#=GF ID   Ssol_1539-like_2nd
#=GF AC   PF22445.1
#=GF DE   Ssol_1539-like, second domain
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF AU   Lazaro Pinto Beatriz;0000-0001-6837-2941
#=GF SE   ECOD:EF23597
#=GF GA   27.00 27.00;
#=GF TC   27.00 28.40;
#=GF NC   26.80 21.70;
#=GF BM   hmmbuild  HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 90746521 --cpu 8 -E 1000 HMM pfamseq
#=GF TP   Domain
#=GF RC   Paper describing PDB structure 5k5a
#=GF RN   [1]
#=GF RM   26339031
#=GF RT   Structures of archaeal DNA segregation machinery reveal
#=GF RT   bacterial and eukaryotic  linkages.
#=GF RA   Schumacher MA, Tonthat NK, Lee J, Rodriguez-Castaneda FA,
#=GF RA   Chinnam NB, Kalliomaa-Sanford AK, Ng IW, Barge MT, Shaw PL,
#=GF RA   Barilla D;
#=GF RL   Science. 2015;349:1120-1124.
#=GF DR   INTERPRO; IPR054524;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This domain is found in Ssol_1539 from Saccharolobus
#=GF CC   solfataricus and similar archaeal sequences. Ssol_1539 is
#=GF CC   organised into two domains. The N-terminal domain contains two
#=GF CC   subdomains separated by a central helix. This entry represents
#=GF CC   the second subdomain, which shows an all-alpha configuration
#=GF CC   [1].
#=GF SQ   3
#=GS Q976D6_SULTO/114-158  AC Q976D6.1
#=GS Q971P3_SULTO/194-238  AC Q971P3.1
#=GS A4YD10_METS5/194-240  AC A4YD10.1
Q976D6_SULTO/114-158             KIPLKPAYELYT..KAKDKLQKIVNLPPTERSQLLTTKEGRRIILER
Q971P3_SULTO/194-238             KLSVRTAYELYK..KAKDKLQKIASLPPTERNQLLTTREGRKIILER
A4YD10_METS5/194-240             KIGIRTAYDIYLalKRKNLLDLDRRIPKSELKLLLTTREGRKIISER
#=GC seq_cons                    KIulRTAYELYp..KAKDKLQKIssLPPTERsQLLTTREGRKIILER
//