GenomeNet

Database: Pfam
Entry: Staphostatin_B
LinkDB: Staphostatin_B
Original site: Staphostatin_B 
#=GF ID   Staphostatin_B
#=GF AC   PF09023.13
#=GF DE   Staphostatin B
#=GF AU   Mistry J;0000-0003-2479-5322
#=GF AU   Sammut SJ;0000-0003-4472-904X
#=GF SE   pdb_1y4h
#=GF GA   25.00 25.00;
#=GF TC   243.00 242.80;
#=GF NC   24.70 20.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF CL   CL0354
#=GF RN   [1]
#=GF RM   15644332
#=GF RT   A comparison of staphostatin B with standard mechanism serine
#=GF RT   protease inhibitors. 
#=GF RA   Filipek R, Potempa J, Bochtler M; 
#=GF RL   J Biol Chem. 2005;280:14669-14674.
#=GF DR   INTERPRO; IPR015113;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   Staphostatin B inhibits the cysteine protease Staphopain B,
#=GF CC   produced by Staphylococcus aureus, by blocking the active site
#=GF CC   of the enzyme. The domain adopts an eight-stranded mixed
#=GF CC   beta-barrel structure, with a deviation from the up-down
#=GF CC   topology of canonical beta-barrels in the amino-terminal part of
#=GF CC   the molecule [1].
#=GF SQ   1
#=GS SSPC_STAA8/3-107  AC Q9EYW6.1
#=GS SSPC_STAA8/3-107  DR PDB; 1Y4H D; 3-107;
#=GS SSPC_STAA8/3-107  DR PDB; 1PXV D; 3-107;
#=GS SSPC_STAA8/3-107  DR PDB; 1PXV C; 3-107;
#=GS SSPC_STAA8/3-107  DR PDB; 1Y4H C; 3-107;
SSPC_STAA8/3-107             QLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDTAHQRIKFSSIDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYER
#=GR SSPC_STAA8/3-107  SS    EEEEEEEE--GGGS-HHHHHHHHTT-EEEEETTTTEEEEEEE--TT-SSEEEEEEEETTTTEEEEEETTEEEEEEEEEEEETTEEEEEEEESSSB-B---EEEEE
#=GC SS_cons                 EEEEEEEE--GGGS-HHHHHHHHTT-EEEEETTTTEEEEEEE--TT-SSEEEEEEEETTTTEEEEEETTEEEEEEEEEEEETTEEEEEEEESSSB-B---EEEEE
#=GC seq_cons                QLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDTAHQRIKFSSIDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYER
//
DBGET integrated database retrieval system