----------------...---------...-----------......................---------------.---------------------...............................................---------------------------------------------------...........--------....------------------------------------------------------------.......------------------------------------------------------------...................-------....-----------------............--------------.........------------.----..-----------------------..------------.--------.------------.--........-----------..-----------------.---------.------.------------------------.......-------------------....---------------.-------...------------------------------.....------------rrylstgetwg......................................................
A4FTJ4_9VIRU/32-1371                   .....................................................................................................................l-LQTPSKVLPMCITQF.NFRGYF.tSDGVQIQTPALGQTVRVVAAVTELLVYNMAESVEDAMRDYCT----.....VATPVTKLTTDLHLTM..LYTGLH..TPLRLCYPR....VPMTS.-QLASKSYYC.PSVCSHRDTDEA-ITSRD..ACRLGQNS.---------LAGKAW..GLLMRG---DPMDPLVLSQLRQSPILG...PCLLKYFGQSAVSPNSTCLGAVGDFCYR........GM-.......CISKTAR.PRGFTNE...PVLTGVPHTYCSVDS...........ATQRQQKPAQFQTLASSLNASLCD................ACLYRSVPMT..LNASW......AEAVLVQQAVTSMR...P..ACPSVH............-LVLTAADADWFNLVNDTAVRAAVVQRAMDMVTANELQGLVF-E...FG-PGVSG.LGLDFYTQ..-.--FLIDVRVRLWTQNLN---GVLL.GVMTYNrVSTGFLRVATVAPFLDKFFDRSVDIKSFTTPSD---CDYNMRTKCTA....AHNTVRDFAENLLAQGVPPVKLVVGV....SLYGS..--MAPGSTACNSVLGGEGVQGRIPIDYI.TQGGYNLNTQPV..........CGV--IDPTTGYCTFSVQIGSDNCVWRTMREA.......HIRYRVSQLMTRYPSADLLV......LDVSVSRNG...........................YWIDVVKQ...TVTANLPSV-SKAAIVGG..................pYYYVGSGP.RVQ..CPGILNFVG.DTIITSVEYDKTVKIPLL.GGY.LALDGFT.CGT....GAAMTP..STC---AQVPT.FAVDMVTLQTV-S...............SAT................SRSVL..................................YDPV.NYCF.VVP.RSQQLC............QFTATEGS-K......VDVYQLGTD.FTDKP.VE......................................RDV.YWLGVSAYITIVDDWTTVIEAIPVDYKCVSFDVSSIPDCLQVVCG...GDIGCRK-RAASACSMD...VSTRVAIMG...LQQQFYAVNEV......................YQLMVRELTQYSVSDiDPFTGQSRAPSKFFGALLSLFgiglgaknaydiaqlqdamqtvkgmlntqsvmldvhdrllknlqaqlVSHDQQLVTVQSQFQGQQTQLNGLNQALNATNTYVNQLVQATAANAEMSNNlqtqinsqqaiIDLINSKI....GVNSRAISHNSDQIMKLGNGLANISIALDNNIKAVNGRVTMLEDEVNDRFSYVASQLTKLraqqasdVADLNYSIELHNAAMLYYQQLNNFAVTLAHNALKLTAMVESYRTCFRSLASGYLQGCPVN...................QPFLKSK....PFFANFRSVLGIVYRQD............LGVAAVLYKVPKSF.........RDFALYAISAKP.LRVN..GEWYVPRSDDVVMLGDGNFYSKP..QCDSNICEPPAL.HPSWTDCM.AAITVQSVSQIF.NF........CRLIKCAADHC..TDVITSPVTYTGVVNLP.DRSVGDFTFyNGVAPVgAVQPVPVPSVNIVPIQTSATLQDIapavaqvQSVVTDLSGSMTQFNAQIAklqaDVQSKLNDLYTTQLAfNLTYDQWqqlVTNLHRNEALYKQGIDQFNAGAQQFGTSLEqwkqqQGEWQGLRDEF-k................................................................
D2E8B8_ANHV1/10-1359                   ......................................................................................................................LSILGTVYGQLSPTN-.--PDCP..-IASPDLLPVYSQPASCNTSDDMILYDKSMTGRNVWISRRTQFGLG.....SNTPWSKISMKTYTCL.tNTSSVT..SPTPAVFST....IQWTYqYIYGTDRTQCkPGMTGQWLNFPAHGNNRDyfVCMKGVLT.-------TTSPPLFW..---DYGNSRGRGYVLPMVPDNNA----...YTVTFYVSTSTVNSNGDQWTVLSPASTT........GIPiqnffpgCFPKDIC.TR-YNGE...LIRTQVHITGLRTTD...........AVVFDCSYAYAATAPQHTVLSPMQftsytqkknmaidyslALMPQGIAYDwtASRRWsgqsahMYPIYAGKAAGNFM...I..TGKAYIghmiq..ymlyaQTAVCHPYTTVLGRYCPVSQPCCLTKGLEAWFVDNGMAGLVVAE...LALRDGNFaTSVDKDMA..D.LKAFVIKQRELLFDNVTAGHYHSV.SVNGTPfLSSDVINIESVGNLMDGLTKSRTPTEIMSQKYANITAWYGYITAAGYlrydENGAFMADSHLAESTSYTPYAVATLV....GVYGYlnRTQPSLVTSSHAYQLYKLARSVCPAEFT.RNGAWGAPCDLVqmgqciscerAPVEVAYQLQGYSESYRAGYMLKLPFGYISPTarggpppDLPAGYFGINMPKRPVGLCVfskstvLNVYGGVRC...........................LAIDNISQgsvAIPKDLVSVISADFTATG...................YMVISSIAlSCNdtCSSVTSYLAgGVSATLIPYNC-------.SGYcEPMRSFD.---....GTPISAgiSIKPIGLPENTqGGYSISVFGAANA...............GNNqsyspmf.gaflikgePGDTFpahrnrrs.................lttvidsapWAGV.DFVV.YSP.------............TYPVCAAPLP......STVTPPAPA.FKPAV.VK......................................HKN.VLYKAEPDMYLVDDLKVVKLTLNVSQQCTLNTTAKALDCVALACG...NDTICARFLAPYCVSTQ...PLVRQLLEEqskLSLRYEHYVST......................YQRLAESVSVTYTGT.DSTVASTTRTKRAIGVLAGIF...............................................ISTAISLVVSAIGFGLLGDAVVKLQTALDITNAKIDAL-------------...........ITAVQNDL....-------------------------NAINNRLDLISNQLASFSQSVVSQFQLINQNLQQL.......NQQTIKQAFAVQFVDSFTNMLIASIGSVRDTNTFFNGAASNLVACVKSLQEGNLGPACVD...................PEMLSDT....LGAVFPLAKTNPILAGR............LPLVSNFGFTPDGIevwlmlplgEPNLIYSEVPKP.IAGN..KEIATTSNRWLKVDPRNGQQTTAcvKCAHVYCFTNTSyDCDAGEIFsAAPSGGNMSGLQvPY........NQYIPLGTLYD..PDTKTTNLAYLQADHTT.NQLV--FTW.ATGAQLgNISVPFLPQPVLTTVAPVIQTNRP.......TEAPLNLTMLVQTIEKLDPlalsNLTAIMEDYNNQLAK.-------...IGKVTNPFASFGN-IFGFLSGLSNMGVLAI.....TAAVAVGVSLI-l................................................................
A0A6G0HEI2_LARCR/639-921               ...........................................................sflhyrgsrtkrsssssssssssfsgghhrvvklddivteipesqykdpasgskncldp----------------.------..----------------------------------------------.....----------------..------..---------....-----.----------.------------------..--------.---------------..---------------------------...----------------------------........---.......-------.-------...---------------...........------------------------................----------..-----......--------------...-..------............--------------------------------------------...--------.--------..-.------------------------.------.-----------------------------------------------....--------------------------....-----..----------------------------.------------..........--------------------------------.......--------------------......---------...........................--------...------------------...................QYNIGLSN.TIV..CPGLIAAHG.ALGVFKEPYKELYSTSYD.KIFiGNLYKLEsCTP....GEPNKK..AKVS--AEPPQ.VAININTLIPTTD...............SNH................YMVGI..................................LDT-.ERVVeYAP.PVNKVC...........vSYNTGKNTHS......MNVVSVDDGyAVDKPmVE......................................VEHgVIVKPTEVLYMVSNFTPGIDYINLNVSCVNYDVSALRPCLIAICG...GDNSCRKDYGRLCNSAH...EIVNDA---...-----------......................---------------.---------------------...............................................---------------------------------------------------...........--------....------------------------------------------------------------.......------------------------------------------------------------...................-------....-----------------............--------------.........------------.----..-----------------------..------------.--------.------------.--........-----------..-----------------.---------.------.------------------------.......-------------------....---------------.-------...------------------------------.....------------rragelmreglealavq................................................
A0A4V6ATJ7_COLLU/721-1021              ........................................................................................vvklgdivteipesqykdpasgskncldpq----------------.------..----------------------------------------------.....----------------..------..---------....-----.----------.------------------..--------.---------------..---------------------------...----------------------------........---.......-------.-------...---------------...........------------------------................----------..-----......--------------...-..------............--------------------------------------------...--------.--------..-.------------------------.------.-----------------------------------------------....--------------------------....-----..----------------------------.------------..........--------------------------------.......--------------------......---------...........................--------...------------------...................-YNIGLSN.TIV..CPGLIAAHG.ALGVFKEPYKELYSTSYD.KIFiGNLYKLEsCTP....GEPNKK..AKVS--AEPPQ.VAININTLIPTTD...............SNH................YMVGI..................................LDT-.ERVVeYAP.PVNKVC...........vSYNTGKNTHS......MNVVSVDDGyAVDKPmVE......................................VEHgVIVKPTEVLYMVSNFTPGIDYINLNVSCVNYDVSALRPCLIAICG...GDNSCRKDYGRLCNSAH...EIVNDA---...-----------......................---------------.---------------------...............................................---------------------------------------------------...........--------....------------------------------------------------------------.......------------------------------------------------------------...................-------....-----------------............--------------.........------------.----..-----------------------..------------.--------.------------.--........-----------..-----------------.---------.------.------------------------.......-------------------....---------------.-------...------------------------------.....------------rragelmreglealavqekkskmyqlpdgmpslelektaadgggrgarrkrflgtvmgaaalgla
A0A6G0HFZ9_LARCR/427-776               ............................................................................................................krflgtvmga----------------.------..----------------------------------------------.....----------------..------..---------....-----.----------.------------------..--------.---------------..---------------------------...----------------------------........---.......-------.-------...---------------...........------------------------................----------..-----......--------------...-..------............--------------------------------------------...--------.--------..-.------------------------.------.-----------------------------------------------....--------------------------....-----..----------------------------.------------..........--------------------------------.......--------------------......---------...........................--------...------------------...................--------.---..---------.------------------.---.-------.---....------..-----------.-------------...............---................-----..................................----.----.---.------............----------......---------.-----.--......................................---.---------------------------------------------...-----------------...---------...-----------......................---------------.---------------------...............................................---------------------------------------------AALGLAwhv.....srrVDALEEQM....DLHKNSYVSVSNRMVEVSNKLNTNIALINSRIDEEEEKMQKNNEIINSNFAMMRDAMMRNte...aaLRDTNVNFSVLTSYQMWYAQMQSITHQMMQAAMYTKFMARGVENCLRQIASKRSGSCPSG...................LAVMEEH....PGLTDFPTIGTALY--K............DRKIFIVHSVPGNV.........EKTVVRGVIPMPkMSTD..GVPCWPDYK--VWLIDGRYYQPS..DCYGKYCHKPEP.HERYRRCL.ANPSE-------.--........----------C..KTVCTP--CHRGICYR-.---DKKFTWmEGSVAV.DIESPPLEPFSRPHI---------.......-------------------....---------------.-------...------------------------------.....------------sdgpvsfsdllrgglsetpemkllqaintsvklihvqedldnitrslkefdkry...........
A0A4U5ULG7_COLLU/162-397               ........................................................................................vvklgdivteipesqykdpasgskncldpq----------------.------..----------------------------------------------.....----------------..------..---------....-----.----------.------------------..--------.---------------..---------------------------...----------------------------........---.......-------.-------...---------------...........------------------------................----------..-----......--------------...-..------............--------------------------------------------...--------.--------..-.------------------------.------.-----------------------------------------------....--------------------------....-----..----------------------------.------------..........--------------------------------.......--------------------......---------...........................--------...------------------...................-YNIGLSN.TIV..CPGLIAAHG.ALGVFKEPYKELYSTSYD.KIFiGNLYKLEsCTP....GEPNKK..AKVS--AEPPQ.VAININTLIPTTD...............SNH................YMVCV.................................sYNTG.KNTH.SMN.------............------VVSV......DDGYAVDKP.M--VE.VE......................................HG-.VIVKPTEVLYMVSNFTPGIDYINLNVSCVNYDVSALRPCLIAICG...GDNSCRKDYGRLCNSAH...EIVNDA---...-----------......................---------------.---------------------...............................................---------------------------------------------------...........--------....------------------------------------------------------------.......------------------------------------------------------------...................-------....-----------------............--------------.........------------.----..-----------------------..------------.--------.------------.--........-----------..-----------------.---------.------.------------------------.......-------------------....---------------.-------...------------------------------.....------------rragelmreglealavqe...............................................
A0A6G0HFE6_LARCR/620-885               ...........................................................................ssssssfsgghhrvvklddivteipesqykdpasgskncldpq----------------.------..----------------------------------------------.....----------------..------..---------....-----.----------.------------------..--------.---------------..---------------------------...----------------------------........---.......-------.-------...---------------...........------------------------................----------..-----......--------------...-..------............--------------------------------------------...--------.--------..-.------------------------.------.-----------------------------------------------....--------------------------....-----..----------------------------.------------..........--------------------------------.......--------------------......---------...........................--------...------------------...................-YNIGLSN.TIV..CPGLIAAHG.ALGVFKEPYKELYSTSYD.KIFiGNLYKLEsCTP....GEPNKK..AKVS--AEPPQ.VAININTLIPTTD...............SNH................YMVGI..................................LDT-.ERVVeYAP.PVNKVC...........vSYNTGKNTHS......MNVVSVDDGyAVDKPmVE......................................VEHgVIVKPTEVLYMVSNFTPGIDYINLNVSCVNYDVSALRPCLIAICG...GDNSCRKDYGRLCNSAH...EIVNDA---...-----------......................---------------.---------------------...............................................---------------------------------------------------...........--------....------------------------------------------------------------.......------------------------------------------------------------...................-------....-----------------............--------------.........------------.----..-----------------------..------------.--------.------------.--........-----------..-----------------.---------.------.------------------------.......-------------------....---------------.-------...------------------------------.....------------rragelmreglealavq................................................
A0A6G0HFE6_LARCR/916-1308              ..........................................................................................................rrkrflgtvmga----------------.------..----------------------------------------------.....----------------..------..---------....-----.----------.------------------..--------.---------------..---------------------------...----------------------------........---.......-------.-------...---------------...........------------------------................----------..-----......--------------...-..------............--------------------------------------------...--------.--------..-.------------------------.------.-----------------------------------------------....--------------------------....-----..----------------------------.------------..........--------------------------------.......--------------------......---------...........................--------...------------------...................--------.---..---------.------------------.---.-------.---....------..-----------.-------------...............---................-----..................................----.----.---.------............----------......---------.-----.--......................................---.---------------------------------------------...-----------------...---------...-----------......................---------------.---------------------...............................................---------------------------------------------AALGLAwhv.....srrVDALEEQM....DLHKNSYVSVSNRMVEVSNKLNTNIALINSRIDEEEEKMQKNNEIINSNFAMMRDAMMRNte...aaLRDTNVKFSVLTSYQMWYAQMQSITHQMMQAAMYTKFMARGVENCLRQIASKRSGSCPSG...................LAVMEEH....PGLTDFPTIGTALY--K............DRKIFIVHSVPGNV.........EKTVVRGVIPMPkMSTD..GVPCWPDYK--VWLIDGRYYQPS..DCYGKYCHKPEP.HERYRRCL.ANPNE-------.--........----------C..KTVCTP--CHRGICYR-.---DKKFTWmEGSVAV.DIESPPLEPFSRPHISDGPVSFSDllrgglsETPEMKLLQAINTSVKLIH....-VQEDLDNI-TRSLK.--EFDKR...YDEITARRSTFAGWLSGFASDAALWTSIAL.....LTGWC-------falsagi..........................................................
A0A2H5AJI8_9VIRU/587-1349              ttedivemidwlmgngivsfkvdqvtydtslqeqyhlktvvaitdavrlrmaafgivesqmvtggnvslnetaiweqadraihgdpesdvtttlspitsaptangssrarvrrsavsg----------------.------..----------------------------------------------.....----------------..------..---------....-----.----------.------------------..--------.---------------..---------------------------...----------------------------........---.......-------.-------...---------------...........------------------------................----------..-----......--------------...-..------............--------------------------------------------...--------.--------..-.------------------------.------.-----------------------------------------------....--------------------------....-----..----------------------------.------------..........--------------------------------.......--------------------......---------...........................--------...-----------------TeivhpptipftsnfsvgtvGVQVGSGP.RVV..CPGVIATIG.NIVFSRTPYKEFKRLSFFkSLYvTWLENMTsCTP....LTSGTP..DLIEAATNFPStFAVDINTFSPT-N...............SSD................YYVIG..................................YDTPgDLVQ.YTP.LVKQSC............AFINTNETFT......QNYVEIDDDfYYTEP.TP......................................VDD.GFIIPEGIKFFMSDLVMAVDYINFNITCMNYNSPTVQSCIAAVCA...ANASACTTEASTMCSQG...TP-------...ILQDFERSNEL......................LKASIRDFELEHE--.---------KMKMFAIAPGET...............................................-----DTTVATQKFGLSIAAITMSGVALAAASTALVV--------------...........ATLAASKI....DALQSQLDITSEVIEKLGNSVAIISARLDRNIQAVNGRIDDLQNQLNKQFAIIEKNMKHIsevveafAEATKKKMREIITYQQWYQQIISLTHQVTQGAIQVGYKVGMLRTCIKSLLAGTMAGCPSE...................LSVFTEH....PGLTYSKTVKAMLY--K............DKKLFIVNQVPRAL.........DPAPVHRFIPAP.SIVK..DKVCWPDYK--LSYVNGKVYAPV..ECTGKYCSPPVE.PKDYLECL.ATPTT-------.--........CKYV------C..GD------CYRGICYNR.TSDELVVPF.EEINYKlALTDLDGPLFNNIPQIMVLEDDL-.......DDVKIELEA-LTQLNTSAK....-------------LE.DITDD--...INHMKETIREYREEMERLRVTGFGEWLAYF.....--LYALLASLI-l................................................................
A0A6G0HEI2_LARCR/953-1344              ...........................................................................................................rkrflgtvmga----------------.------..----------------------------------------------.....----------------..------..---------....-----.----------.------------------..--------.---------------..---------------------------...----------------------------........---.......-------.-------...---------------...........------------------------................----------..-----......--------------...-..------............--------------------------------------------...--------.--------..-.------------------------.------.-----------------------------------------------....--------------------------....-----..----------------------------.------------..........--------------------------------.......--------------------......---------...........................--------...------------------...................--------.---..---------.------------------.---.-------.---....------..-----------.-------------...............---................-----..................................----.----.---.------............----------......---------.-----.--......................................---.---------------------------------------------...-----------------...---------...-----------......................---------------.---------------------...............................................---------------------------------------------AALGLAwhv.....srrVDALEEQM....DLHKNSYVSVSNRMVEVSNKLNTNIALINSRIDEEEEKMQKNNEIINSNFAMMRDAMMRNte...aaLRDTNVKFSVLTSYQMWYAQMQSITHQMMQAAMYTKFMARGVENCLRQIASKRSGSCPSG...................LAVMEEH....PGLTDFPTIGTALY--K............DRKIFIVHSVPGNV.........EKTVVRGVIPMPkMSTD..GVPCWPDYK--VWLIDGRYYQPS..DCYGKYCHKPEP.HERYRRCL.ANPNE-------.--........----------C..KTVCTP--CHRGICYR-.---DKKFTWmEGSVAV.DIESPPLEPFSRPHISDGPVSFSDllrgglsETPEMKLLQAINTSVKLIH....-VQEDLDNI-TRSLK.--EFDKR...YDEITARRSTFAGWLSGFASDAALWTSIAL.....LTGWC-------falsagi..........................................................
K7PC08_9VIRU/31-1378                   ......................................................................................................................LFKTGSKVYPGCVQNF.QFRGYFdqTTGLQIATPAMGQTVIAVAYITDLMVYNLAENMEDAMKDYCT----.....VATPSTKLTTDIYFKM..LYTGLA..APTKLCYPK....IPMTP.-QLASKSYVC.PSVCSHRDTNDA-ITSRD..ACRLGQNS.---------LAGRAW..-DLLMGN--KPMDSLILSQLVQSPILG...PCLLQYFGQSKLKPNSTCLSVIGDLCYR........GM-.......CISKTAR.PRGFNNE...VVRSGVPLTHCSVDT...........STQLTQKPAQFRTPISAINASMCD................ACVLRSMVMTspSNGTW......AEAATIAAQVTAMR...P..ACPSVY............-LGLTASDADWAAMVTDPLNKAHTIQKAVGLVGTANLQGLVF-E...FG-PGASD.SNADFFSQ..-.--FLIDVRFRLVAQSLD---SVLL.GVMTYNrITTSFLRTATVAPFVDKFFDRNADIRSFTTPGD---CDYNMRTRCTS....THNTVRDLSEYLLSQGVAPAKLAVGV....SLYASmaVTGAAGSSACNVVGGGESVQGRIPVDYI.TN-SYPLSSQPV..........CST--IDPTTALCSFSATVGSENCLWRTMTEA.......HVGYRVGQIMTKYPSSDLFV......SDVSVSRNG...........................YWLGVIKQ...AVTSNLPPENNKAALAGG..................pYYYVGNGP.RVT..CPGILNYVG.DYIVTSEQYENTVKLPLL.GGY.LALDGFT.CSP....GTAQGP..TTC---AQIPA.FAVDMISLQTVST...............ASN................TRSVL..................................YDPV.NYCF.VVP.GSQQLC............EFTAKDGS-S......VNVYQLGTA.FTDVP.VE......................................RDQ.YWLGLSRYVTIVDEWSTVIEAIPVDYKCVSFDVSSIPDCLQVVCG...GDQLCRQ-MAAGPCSMD...ITTRVAILG...LQQQFYAVNEV......................YQLMVKELNQYNAGTiNPFTSQPNAQSKFWGLLAGGTalilasknahdisvlqeamkqvqgllttqsnmldvhdrllknlqsqlVSHDQQLITVQSQIGGQQTQLNGLDQALNATNSYVNQLVQATAANADMSNNlqrqinsqqsiIDLINSKV....GVNSRAISHNADQIMKLGTVLANLSIALDNNIKAVNGRVTLLEDEVNDRFSYVASQLSKLrqqqaadVAALTYNINLQNAAMLYYQQLNSFAVMLAHNALKLTAMVEAYRTCFRSLASGYLQGCPVN...................QQFLKDK....PFFANFRSVQGIVYRPD............LGVAAVLYRIPKTY.........RDFASYAVSAKP.LKIN..GEWYVPRSDDVEMLGDGVFYSTL..QCDNNICLPPTV.HPTWADCM.AAITVQTVLQIQ.QY........CRLIKCAADHC..SDIVTSPIQYTGTVTLP.QRSVGDFTFyNGVEPVsNVPQVVVPPISIVPIKTGATLTDItpavaqvQSIVTDLGKSMGQFNNQLSklqaDIQSKLNELYSNQNNfNLTYEQWlvlVNNIQRNQVQYQQGITLFNKGAQEFNVSLEewrqqQYEWTVLKTDF-k................................................................
A0A4U5ULG7_COLLU/417-635               .................................................................................................taadgggrgarckrflgtvmg----------------.------..----------------------------------------------.....----------------..------..---------....-----.----------.------------------..--------.---------------..---------------------------...----------------------------........---.......-------.-------...---------------...........------------------------................----------..-----......--------------...-..------............--------------------------------------------...--------.--------..-.------------------------.------.-----------------------------------------------....--------------------------....-----..----------------------------.------------..........--------------------------------.......--------------------......---------...........................--------...------------------...................--------.---..---------.------------------.---.-------.---....------..-----------.-------------...............---................-----..................................----.----.---.------............----------......---------.-----.--......................................---.---------------------------------------------...-----------------...---------...-----------......................---------------.---------------------...............................................--------------------------------------------AAALGLAwhv.....srrVDALEEQM....DLHKNSYVSVSNRMVEVSNKLNTNIALINSRIDEEEEKMQKNNEIINSNFAMMRDAMMRNte...aaLRDTNVKFSVLTSYQMWYAQMQSITHQMMQAAMYTKFMARGVENCLRQIASKRSGSCPSG...................LAVMEEH....PGLTDFPTIGTALY--K............DRKIFIVHSVPGNV.........EKTVVRGVIPMP.----..-----------------------..------------.--------.------------.--........-----------..-----------------.---------.------.------------------------.......-------------------....---------------.-------...------------------------------.....------------kmsrt............................................................
A0A444V833_ACIRT/402-695               ...................................................................................ydqlsatrprdkntffrgwkkktvgeesdsvyyvq----------------.------..----------------------------------------------.....----------------..------..---------....-----.----------.------------------..--------.---------------..---------------------------...----------------------------........---.......-------.-------...---------------...........------------------------................----------..-----......--------------...-..------............--------------------------------------------...--------.--------..-.------------------------.------.-----------------------------------------------....--------------------------....-----..----------------------------.------------..........--------------------------------.......--------------------......---------...........................--------...------------------...................-VQVKGVRgTRY..CPSIVYYAD.GCAITNAPTDGSKKIPIF.NLYtTPMLNFT.CQP...pGSAQPAilPFT-NRSDQDS.VLLALETLTYE-N...............STT................KPVLI..................................MDGA.GKAWyYFP.NTVVPC............TTSVSAPSRTfnlaisQGLIATETP.---SF.LD......................................NGD.LLL-NRGVRYVATHFEWSAEVLPINMSCLLVDVDALPSCQAFVCG...GGK-CPRNFDRVCASAD...TLVEK-VRR...SQAQLKTLLDR......................YQDLKALAKQYEP--.-PRQETERRTRRFIMGLAAII...............................................---------------------------------------------------...........--------....------------------------------------------------------------.......------------------------------------------------------------...................-------....-----------------............--------------.........------------.----..-----------------------..------------.--------.------------.--........-----------..-----------------.---------.------.------------------------.......-------------------....---------------.-------...------------------------------.....------------ltkqqe...........................................................
A0A6G0HFZ9_LARCR/139-391               .....................................................................................hhrvvklddivteipesqykdpasgskncldpq----------------.------..----------------------------------------------.....----------------..------..---------....-----.----------.------------------..--------.---------------..---------------------------...----------------------------........---.......-------.-------...---------------...........------------------------................----------..-----......--------------...-..------............--------------------------------------------...--------.--------..-.------------------------.------.-----------------------------------------------....--------------------------....-----..----------------------------.------------..........--------------------------------.......--------------------......---------...........................--------...------------------...................-YNIGLSN.TIV..CPGLIAAHG.ALGVFKEPYKELYSTSYD.KIFiGNLYKLEsCTP....GEPNKK..AKVS--AEPPQ.VAININTLIPTTD...............SNH................YMVGI..................................LDT-.ERVVeYAP.PVNKVC...........vSYNTGKNTHS......MNVVSVDDGyAVDKPmVE......................................VEHgVIVKPTEVLYMVSNFTPGIDYINLNVSCVNYDVSALRPCLIAICG...GDNSCRKDYGRLCNSAH...EIVNDA---...-----------......................---------------.---------------------...............................................---------------------------------------------------...........--------....------------------------------------------------------------.......------------------------------------------------------------...................-------....-----------------............--------------.........------------.----..-----------------------..------------.--------.------------.--........-----------..-----------------.---------.------.------------------------.......-------------------....---------------.-------...------------------------------.....------------rragelmregleal...................................................
A0A6G0HF40_LARCR/959-1350              ...........................................................................................................rkrflgtvmga----------------.------..----------------------------------------------.....----------------..------..---------....-----.----------.------------------..--------.---------------..---------------------------...----------------------------........---.......-------.-------...---------------...........------------------------................----------..-----......--------------...-..------............--------------------------------------------...--------.--------..-.------------------------.------.-----------------------------------------------....--------------------------....-----..----------------------------.------------..........--------------------------------.......--------------------......---------...........................--------...------------------...................--------.---..---------.------------------.---.-------.---....------..-----------.-------------...............---................-----..................................----.----.---.------............----------......---------.-----.--......................................---.---------------------------------------------...-----------------...---------...-----------......................---------------.---------------------...............................................---------------------------------------------AALGLAwhv.....srrVDALEEQM....DLHKNSYVSVSNRMVEVSNKLNTNIALINSRIDEEEEKMQKNNEIINSNFAMMRDAMMRNte...aaLRDTNVKFSVLTSYQMWYAQMQSITHQMMQAAMYTKFMARGVENCLRQIASKRSGSCPSG...................LAVMEEH....PGLTDFPTIGTALY--K............DRKIFIVHSVPGNV.........EKTVVRGVIPMPkMSTD..GVPCWPDYK--VWLIDGRYYQPS..DCYGKYCHKPEP.HERYRRCL.ANPNE-------.--........----------C..KTVCTP--CHRGICYR-.---DKKFTWmEGSVAV.DIESPPLEPFSRPHISDGPVSFSDllrgglsETPEMKLLQAINTSVKLIH....-VQEDLDNI-TRSLK.--EFDKR...YDEITARRSTFAGWLSGFASDAALWTSIAL.....LTGWC-------falsagi..........................................................
K7PBM0_9VIRU/27-1368                   ......................................................................................................................LMSLKTKVYPGCTTSF.TFKGYF.dRTGKAITSPVMGSEVRAVVTVSGLVIFNLADSIQDAINDRCSL---.....NLIPPMSLTTDMYVDM..LYTGLA..EPKKICYPF....IPVTE.-SMTAKAVAC.ASVCRHRDTTDA-ITSRD..ACRLGPNS.---------LAGKTW..GAMMMG---LNLDSLVLPQLLQSPVLG...PCLLQYMGKANLKSNSTCVRTIGDFCYR........GM-.......CVSNIAR.ARGFTNE...DAQSGYPHIHCAVDS...........SALQNTKGASYRSKLNNVTAGSCD................VCVLRTVVMSspYNGSW......-VSEDDKKILALMM...T..NCPTSY............-ISFSASSTTWSDIVTVGENKANVIKNAVELMTTYNMNGIIF-E...YTFPQSQD.SLSEAHTQ..-.--FIIETKTTLVTQNIK---DPYL.GVMTVNmIDINFLNIPLASLFVDKFYDESMELRSFTTPGN---CDYNMQTKCSS....SHRTVRDYAEFMTSHGVPLEKLSLSV....SLYGS..-VDPVSNPTCNITDGG--APGRIPIDYF.NASNYNLEDQPV..........CGSGNVDATSGYCGFTDVVGGKNCTWRTMRES.......HIEYRVSQLMNKYPSSDFFV......MDVSVSRDG...........................YWINKVKQ...AVSSNL--AVSKSALSGG..................pYYYVGNGP.RVS..CAGIINYAG.NYVVLDRAYDKTVKIPMV.SGF.LALPGFT.CTD....GSVSQA..NTC---TQTPS.IAVDVATLQTVSP...............SAR................RDVVL..................................WDPA.NLCF.VVP.TVQQLC............SFTAQEGA-N......VDLYQLGTT.FTDKP.VE......................................RDQ.YWLGISRYVTIADSWTTVIEVMPVNYKCVNFDVTTIPDCLQVLCE...GDVICRR-DAATVCSMD...VASRVAVLG...LQQQFYAVHQT......................YQLMTRELLQYNSGTiDPFTNK--ANSKFFGLFVSAAalalgiknsvdiaalqdamrsvaglledqmkmlnvhdemlkvlqkqlVSHDQQLVTVQNQFSGQQNQLDGLNIALNATNNYINQLVDATATNAQLSNAlqdqlnsqqkvIELINDRV....GVNSQAISHNSDRIIKLGNSIANISVALDSNIKAVNGRVTLMEDEINSRFGYVADQLNEIreqqvadIANVNYKINLQAAAMLYYQQLNNLATTLAHNALKLTGMVEAYRTCFKSLYGGTLEGCPVN...................QKFLADK....PYFAGYRSVQGIVYRQD............LGVVAVMYKVPAAY.........RDFAYYTVSAKP.LTIN..GEWFVPRSDDVVMLGDGRFYTEP..QCSANICQPPVA.HPTWDDCV.AAIIVQQVVQIK.KY........CRLVKCSSDGC..TDIITAPIQISGTVTLP.ERSVGDFSFyNGVQAVgQVTPVPVPKVNIAPIRSSAGLDEItpavvqvQGVVADLSTSMNQFNAQVAglqaDVQQKLNDFYKSQLSyNLTYEQWvnlVTQIQKNGEEYRRGMVLFTNGSQTFATSLAqwkeqQSEWEGLRDNV-y................................................................
Q14VR2_RAHV1/6-1142                    .....................................................................................................................t-ALMVALTYAHAAAAA.FYDECF..VLEQGVYTEDGTKRVALGAMVQDTRYAIPMVSKEEGHNSV-KQQAG.....SNLCTHVCPDGTMATF..LYIG--..--QRLVCGL....SVDVA.-----GCASC.SHYCAQHRTKDGMLTSKD..VCYSSVSS.-----NTITALSLFW..TQYQSGTLDDRGKAVLQPSAGLSPGAI...ACLQSYVGLSMPPNTGDCVMNMGNLCLG........DY-.......CISRDAH.GRGYTDR...RIDEELMGT--VRDV...........IPIVSCRLAINHRL--SAQLSICD................ECVIEYLDLG..KQ-RV......SYPFIAS-------...P..YCKRYI............-AALTPA-------------------S-MESGTAAEVATLAVRY...LLTNNESV.TGLEFPTG..-.--IKHTQRLSDVLKYVHHDMALQP.GVWSVD.VRVSLLSAEQVRQYVTELETEP----------K---TSYNGARYVWI....DAPNSPSLT---VNHMTAPQEAAVAV....AMYRR..---------------------SLTYGII.------------..........------------VPAA------ANTEEYRVLR.......TLHQG-FRLPLGVAPALQTR......RNITGSHHG...........................MLNVTGSG...--------RVSY------...................HYYVGDGP.MIN..CQYVQLYAGpAQFYTNYPYNNTIEVPYI.NMF.RVRNGFT.CAR....GSPAAP..RRC--AGDAPS.QALSVISQQT--E...............STL................NGGVY..................................YDTT.NDCY.WGP.TGPRLC............TFASVSRVAR......QELYLTNGA.VTNEL.QD......................................MGT.HYLATMGFYKIITGFTDVVELLSVDQACGTVSLNDIPSCLEMVCG...DDETCKGAQQSDVCSMD...RVVRESIQG...LINEFEYSKAR......................YRSTVSVVELWRL--.----TSDMRPRRFIAEAMAGA...............................................-----AIVMSAAAFATAYVALNRADRALQVGQEAKEMGLRNLQATAKLGVD...........VSTMRSAM....GDLNARVGGLSDTVFQMGNTLVKLGATMQNNIDAVNGRISALEASVNQRLLQVAAYVNTL.......AEQTNNAIARQARAAIYYQQLNALSNQIITSNSKLMGQITMFSTCLNSIHAGRLFGCPIT...................NRFLQDN....PDYNMVTSVYGAAY--D............GAFLSIMFKIPDYA.........EPLALYSILVKP.ILMN..DRPHVVDTTNVVVGPDNTFYLKP..SCEGRYCAGLDL.HPTFGRCF.SRLQSNDSAGVA.EA........CILLPCQQKDC..GDRLRIT-SAVGEKYLK.GEPHGSYSF.QSSNFFgGNQSASAPQLTLVDYISSANSTEA.......EGVLTAFHKDLLDWKMRDT....NASEAVVEL----LT.RVGGYEG...IESLLQEAMTFYHGSGAYSIGGTSITTILL.....ITLCCLIVAGI-v................................................................
A0A6G0HEG0_LARCR/2-384                 ............................................................................................................gaaalglawh----------------.------..----------------------------------------------.....----------------..------..---------....-----.----------.------------------..--------.---------------..---------------------------...----------------------------........---.......-------.-------...---------------...........------------------------................----------..-----......--------------...-..------............--------------------------------------------...--------.--------..-.------------------------.------.-----------------------------------------------....--------------------------....-----..----------------------------.------------..........--------------------------------.......--------------------......---------...........................--------...------------------...................--------.---..---------.------------------.---.-------.---....------..-----------.-------------...............---................-----..................................----.----.---.------............----------......---------.-----.--......................................---.---------------------------------------------...-----------------...---------...-----------......................---------------.---------------------...............................................-----------------------------------------------VSRR...........VDALEEQM....DLHKNSYVSVSNRMVEVSNKLNTNIALINSRIDEEEEKMQKNNEIINSNFAMMRDAMMRNte...aaLRDTNVKFSVLTSYQMWYAQMQSITHQMMQAAMYTKFMARGVENCLRQIASKRSGSCPSG...................LAVMEEH....PGLTDFPTIGTALY--K............DRKIFIVHSVPGNV.........EKTVVRGVIPMPkMSTD..GVPCWPDYK--VWLIDGRYYQPS..DCYGKYCHKPEP.HERYRRCL.ANPNE-------.--........----------C..KTVCTP--CHRGICYR-.---DKKFTWmEGSVAV.DIESPPLEPFSRPHISDGPVSFSDllrgglsETPEMKLLQAINTSVKLIH....-VQEDLDNI-TRSLK.--EFDKR...YDEITARRSTFAGWLSGFASDAALWTSIAL.....LTGWC-------falsagi..........................................................
A0A0E3J9I3_9NIDO/594-1199              .....................................qlgtvfitlydsnaxctlqqttysrsavlrqvntftpnatdlvvpygktpiyngayninstasgavsxstnthyiprllts----------------.------..----------------------------------------------.....----------------..------..---------....-----.----------.------------------..--------.---------------..---------------------------...----------------------------........---.......-------.-------...---------------...........------------------------................----------..-----......--------------...-..------............--------------------------------------------...--------.--------..-.------------------------.------.-----------------------------------------------....--------------------------....-----..----------------------------.------------..........--------------------------------.......--------------------......---------...........................--------...------------------...................--------.---..---------.------------------.---.-------.---....------..-----------.-------------...............---................-----..................................----.----.---.------............----------......---------.-----.-Vltpqsdykitp...............tttnlepfveinGTT.FYYDANQAYVNTSDVYQANVDFGLPQTFSLDTS--FLNCTAFLCA...SDYKCIADFSPICSATQ...PL----IDA...LLQTYTLYNQQ......................LTLYNSSLLTIQAAA.NYLYDTRTRTRRSLLSTVN--...............................................--------------LGYGDVFQQPAWVYEIGATAAIPMIGPAVSVGLLASR...........VASIESTLyqitQGVKESIMAMNTKLDKIANILHSDIERLGLTVNTLASSFNTFTKQVTDKFASVDVAFNDL.......STSLNTLTTTTTVGASYAAQINFATTTLTNLEVQISQTTDHALSCIAALNEHVLSPHCIS...................VSQLSAYtpnaLSNIGEKLVLTHYI---............NGSLITFYHLIASK.........---GVYRPLPK-.-MYN..STHHLVATT----GFYNGHCI--..FCGEHYCDISVSvPCDYAY--.EPLK--------.--........-----------..STVLAAYPLTTGVALLTlDSTATNFII.-NYNNA.PLISSSVPQPPIINNTDGTVITL-.......QQQIIQLQTQFDHFNISSNfhvsEIQPIIDYY------.NAQ----...INSSLNQIVDFGNGSTS-------------.....------------nvgtiilivlvvalalaaaiai...........................................
A0A6G0HFM4_LARCR/661-926               ...........................................................................ssssssfsgghhrvvklddivteipesqykdpasgskncldpq----------------.------..----------------------------------------------.....----------------..------..---------....-----.----------.------------------..--------.---------------..---------------------------...----------------------------........---.......-------.-------...---------------...........------------------------................----------..-----......--------------...-..------............--------------------------------------------...--------.--------..-.------------------------.------.-----------------------------------------------....--------------------------....-----..----------------------------.------------..........--------------------------------.......--------------------......---------...........................--------...------------------...................-YNIGLSN.TIV..CPGLIAAHG.ALGVFKEPYKELYSTSYD.KIFiGNLYKLEsCTP....GEPNKK..AKVS--AEPPQ.VAININTLIPTTD...............SNH................YMVGI..................................LDT-.ERVVeYAP.PVNKVC...........vSYNTGENTHS......MNVVSVDDGyAVDKPmVE......................................VEHgVIVKPTEVLYMVSNFTPGIDYINLNVSCVNYDVSALRPCLIAICG...GDNSCRKDYGRLCNSAH...EIVNDA---...-----------......................---------------.---------------------...............................................---------------------------------------------------...........--------....------------------------------------------------------------.......------------------------------------------------------------...................-------....-----------------............--------------.........------------.----..-----------------------..------------.--------.------------.--........-----------..-----------------.---------.------.------------------------.......-------------------....---------------.-------...------------------------------.....------------rragelmreglealavq................................................
VG46_ICHVA/15-1320                     ......................................................................................................................YAVAGETVADDEV---.FFLSAP..QLDGTLIDSWGTDAVITGSTLMNRLWKTFTVSATHTLREYGRVAKSvnstaATKCTHLCVPGTVLKL..SVQATR..SNANNNASWrfarPVITNmHELNETCIPM.EYDCEEVISEKTSLNTLS..ITIYGSND.LKKALGENSTCNKTWtqGCAIATALTALYENKSVDARKLNILRGtsyTCLLGYLGIGELEPNSPCWTQLGPMCYG........PLAe....qvCVTAGRN.PFGVVPR...ADRPVSTGVDCRVGS...........RADLQ---FSGLTKGLFAE-RGCD................RVFVRCDLID..---PY......DPPATAAEF--ELH...V..ECRSSFrvsgfpgegedmGLELAFNNFGLEGLIRTKQDRLTIITGIFDI-RNNKYNALVINW...IPTPELLD.TFHMFMAE..L.DTFRKIHRPTVRLGVVITGASPFV.EQYNFK.LLSGVVDMVYIHPQIQPMTSTPTLTCPMPIRSDSLECGEPHRQCPGF....DGYRHLTYATRFLLGHISPEKLTLGLdvscQLWGR.rVRQYDTNWYFQDNLFSEVQGGWVSRGYI.TDVIQPNMTQAIqlngchgvfgPELDILLPSADATPYVGLLWSQPSDLEDAVDF.......SMALGITRFSIEGALGDVYMdssenlKTVSTVHEAvtvrmrahammeemlgegglaafdesmIWANVTRS...TGTATTGARKRRALTTQGpdgvnrtipfsasvqsgtsIVRIGTGP.KMV..CPGIIASVR.GLLFSRTSYQGFYRLTFFqNLYvTQLQNLTgCTA....VKPEDL..PVITQATKVPSvFAIDINTFGVV-N...............GSE................YYVVG..................................LEGT.DLVQ.YSP.QVKQSC............AFINTNETFN......QTFITIDERfFFTGP.RP......................................VAD.GFVIPAGINFFGSDNIMTVDYIDFNVTCMNYSNPSVQSCIATVCA...ANVTECTPRATLLCNQT...AA-------...ILLDFQRSNEL......................LKNSLVDLDLEHE--.---------KVKMFAPASGGS...............................................-------VPTSDKFGLSVAAITMSSAALVASTAALAV--------------...........ATLAASKI....DGLQAQLDKTADVITELGDSIALISAKLDRNIRAVNGRVDDLQNQINLQMLAMDTNFKRLatglkelGTTTNERLGEVMAYQQWYQQIMSLTNQVTQGAIQIGYKVGMIRTCVKSLLAGTMAGCPTD...................ASSFRDH....PGLTFRKTVRALLY--R............DQKLFIVNEVPQTL.........TARSVQVFIPSP.TITE..KKVCWPDYK--LMHVDGKVVAPL..ECTGKYCSEPIE.ATDYQECL.TNPST-------.--........CRYV------C..GD------CYRGICYNR.TTEDISIKF.ENVTHAlSVSDLTSPLFNSIPQIVSMEMEI-.......QDLKLELIQ-LQKINTSVH....-------------ME.NITGD--...IDAMKATIEEYRAEMAKLRVTGFGEWLKYF.....IYAILGVIAIG-a................................................................
A0A4U5ULI2_COLLU/607-907               ........................................................................................vvklgdivteipesqykdpasgskncldpq----------------.------..----------------------------------------------.....----------------..------..---------....-----.----------.------------------..--------.---------------..---------------------------...----------------------------........---.......-------.-------...---------------...........------------------------................----------..-----......--------------...-..------............--------------------------------------------...--------.--------..-.------------------------.------.-----------------------------------------------....--------------------------....-----..----------------------------.------------..........--------------------------------.......--------------------......---------...........................--------...------------------...................-YNIGLSN.TIV..CPGLIAAHG.ALGVFKEPYKELYSTSYD.KIFiGNLYKLEsCTP....GEPNKK..AKVS--AEPPQ.VAININTLIPTTD...............SNH................YMVGI..................................LDT-.ERVVeYAP.PVNKVC...........vSYNTGKNTHS......MNVVSVDDGyAVDKPmVE......................................VEHgVIVKPTEVLYMVSNFTPGIDYINLNVSCVNYDVSALRPCLIAICG...GDNSCRKDYGRLCNSAH...EIVNDA---...-----------......................---------------.---------------------...............................................---------------------------------------------------...........--------....------------------------------------------------------------.......------------------------------------------------------------...................-------....-----------------............--------------.........------------.----..-----------------------..------------.--------.------------.--........-----------..-----------------.---------.------.------------------------.......-------------------....---------------.-------...------------------------------.....------------rragelmreglealavqekkskmyqlpdgmpslelektaadgggrgarrkrflgtvmgaaalgla
A0A1X9T5E6_9VIRU/409-1167              ................................................................................................................detcir----------------.------..----------------------------------------------.....----------------..------..---------....-----.----------.------------------..--------.---------------..---------------------------...----------------------------........---.......-------.-------...---------------...........------------------------................----------..-----......--------------...-..------............--------------------------------------------...--------.--------..-.------------------------.------.-----------------------------------------------....--------------------------....-----..----------------------------.------------..........-----------------------AQWSLVQHA.......DVAISSFS-PSVMLSTLALT......SNIIKENDY...........................VSAVSTVQ...------SQRTNF------...................YYYIGGGI.MTY..CPSIVKYVS.GAVISYQPLSQTTSIPFT.STYiTTNQSFT.CSQ....GSPTPA..VTC---SSAVT.QGISLTTLLT--S...............SAQ................PNDVI..................................FNVP.NKCFiYVNsTSAQLC............NFKAAGTSLS......SQYFMINNR.IISAL.DD......................................RGP.YKVGLYGFYKIVDGYDYTVEMFPIDVMCNTPSLMTVPDCMTAVCG...ADATCRSNNANNVCVMD...ASMRDSVLS...VLARFTEAQAL......................YTKITSIKANWQQ--.----NNNVRNRRFVEWIALGVaaaglaraeqaya.....................laeraeatsaialAAAETAVHVSMDALNASKSAVLLANMSLNIAGDAYALANRTSVALTQLTNK...........VDVLANTI....NILDGRLNSLESAVTVLGDQLYIVSSSLQKNIDKTNSRISDLQESVNARFSAITTFINTV.......TSGTATGLSYLQSAFMYYQQLMIFNNQLHSATEKLIMQSQMYATCLQSIFNRRLYGCPLD...................NDFLSRY....PDYLLTRSVEGAVF--K............DGVMSVMYRVPSSV.........TPMALYVVIVKG.FVVG..QNLYTIDASDTVLGADNNYYKRP..SCDENYCAPLVK.DINFATCI.QYLTAADFSSIQ.KY........CNIRACSMMDC..SDVNKIT-MYNGTFSMP.TTPYYTFTF.TDTSKI.--THPLIQQFVYQNISSSTNLGNI.......SDSLQMLTNSQTNMLAYIN....ANNQSLSSY----IN.NFSTEEI...YATLNDSLSHYLPDSINQSISAGQQLAHET.....IDQINVAMAT--an...............................................................
Q14W34_9VIRU/16-1167                   .....................................................................................................................a-ALLAEELQPLTDDTM.THTQCR..VIASALPSPDATSAISSKSFKLNTVYYIPMDGMATQQNGV-EYKEN.....PELYKGFCMDGTLMSF..TYRG--..--SELVCEF....AIYQKpGGKSPNCFTC.QHYKQHHGTPEAMLSSTD..ACYSPNRT.----DAYHTSLRAFW..ADFYTGQLTRPSELFMYSAD-MEPNVA...SCLQSYVGISIPDSTGYCVRTLGHACYK........TF-.......CISSQEI.AGGFTNR...PAQTQGDTN------...........-MKLQCRINDGVSEIDYGKLQLCD................VCVLEHLTIN..ADGKI......VVPLLYSNA--KLH...Q..MCNEVV............-LALHSN-------------------TPMTLESATTLLTWVA--...LNAGTGQL.HGLEVP--..-.----WVHKSAVMIDALDKAFTVYR.-FISVS.VRYDLDRM-KVDSFVTELTNRD----------D---IARRKIKYVTL....VQGKAQTFD-------REGRQALAAL....LMYRK..---------------------PLSVYYV.------------..........------------VPFTSITSLESDLERIVEVR.......TVHLGAYGILTAAEPNHIYM......ASLRSAVMG...........................RDSVQKSG...AIDTNLLRAVKY------...................YYYITTVRdKIY..CPYISSYYN.DIMLLRFPYENTERVPSM.DVY.WARENFV.CAV....GSEVIPwaQRCNFGSSIPA.TGISLLTLVE--D...............LYK................PGVPY..................................LFKS.NNCT.LAEvTNGASC............TFSEKPRTIH......SQLYLANGR.VSGAV.TD......................................FGT.YHVGVYMTAKIINEMTDVVEIIPLQQTCTFLNISLLPTCAAAVCKppvGQQADANCNSEVVCSLD...TNVRTSMAL...LFDEFEYAKRR......................YKETIAVAEAWQS--.---SKEPARHRRFAGMIMAGV...............................................-----AIGLSTIALGIAGGAFYYAKQADQKATQALDVAMRTRDVLLQVAEQ...........TKDMKLAM....EGTNKRVDLVESSVRKIGDTIFKLTNTMQAKLAETHSRISDLTDHVDNNFVLVRDAINTV.......ATKLSSEMEAAQKAALYYQQMQSFTNIVVQSISRLNSQTQMYSTCLQNIDDGKLYGCPLS...................DPFINMN....ADYRMVSSVYGAIY--D............GEALHVVYKVPDSV.........ELMTLYTVLVKP.FMVN..GILQVVDSSNVVMGPDGGFYEKP..FCEGRYCMPLTQ.NTNFSKCL.SMVQSGDTAQIA.RF........CTMLPCNKIDC..SDRMNIK-TIRGTLSVP.GTPLKGFEV.LSFDYV.---DYRMPNLTLNKTPTFKINGTY.......DEIIKDLLDEMNKTIEGNA....ANSSILSAYVKAELD.KIKPDEW...IKQLNDPAFNYAG-------SGTSATVVTA.....LVVMSVLLGVI-v................................................................
A0A1X9T5E6_9VIRU/6-415                 .......................................................................................................lilvtslvlftsvmg---------------A.TMFNCF..SVEQMFSSSALTTLV--KSPVKGTTYFTKIGGLRGGVTSY-QNTLG.....SDTCDGVCPDDTVMSF..RYDG--..--SSLTCSL....TPVSI.----SACTAC.THYCTHVLSKTGDLTSKD..MCYGPLLT.PPTAVSVVSALQGFW..TAFALGTMSSAIQVGVSSSA-LSLETR...NCLASYVGLKTPPSVGYCYAAIGSMCFG........VY-.......CINNDGV.NMGLTNN...P--PNLPTY--PKDV...........KSKLRCRISQALSD--YSVLKACD................ECVVESLAPS..GS-SW......VIPGFVAGV--NLR...E..VCNLVT............-YSVAAN--------------------TYDVTTISSLATWLF--...---NQPRN.TFLELVDK..-.----NDGKSLHAAQVITANAQLVA.GVYGID.VKFLFTSESDVKTAEAILLKEE----------------YSPVRYLII....DGKSTLDQS---TYSGLANKVSGVRG....AFRGS..----------------------------.------------..........--------------------------------.......--------------------......---------...........................--------...------------------...................--------.---..---------.------------------.---.-------.---....------..-----------.-------------...............---................-----..................................----.----.---.------............----------......---------.-----.--......................................---.---------------------------------------------...-----------------...---------...-----------......................---------------.---------------------...............................................---------------------------------------------------...........--------....------------------------------------------------------------.......------------------------------------------------------------...................-------....-----------------............--------------.........------------.----..-----------------------..------------.--------.------------.--........-----------..-----------------.---------.------.------------------------.......-------------------....---------------.-------...------------------------------.....------------hlcvdetcira......................................................
A0A4V6ATJ7_COLLU/1006-1396             ............................................................................................................krflgtvmga----------------.------..----------------------------------------------.....----------------..------..---------....-----.----------.------------------..--------.---------------..---------------------------...----------------------------........---.......-------.-------...---------------...........------------------------................----------..-----......--------------...-..------............--------------------------------------------...--------.--------..-.------------------------.------.-----------------------------------------------....--------------------------....-----..----------------------------.------------..........--------------------------------.......--------------------......---------...........................--------...------------------...................--------.---..---------.------------------.---.-------.---....------..-----------.-------------...............---................-----..................................----.----.---.------............----------......---------.-----.--......................................---.---------------------------------------------...-----------------...---------...-----------......................---------------.---------------------...............................................---------------------------------------------AALGLAwhv.....srrVDALEEQM....DLHKNSYVSVSNRMVEVSNKLNTNIALINSRIDEEEEKMQKNNEIINSNFAMMRDAMMRNte...aaLRDTNVKFSVLTSYQMWYAQMQSITHQMMQAAMYTKFMARGVENCLRQIASKRSGSCPSG...................LAVMEEH....PGLTDFPTIGTALY--K............DRKIFIVHSVPGNV.........EKTVVRGVIPMPkMSTD..GVPCWPDYK--VWLIDGRYYQPS..DCYGKYCHKPEP.HERYRRCL.ANPSE-------.--........----------C..KTVCTP--CHRGICYR-.---DKKFTWmEGSVAV.DIESPPLEPFSRPHISDGPVSFSDllkgglsETPEMKLLQAINTSVKLIH....-VQEDLDNI-TRSLK.--EFDKR...YDEITARRSTFAGWLSGFASDAALWTSIAL.....LTGWC-------falsagi..........................................................
A0A444V833_ACIRT/694-975               .....................................................................................................qerriddfeerytmvlq----------------.------..----------------------------------------------.....----------------..------..---------....-----.----------.------------------..--------.---------------..---------------------------...----------------------------........---.......-------.-------...---------------...........------------------------................----------..-----......--------------...-..------............--------------------------------------------...--------.--------..-.------------------------.------.-----------------------------------------------....--------------------------....-----..----------------------------.------------..........--------------------------------.......--------------------......---------...........................--------...------------------...................--------.---..---------.------------------.---.-------.---....------..-----------.-------------...............---................-----..................................----.----.---.------............----------......---------.-----.--......................................---.---------------------------------------------...-----------------...---------...-----------......................---------------.---------------------...............................................---------------------------------------------------...........--------....----------TDAIRSLTQSTISITSTLRTNIEAVNGRVGALEKEVNERFRAVSETLNQL.......NDNSAINFNVLNGFQMWFMQIQYLESILTEARFSLSMALDSLKSCLLSLQEGHLQNCKIT...................TGVLQEH....PGFRALPLLGAAQYHKD............--TVVLLFKQPTAY.........KTIVLQAVTPAP.VLVDslGLYIWPDYKDV-VWMDGEYYKAP..MCKGAYCMPLQE.HVEYKQCL.ENRT--------.-F........CRYA---LGNC.yGDVCYDN--KTGRTVYT.TKTVQTYGQ.HPVDSV.------------------------.......-------------------....---------------.-------...------------------------------.....------------lhlplfepyrieaek..................................................
SPIKE_WBV24/13-1197                    ....................................................................................................................vt--AQLSQTNPDC----.PIPTCT..ILPPPKTTLDNTKFRVVYTKDQEALIYATNFTSPFNNAQYPLPTLG.....NHLNRSYTLNYDKVFL..NIADSP..DMLNLKTSW....TVVNN.---SNLCPLS.PSVYRSTSPLQTLTTAEQ..YCFMTTATlTSAFLYDYTAMKPV-..GYIRARAEETISFFSIMKTNMVNRPTS...PSLSQAHTHTLAAMRTTATGIQAQ-TFKp.....qtGFF.......IVLDASR.ARAVTNP...LDTAIQPKF------...........SPSFIKEVTFDHIFQTTINETA--................RSVTRETTTGyiMNAAK......TGALYKASPAYYLF...L..ISSDCR...........lQQALSVPYDFSLGRFCPASMSCCLNKG----YEQYYVNTWLFHY...YNLKRLNV.LNLESSPV..S.DHFIQLHRTFNTEHSMHCDGSPYA.SDTTYN.--IALLR-DTVQFLNGTKTTTPLANEIPQLTDSLGYLKYQPDMVDAS....DHQNYMAYVTYLMAIFYPTFTEAQKF....EFHNLlqSVCYFDKGSISRNQAYHSICHIISFQTT.ASVPYPIELQIP..........---FTTEPTSGYNAYLVKTPIGSVAIGNQNPF.......DGEGVCFLTTCIYHPTKKIN......QKLTIPPV-...........................RWQVVPEGi.aVVTGIPPNCLGYETYTQGs.................sFFTIYNDSkP--..CQPQTMQIAqARSVITTVYSAAQKSDIFvQPY.-------.---....GKSSWV..NGSYQFDQFVG.GALNLRTLTF--T...............MRK................PTQLY.................................vLDPI.EGTY.IIP.------............DYQ-------......TKFPLLTSG.-----.--......................................TQT.YYYDPDQTVTNTTEVSKVTIDFSIRTMITLDPL--VFNCEEFICD...KDPTCRTQFSSYCQTTQ...PIL-AALKD...AFEKYNRSIAD......................YTSTIRALTNTTQDLfA--SATPVRYRRGVEVPLG--...............................................----------------YGHDLEQPSWVYDLGGTAIVPWIGTAVAVGKLANR...........VASIEATLyqitQGVKQSIQSTNDKFDKITNILHTHLRPVTEGLVRTNEQLNAFSKQVRDQFTMINTVTTEL.......SAYVDQLQQVFTVGAFYQNQILQVISQLNSLQVYVDTLTSSFTDCISDLNQKILSPACIT..................tHQLLQINk..pSDNLGLKNVLTHYI---............NGSAATFYHLTSTK.........---GVYKPLPK-.-LFN..NTHFLAPTTAYNPVTGTCF----..FCGSNACDKSVTvDCDYQP--.QPLQ--------.--........-----------..STILAVYPTPTGLDLLT.ITSNKTFEIkHGSTVV.--TSVAIPPPPILSSTININVTF-.......QQQLLQLQEQVDQLNLQTNytttEIQSIIDKY------.NVE----...IQNALNQIVDFGPGTPSLAL----WKVILI.....LIAVVVVIVII-a................................................................
A0A097P9K3_9NIDO/28-1542               ......................................................................................................................LSLSEPVSYPFSLAVLrSFTQHVtgRFRRDVVKQVWDFAYQISTNRISVNGWDVVFKSPFILSYSNGMLNTsvlpfDAYMKSSIAKFSYTVT..AYTG--..QRPYLNTQV....NDLVN.GGYSGWSDNVrVDNCGNYACHPGGKPGCSigQPRMLQGV.CTRVLPTTQSPGVQF..----SG---VNYQLTPYTDYTLSMPST...--QSGYCQNSPVYVQCGAWTPYRLHSFGcdrvscnyNLTtd..wvvGFKSKVP.PVTLPQE...LRLPIAQKVSRRLGVnvpdyfwlvkqSYFYLAQSFKSPNY--SLFAALLN................SIFQQSRFLT..-DLCY......SQPFFQLQQCYDNA...L..YLPDAV............FSTLFSTLFQWDYQVKFPNNNRLQVNETFLQLPPYEYVGQTISQgqiLNLFKDAM.VFLDFFDT..K.FYRVNDGPGGDVFAVVVKQMEEIKySDFKVK.LVNGFLEISCKNVVNATLQPHASQVILLARHMSMWSVAAANSTTIYC....PIYTLTHFGTLDISSSWFFHTLAKPS....GPLKE..ISMPILSTAAAGVYMYAMPEHWLSFLQQlQQVYQPSLFSLGi........nMTSANSSQLQAYVQSYTAWYLSIIYTRLPESR.......RLSFGSHLVPYMQALLSFRQ......SDIDA----...........................TDVDTVAR...YNTLCLMWGRKYAVVS--...................YNQLPEWSlPLFrgDVGSSMWFR.KTITCE---NTPAHFYPI.VGY.LDFLDYKyIPKynsvQCPNTNvqPTLLQVYEVPNlFVIIVQCVFGSYSwfsgltdrraytfyrSYK................---IGticillpykkpfgsistigfykqeslnipvvtvtQDLL.PNCTgIIMdGIFTPChpsgcpvrssydNYIVCRGDSGsn.ytlRNYHRVSPP.VYNVP.LSevslnltvptvdftsyslspsnsvllqdidggivvdhnTGS.IWY-PDGQAYDVSFYISVIIRYAPPKLELPSSLANFTSCLDYVCF...GNQQCRGEAQTFCASMDyfeQVFNKSLTSlvtALTDLHHVLKLilpettleltdssrrqrrsvdeFADSISLLSESFERYmSPASQAYMANMMWWDEAFDGIslpqrsgsilsr......................spsisstsswrsySSRTPLISNVRTPKTTFNVKLSMPKLPKASTLSTIGSVLSSGLSIASLGLS..........iFSIIQDRQv..tELTQQQIMALENQVTILTDYTEKNFKEIQSSLNTLGQQVQDFSQQVTLSLQQLSNGLEQI.......TQQLDKSLYYVTATQQYSIYMSSLINQLNELSQAVYKTQDMYITCIHSLQSGVLSPTCITpsqilqlyq.vaknlggncQPIFSERe..iSRFYSLPLVTDAMVHNDtywfswsipitcSNILGSVFKVQPGY.........---IVNPYHQTS.LQYD..LPTHVVTSNAGALVFNNHYCDR-..YNQVYLCTKSAF.DLAESNYL.TMIYSNVTGNGSlTFhpepkpdpCVYLSASTLYCfySDVCHQCVITVGNCTNR.TVTYENYTY.------.FIMDQQCRGFDQVTISSPIDIRYDftaipskPPLPLHLSYINVTFNVTLP....------NGMNWTDLVlDYSFKDK...VYEISKNITQLHEQILQVSSWASGWFQRLR.....DFLYGLLPAWIT.................................................................
A0A6G0HFM4_LARCR/1056-1306             ............................................................................................................tniaskrsgs----------------.------..----------------------------------------------.....----------------..------..---------....-----.----------.------------------..--------.---------------..---------------------------...----------------------------........---.......-------.-------...---------------...........------------------------................----------..-----......--------------...-..------............--------------------------------------------...--------.--------..-.------------------------.------.-----------------------------------------------....--------------------------....-----..----------------------------.------------..........--------------------------------.......--------------------......---------...........................--------...------------------...................--------.---..---------.------------------.---.-------.---....------..-----------.-------------...............---................-----..................................----.----.---.------............----------......---------.-----.--......................................---.---------------------------------------------...-----------------...---------...-----------......................---------------.---------------------...............................................---------------------------------------------------...........--------....------------------------------------------------------------.......--------------------------------------------------------CPSG...................LAVMEEH....PGLTDFPTIGTALY--K............DRKIFIVHSVPGNV.........EKTVVRGVIPMPkMSTD..GVPCWPDYK--VWLIDGRYYQPS..DCYGKYCHKPEP.HERYRRCL.ANPNE-------.--........----------C..KTVCTP--CHRGICYR-.---DKKFTWmEGSVAV.DIESPPLEPFSRPHISDGPVSFSDllrgglsETPEMKLLQAINTSVKLIH....-VQEDLDNI-TRSLK.--EFDKR...YDEITARRSTFAGWLSGFASDAALWTSIAL.....LTGWC-------falsagi..........................................................
A0A4U5ULI2_COLLU/888-1282              ........................................................................................................garrkrflgtvmga----------------.------..----------------------------------------------.....----------------..------..---------....-----.----------.------------------..--------.---------------..---------------------------...----------------------------........---.......-------.-------...---------------...........------------------------................----------..-----......--------------...-..------............--------------------------------------------...--------.--------..-.------------------------.------.-----------------------------------------------....--------------------------....-----..----------------------------.------------..........--------------------------------.......--------------------......---------...........................--------...------------------...................--------.---..---------.------------------.---.-------.---....------..-----------.-------------...............---................-----..................................----.----.---.------............----------......---------.-----.--......................................---.---------------------------------------------...-----------------...---------...-----------......................---------------.---------------------...............................................---------------------------------------------AALGLAwhv.....srrVDALEEQM....DLHKNSYVSVSNRMVEVSNKLNTNIALINSRIDEEEEKMQKNNEIINSNFAMMRDAMMRNte...aaLRDTNVKFSVLTSYQMWYAQMQSITHQMMQAAMYTKFMARGVENCLRQIASKRSGSCPSG...................LAVMEEH....PGLTDFPTIGTALY--K............DRKIFIVHSVPGNV.........EKTVVRGVIPMPkMSTD..GVPCWPDYK--VWLIDGRYYQPS..DCYGKYCHKPEP.HERYRRCL.ANPSE-------.--........----------C..KTVCTP--CHRGICYR-.---DKKFTWmEGSVAV.DIESPPLEPFSRPHISDGPVSFSDllkgglsETPEMKLLQAINTSVKLIH....-VQEDLDNI-TRSLK.--EFDKR...YDEITARRSTFAGWLSGFASDAALWTSIAL.....LTGWC-------falsagi..........................................................
SPIKE_BRV1/28-1552                     ......................................................................................................................LVVCEPVSYPYSLQVLrSFSQRVnlRTKRAVTTDAWSFAYQISTSSLNVNGWYVNFTSPLGWSYPNGKLFGivlgsDAMMRASVSTFTYDVI..SYVG--..QRPNLDCQI....NDLAN.GGLESRYSTVrVDNCGNYPCHGGGKPGCSigHPYMANGV.RTRVLLTTQSPGIQY..-EIYSGQDYAVYQITPYTQYTVTMPSG...--TSGYCQQTPLYVECGSWTPYRVHAYGcdkatqscNYTissdwvvAFKSKAS.AIILRSQ...LIVALAQKLSRTVGVnkavyfwflkqPYHYLSLVNFSPNYALFSP--LCK................SLRQQSATYS..-ALSY......GSPFFVAQECYNNA...L..YLPDCC............LYTLFSILFSWDYQVNYPVNNVLQANETFLQLPTTGYLGQTVSQgrmLNLFKDAI.VFLDFYDT..K.FYRTNDGPGGDIFAVVVKQVPVIAySAFRIE.QQTGYLAVKCNGVIQATLAPHSSRVVLLARHMSMWSIAAANSTTIYC....PIYTLTSFVRLDISTSWYFHTLAQPS....GPIQQ..VSMPVLSTGAAGVYMHPMIEHWVTLLAQ.SSVYQPSMFNMGv........nKSVTLTTQLQAYAQVYTAWFLSILYTRLPESR.......RLTLGAQLTPFIQALLSFKQ......ADIDA----...........................TDVDTVAR...YNVLILMWGRKYAAVI--...................YNQLPEWSyPLFkgGVGDSMWFRkKFLVTTKIHQTASHFPFI.AGY.LDFLDYKyIPKykdvACPLSTmvPSILQVYETPQlFVIIVQCVSTTYSwypgl.....rnphtI-YrsyklgticvlvpyssPTDVYssfgfffqs...............altiptvqttDDIL.PGCVgFVQdSVFTPChpsgcpvrnsydNYIICPGSSAsn.ytlRNYYRTTTP.VTNVP.IEevplqleiptvsltsyelkqsesvllqdieggivvdhnTGS.IWY-PGGQAYDVSFYVSVIIRYAPPKLELPSTLANFTSCLDYICF...GNQQCRGEAQTFCTSMDyfeQVFNKSLTSlitALQDLHYVLKLvlpettleltedtrrrrravdeFSDTISLLSESFERFmSPASQAYMANMMWWDEAFDGIslpqrtgsilss......................apslssisswhsySSRTPLISNVKTPKTTFNVKLSMPKLPKASTLSTIGSVLSSGLSIASLGLS..........iFSIIEDRRv..iELTQQQIMALEDQITILAGYTTKNFEEIQSSLNTLGQQVQDFSQTSALSLQQLSNGFEQI.......TQQLDKSIYYVMAVQQYATYMSSLVNQLNELSQAVYKTQDMYITCIHSLQSGVLSPNCITpfqichlyqvaknlssgecQPILSERe..iSRFYSLPLVTDAMVHNDtywfswsipitcSNILGSVYKVQPGY.........---IVNPHHPTS.LQYD..VPTHVVTSNAGALIFDEHYCDR-..YNQVYLCTKSAF.DLAEASYL.TMLYSNQTDNSSlTFhpaprpdpCVYLSASALYCyySDECHQCVIAVGNCTNR.TVTYENYTY.------.PIMDPQCRGFDQITISSPIAIGADftalpsrPPLPLHLSYVNVTFNVTLP....------NELNWTDLVlDYSFKDK...VYEISKNITQLHEQILQVSNWASGWFQRLR.....DFLYGLIPAWIT.................................................................
#=GC seq_cons                          ..................................................................................................................h..t......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................l..........t......ht.t........pt..........a..................................t..hh.h..............................................h.........................................s.........................................th...t.................................................ht..hhh.....hh.hs.h..sh..hs........s...h.sC..hlC....ts..sht..t..hss.p..................................................................................................................................................................................................ht.ht.t...............tp.h..hst.h......hptpltt.ttpht..pt.ls.ph..htt.h.p.........ttht..h.....h..a...h..h...h.p.t..h....t.h.sChtpl.tth..sss.s.....................hhp.p....s.hh....l.shhh..c.............thh..hhpl..sh............hl....shs...hp.....hhst.p....h.tsth.......s...hC........t.t....t...................................ts.......h.G............h.h..................s....................................................................................................................h................................................................
//
DBGET integrated database retrieval system