GenomeNet

Database: Pfam
Entry: Sublancin
LinkDB: Sublancin
Original site: Sublancin 
#=GF ID   Sublancin
#=GF AC   PF19151.2
#=GF DE   Sublancin
#=GF PI   DUF5833;
#=GF AU   Finn RD;0000-0001-8626-2148
#=GF AU   Williams LS;0000-0001-5551-8526
#=GF SE   Manual
#=GF GA   26.90 26.90;
#=GF TC   28.30 123.10;
#=GF NC   24.80 24.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 57096847 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   21196935
#=GF RT   Sublancin is not a lantibiotic but an S-linked glycopeptide.
#=GF RA   Oman TJ, Boettcher JM, Wang H, Okalibe XN, van der Donk WA;
#=GF RL   Nat Chem Biol. 2011;7:78-80.
#=GF RN   [2]
#=GF RM   9722542
#=GF RT   Identification and characterization of the structural and
#=GF RT   transporter genes for,  and the chemical and biological
#=GF RT   properties of, sublancin 168, a novel lantibiotic produced by
#=GF RT   Bacillus subtilis 168.
#=GF RA   Paik SH, Chakicherla A, Hansen JN;
#=GF RL   J Biol Chem. 1998;273:23134-23142.
#=GF RN   [3]
#=GF RM   24405370
#=GF RT   NMR structure of the S-linked glycopeptide sublancin 168.
#=GF RA   Garcia De Gonzalo CV, Zhu L, Oman TJ, van der Donk WA;
#=GF RL   ACS Chem Biol. 2014;9:796-801.
#=GF DR   INTERPRO; IPR026479;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family represents sublancin, a small bacteriocin active
#=GF CC   against  Gram-positive bacteria. This family appears to be
#=GF CC   restricted to  Bacilli. Sublancin was thought to be a
#=GF CC   lantibiotic but was later  shown to be an S-linked glycopeptide
#=GF CC   [1,2]. Glycosylation is  essential for its antimicrobial
#=GF CC   activity. Sublancin is  biosynthesised as a precursor peptide
#=GF CC   bearing an N-terminal leader  peptide, and a C-terminal core
#=GF CC   peptide that is converted into the  mature peptide [1].
#=GF CC   Sublancin comprises two alpha helices and a  well-defined
#=GF CC   inter-helical loop [3]. Sublancin inhibits B.cereus  spore
#=GF CC   outgrowth, after the germination stage, approximately  1000-fold
#=GF CC   better than it inhibits exponential growth of the same  cells
#=GF CC   and inhibits B.subtilis strain ATCC6633 and B. megaterium 
#=GF CC   strain 14581 [2].
#=GF SQ   3
#=GS SUNA_BPSPB/1-56        AC P68578.1
#=GS SUNA_BACSU/1-56        AC P68577.1
#=GS SUNA_BACSU/1-56        DR PDB; 2MIJ A; 1-37;
#=GS A0A3R9QMC4_9BACI/1-57  AC A0A3R9QMC4.1
SUNA_BPSPB/1-56                   MEKLFKEVKLEELENQKGSGLGKAQCAALWLQCASGGTIGCGGGAV-ACQNYRQFCR
SUNA_BACSU/1-56                   MEKLFKEVKLEELENQKGSGLGKAQCAALWLQCASGGTIGCGGGAV-ACQNYRQFCR
#=GR SUNA_BACSU/1-56        SS    XXXXXXXXXXXXXXXXXXX---TTHHHHHHHHTTTS--SS-S-TTT-HHHHHHHH--
A0A3R9QMC4_9BACI/1-57             MDNLYKELQIDEIEQFKGKGFGALQCTAIATQCSSGGAIGCGGGSTQACDTYERYCT
#=GC SS_cons                      XXXXXXXXXXXXXXXXXXX---TTHHHHHHHHTTTS--SS-S-TTT-HHHHHHHH--
#=GC seq_cons                     MEKLFKEVKLEELENQKGSGLGKAQCAALWLQCASGGTIGCGGGAV.ACQNYRQFCR
//
DBGET integrated database retrieval system