GenomeNet

Database: Pfam
Entry: TMEM169
LinkDB: TMEM169
Original site: TMEM169 
#=GF ID   TMEM169
#=GF AC   PF15052.9
#=GF DE   TMEM169 protein family
#=GF AU   Coggill P;0000-0001-5731-1588
#=GF AU   Hetherington K;
#=GF SE   Jackhmmer:Q96HH4
#=GF GA   27.00 27.00;
#=GF TC   27.40 48.60;
#=GF NC   26.40 24.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR029386;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This domain is thought to be structured transmembrane helices
#=GF CC   and includes the intermediary cytoplasmic domain. It is found in
#=GF CC   eukaryotes, and is approximately 130 amino acids in length.
#=GF SQ   331
#=GS A0A6P7LET5_BETSP/150-280  AC A0A6P7LET5.1
#=GS A0A7E5W5N5_TRINI/276-406  AC A0A7E5W5N5.1
#=GS A0A060YVD9_ONCMY/55-186   AC A0A060YVD9.1
#=GS A0A444SKL8_ARMVU/214-343  AC A0A444SKL8.1
#=GS A0A3P9NY52_POERE/152-282  AC A0A3P9NY52.1
#=GS A0A091NEJ1_9PASS/154-284  AC A0A091NEJ1.1
#=GS A0A091QA83_LEPDC/147-277  AC A0A091QA83.1
#=GS E7F6S9_DANRE/142-272      AC E7F6S9.1
#=GS A0A3Q3FTS7_KRYMA/133-263  AC A0A3Q3FTS7.1
#=GS A0A6J2LCF0_9CHIR/147-277  AC A0A6J2LCF0.1
#=GS A0A2Y9MM47_DELLE/146-276  AC A0A2Y9MM47.1
#=GS A0A671PMR5_9TELE/157-285  AC A0A671PMR5.1
#=GS A0A6J1NVL3_BICAN/274-404  AC A0A6J1NVL3.1
#=GS A0A2I2V108_FELCA/147-277  AC A0A2I2V108.1
#=GS A0A6I8P5C0_ORNAN/156-286  AC A0A6I8P5C0.1
#=GS A0A5E4C979_MARMO/56-186   AC A0A5E4C979.1
#=GS A0A384AKT5_BALAS/147-277  AC A0A384AKT5.1
#=GS H0WPW5_OTOGA/147-277      AC H0WPW5.1
#=GS A0A6J2V705_CHACN/143-273  AC A0A6J2V705.1
#=GS A0A6P8QXA7_GEOSA/150-280  AC A0A6P8QXA7.1
#=GS J9NSU3_CANLF/147-277      AC J9NSU3.1
#=GS A0A6J3DA61_AYTFU/158-288  AC A0A6J3DA61.1
#=GS A0A6J0XS50_ODOVR/147-277  AC A0A6J0XS50.1
#=GS A0A212EJ21_DANPL/276-406  AC A0A212EJ21.1
#=GS A0A1S3K8E1_LINUN/108-238  AC A0A1S3K8E1.1
#=GS A0A4W4H5L4_ELEEL/147-277  AC A0A4W4H5L4.1
#=GS A0A6J0UJQ8_9SAUR/158-288  AC A0A6J0UJQ8.1
#=GS L8IIW0_9CETA/147-277      AC L8IIW0.1
#=GS A0A553NA28_9TELE/165-295  AC A0A553NA28.1
#=GS A0A452QGZ5_URSAM/148-278  AC A0A452QGZ5.1
#=GS B4GLD0_DROPE/275-405      AC B4GLD0.1
#=GS Q9VGV1_DROME/275-405      AC Q9VGV1.1
#=GS A0A674HXH9_TERCA/147-277  AC A0A674HXH9.1
#=GS V4A081_LOTGI/41-170       AC V4A081.1
#=GS A0A6P5LQW6_PHACI/147-277  AC A0A6P5LQW6.1
#=GS A0A2G8KDC1_STIJA/18-148   AC A0A2G8KDC1.1
#=GS A0A452GYL0_9SAUR/158-288  AC A0A452GYL0.1
#=GS A0A6P4XJ43_BRABE/164-294  AC A0A6P4XJ43.1
#=GS A0A6L2Q294_COPFO/344-474  AC A0A6L2Q294.1
#=GS A0A0L8HB75_OCTBM/89-218   AC A0A0L8HB75.1
#=GS A0A1L8ENL2_XENLA/160-290  AC A0A1L8ENL2.1
#=GS A0A6P6Q1H6_CARAU/140-270  AC A0A6P6Q1H6.1
#=GS A0A1U7SDU7_ALLSI/157-287  AC A0A1U7SDU7.1
#=GS A0A2Y9FHP7_PHYMC/147-277  AC A0A2Y9FHP7.1
#=GS A0A3Q4HEH1_NEOBR/131-261  AC A0A3Q4HEH1.1
#=GS A0A2K6MCL5_RHIBE/147-277  AC A0A2K6MCL5.1
#=GS A0A2I2Y3U3_GORGO/89-219   AC A0A2I2Y3U3.1
#=GS A0A6P6KLP5_CARAU/148-278  AC A0A6P6KLP5.1
#=GS A0A2J7RCL2_9NEOP/248-378  AC A0A2J7RCL2.1
#=GS F6Y0R9_XENTR/160-290      AC F6Y0R9.3
#=GS A0A2P4SXK3_BAMTH/55-185   AC A0A2P4SXK3.1
#=GS A0A2K5VI40_MACFA/147-277  AC A0A2K5VI40.1
#=GS A0A6J2TKV2_DROLE/266-396  AC A0A6J2TKV2.1
#=GS A0A0P7UGE4_SCLFO/157-287  AC A0A0P7UGE4.1
#=GS M3YYF0_MUSPF/148-278      AC M3YYF0.1
#=GS A0A5B7INE3_PORTR/38-131   AC A0A5B7INE3.1
#=GS A0A341CXP2_NEOAA/147-277  AC A0A341CXP2.1
#=GS A0A3P8XZ32_ESOLU/156-286  AC A0A3P8XZ32.1
#=GS R0J9G8_ANAPL/147-277      AC R0J9G8.1
#=GS A0A3B0JR97_DROGU/278-408  AC A0A3B0JR97.1
#=GS A0A6I9K0A3_CHRAS/146-276  AC A0A6I9K0A3.1
#=GS A0A5B7CIB9_PORTR/236-286  AC A0A5B7CIB9.1
#=GS A0A668V5L3_OREAU/152-282  AC A0A668V5L3.1
#=GS Q6NU88_XENLA/161-291      AC Q6NU88.1
#=GS A0A2K6CFT0_MACNE/147-277  AC A0A2K6CFT0.1
#=GS A0A3P8VQN2_CYNSE/136-266  AC A0A3P8VQN2.1
#=GS G3T5T9_LOXAF/147-277      AC G3T5T9.1
#=GS A0A6I9I9Y1_VICPA/147-277  AC A0A6I9I9Y1.1
#=GS A0A3Q3EAD8_9LABR/152-282  AC A0A3Q3EAD8.1
#=GS A0A3Q0H683_ALLSI/157-287  AC A0A3Q0H683.1
#=GS A0A2Y9I598_NEOSC/148-278  AC A0A2Y9I598.1
#=GS A0A671T3X5_9TELE/140-270  AC A0A671T3X5.1
#=GS A0A6P8Z8I0_DROAB/279-409  AC A0A6P8Z8I0.1
#=GS A0A3Q7Q7V2_CALUR/148-278  AC A0A3Q7Q7V2.1
#=GS B4QUM5_DROSI/275-405      AC B4QUM5.1
#=GS A0A553NU28_TIGCA/430-559  AC A0A553NU28.1
#=GS A0A672T9H6_SINGR/139-269  AC A0A672T9H6.1
#=GS A0A0Q3PT46_AMAAE/157-287  AC A0A0Q3PT46.1
#=GS H2ZK06_CIOSA/101-186      AC H2ZK06.1
#=GS A0A182GV59_AEDAL/252-382  AC A0A182GV59.1
#=GS G5C2J8_HETGA/146-276      AC G5C2J8.1
#=GS A0A444T043_ARMVU/73-169   AC A0A444T043.1
#=GS A0A315W5C0_GAMAF/152-282  AC A0A315W5C0.1
#=GS A0A2U3XUH2_LEPWE/148-278  AC A0A2U3XUH2.1
#=GS A0A6P7SBH2_OCTVU/89-218   AC A0A6P7SBH2.1
#=GS A0A672QIQ4_SINGR/141-271  AC A0A672QIQ4.1
#=GS A0A4W4EQW9_ELEEL/109-239  AC A0A4W4EQW9.1
#=GS Q7QD12_ANOGA/259-389      AC Q7QD12.5
#=GS A0A0D9R9S6_CHLSB/147-277  AC A0A0D9R9S6.1
#=GS A0A3B1J351_ASTMX/148-278  AC A0A3B1J351.1
#=GS A0A5J5D0M8_9PERO/151-276  AC A0A5J5D0M8.1
#=GS A0A3Q1CYB9_AMPOC/133-263  AC A0A3Q1CYB9.1
#=GS A0A6I8URV1_DROPS/275-405  AC A0A6I8URV1.1
#=GS A0A401Q925_SCYTO/56-186   AC A0A401Q925.1
#=GS A0A672M8T0_SINGR/140-270  AC A0A672M8T0.1
#=GS A0A084VE31_ANOSI/262-391  AC A0A084VE31.1
#=GS A0A669BAB0_ORENI/150-280  AC A0A669BAB0.1
#=GS A0A096LYU2_POEFO/144-274  AC A0A096LYU2.1
#=GS T1JJW6_STRMM/154-284      AC T1JJW6.1
#=GS U3JMY0_FICAL/158-288      AC U3JMY0.1
#=GS B4HIN1_DROSE/275-405      AC B4HIN1.1
#=GS A0A7N8WM51_9TELE/151-281  AC A0A7N8WM51.1
#=GS A0A2R9CHJ7_PANPA/147-277  AC A0A2R9CHJ7.1
#=GS W5QDJ2_SHEEP/147-277      AC W5QDJ2.1
#=GS B4GLH3_DROPE/6-136        AC B4GLH3.1
#=GS G7N8V0_MACMU/147-277      AC G7N8V0.1
#=GS A0A2K5NQS9_CERAT/147-277  AC A0A2K5NQS9.1
#=GS A0A6J2HST7_9PASS/158-288  AC A0A6J2HST7.2
#=GS W5MU45_LEPOC/161-291      AC W5MU45.1
#=GS A0A663DUL9_AQUCH/158-288  AC A0A663DUL9.1
#=GS A0A6P9CDK1_PANGU/53-183   AC A0A6P9CDK1.1
#=GS A0A5E4CB44_MARMO/31-161   AC A0A5E4CB44.1
#=GS E1C4T0_CHICK/157-287      AC E1C4T0.2
#=GS A0A3M0L0Y9_HIRRU/158-288  AC A0A3M0L0Y9.1
#=GS A0A6J2J8L4_BOMMA/233-301  AC A0A6J2J8L4.1
#=GS A0A6I9VRY7_BACDO/251-381  AC A0A6I9VRY7.1
#=GS S4RHY9_PETMA/170-300      AC S4RHY9.1
#=GS A0A6P3F8W8_OCTDE/147-277  AC A0A6P3F8W8.1
#=GS M7AQ08_CHEMY/111-241      AC M7AQ08.1
#=GS A0A226PPK7_COLVI/157-287  AC A0A226PPK7.1
#=GS A0A643CHD5_BALPH/147-277  AC A0A643CHD5.1
#=GS A0A194PLI3_PAPXU/277-407  AC A0A194PLI3.1
#=GS A0A2I0UKL6_LIMLA/158-288  AC A0A2I0UKL6.1
#=GS A0A3Q1GXT7_9TELE/153-283  AC A0A3Q1GXT7.1
#=GS A0A182H6H0_AEDAL/252-382  AC A0A182H6H0.1
#=GS A0A6P3VR80_CLUHA/140-270  AC A0A6P3VR80.1
#=GS A0A7E4SEK4_CIMLE/129-259  AC A0A7E4SEK4.1
#=GS A0A3S2MF93_ORYJA/151-281  AC A0A3S2MF93.1
#=GS A0A2K6V171_SAIBB/146-276  AC A0A2K6V171.1
#=GS A0A5F8HJK2_MONDO/148-278  AC A0A5F8HJK2.1
#=GS A0A2I0MGD5_COLLI/157-287  AC A0A2I0MGD5.1
#=GS A0A3Q1JHA9_ANATE/152-282  AC A0A3Q1JHA9.1
#=GS A0A5A9P027_9TELE/139-269  AC A0A5A9P027.1
#=GS I3M7Y3_ICTTR/147-277      AC I3M7Y3.1
#=GS W5KWK1_ASTMX/171-301      AC W5KWK1.2
#=GS A0A093PTS6_9PASS/154-284  AC A0A093PTS6.1
#=GS A0A210PVV1_MIZYE/106-236  AC A0A210PVV1.1
#=GS H3A7V9_LATCH/162-292      AC H3A7V9.1
#=GS D4ACP3_RAT/147-277        AC D4ACP3.1
#=GS A0A5N4E7P4_CAMDR/147-277  AC A0A5N4E7P4.1
#=GS A0A384C1J2_URSMA/148-278  AC A0A384C1J2.1
#=GS B4LZX3_DROVI/271-401      AC B4LZX3.1
#=GS A0A093H7P9_STRCA/147-277  AC A0A093H7P9.1
#=GS A0A4Z2J3L4_9TELE/152-282  AC A0A4Z2J3L4.1
#=GS A0A3Q2EDM3_CYPVA/212-342  AC A0A3Q2EDM3.1
#=GS A0A6P7HGZ6_9TELE/152-282  AC A0A6P7HGZ6.1
#=GS A0A2I2YI43_GORGO/102-232  AC A0A2I2YI43.1
#=GS A0A3S2LUE9_CHISP/280-410  AC A0A3S2LUE9.1
#=GS A0A5E4Q955_9NEOP/267-397  AC A0A5E4Q955.1
#=GS A0A6P6KYD9_CARAU/140-270  AC A0A6P6KYD9.1
#=GS A0A7N8YPL7_9TELE/143-273  AC A0A7N8YPL7.1
#=GS TM169_MOUSE/147-277       AC Q8BG50.1
#=GS A0A665WWF4_ECHNA/152-282  AC A0A665WWF4.1
#=GS A0A6G1A7Y6_CROCR/147-277  AC A0A6G1A7Y6.1
#=GS A0A6P4F0K5_DRORH/274-404  AC A0A6P4F0K5.1
#=GS A0A212D2X5_CEREH/147-277  AC A0A212D2X5.1
#=GS A0A3B1JGG4_ASTMX/133-263  AC A0A3B1JGG4.1
#=GS A0A2K5IFW4_COLAP/147-277  AC A0A2K5IFW4.1
#=GS A0A6J1TR31_9SAUR/158-288  AC A0A6J1TR31.1
#=GS A0A0L7L7Q4_9NEOP/199-328  AC A0A0L7L7Q4.1
#=GS C3YL36_BRAFL/163-293      AC C3YL36.1
#=GS A0A286Y371_CAVPO/146-276  AC A0A286Y371.1
#=GS A0A672JKH2_SALFA/152-282  AC A0A672JKH2.1
#=GS B4K5T4_DROMO/269-399      AC B4K5T4.1
#=GS H9JGH7_BOMMO/276-406      AC H9JGH7.1
#=GS A0A0F8ALS0_LARCR/152-282  AC A0A0F8ALS0.1
#=GS A0A6I8W0X7_DROPS/6-136    AC A0A6I8W0X7.1
#=GS A0A2U9C9U9_SCOMX/151-282  AC A0A2U9C9U9.1
#=GS G3H3Z1_CRIGR/147-277      AC G3H3Z1.1
#=GS A0A6A5ETB8_PERFL/151-281  AC A0A6A5ETB8.1
#=GS S7NLV9_MYOBR/72-202       AC S7NLV9.1
#=GS H9GFK9_ANOCA/158-288      AC H9GFK9.2
#=GS A0A3Q7SN38_VULVU/147-277  AC A0A3Q7SN38.1
#=GS A0A2K6ACF2_MANLE/147-277  AC A0A2K6ACF2.1
#=GS A0A3Q7V6Q7_URSAR/148-278  AC A0A3Q7V6Q7.1
#=GS A0A067QFN8_ZOONE/237-367  AC A0A067QFN8.1
#=GS A0A182XV45_ANOST/260-390  AC A0A182XV45.1
#=GS A0A5N5SL10_9CRUS/360-407  AC A0A5N5SL10.1
#=GS A0A4U5TZZ9_COLLU/93-223   AC A0A4U5TZZ9.1
#=GS G3VBS0_SARHA/148-278      AC G3VBS0.1
#=GS A0A669PE30_PHACC/157-287  AC A0A669PE30.1
#=GS A0A484CVQ0_PERFV/174-253  AC A0A484CVQ0.1
#=GS A0A4C1VWJ8_EUMVA/291-349  AC A0A4C1VWJ8.1
#=GS T1GIS9_MEGSC/194-322      AC T1GIS9.1
#=GS B3LZG4_DROAN/272-402      AC B3LZG4.2
#=GS A0A5J5MI46_MUNRE/147-277  AC A0A5J5MI46.1
#=GS A0A4U1FGD1_MONMO/147-277  AC A0A4U1FGD1.1
#=GS A0A4W2E8W7_BOBOX/302-432  AC A0A4W2E8W7.1
#=GS D2GXF2_AILME/148-278      AC D2GXF2.1
#=GS A0A2Y9DL91_TRIMA/151-281  AC A0A2Y9DL91.1
#=GS A0A672VBA2_STRHB/158-280  AC A0A672VBA2.1
#=GS A0A6P4JB25_DROKI/275-405  AC A0A6P4JB25.1
#=GS R7VK65_CAPTE/73-203       AC R7VK65.1
#=GS A0A671PI01_9TELE/144-272  AC A0A671PI01.1
#=GS A0A091FJ77_9AVES/147-277  AC A0A091FJ77.1
#=GS A0A6I9N4E8_9TELE/152-282  AC A0A6I9N4E8.1
#=GS A0A671NPA7_9TELE/78-208   AC A0A671NPA7.1
#=GS TM169_HUMAN/147-277       AC Q96HH4.1
#=GS A0A670JYU7_PODMU/158-288  AC A0A670JYU7.1
#=GS A0A5N5PDF2_PANHP/148-278  AC A0A5N5PDF2.1
#=GS A0A674HCJ1_TAEGU/158-288  AC A0A674HCJ1.1
#=GS A0A671PJ29_9TELE/149-277  AC A0A671PJ29.1
#=GS A0A1U7QMA7_MESAU/147-277  AC A0A1U7QMA7.1
#=GS F7IHX4_CALJA/147-277      AC F7IHX4.1
#=GS B4JGE5_DROGR/270-400      AC B4JGE5.1
#=GS A0A484GT41_SOUCH/147-277  AC A0A484GT41.1
#=GS A0A484BAJ9_DRONA/268-398  AC A0A484BAJ9.1
#=GS A0A3R7MQR9_PENVA/261-390  AC A0A3R7MQR9.1
#=GS A0A2I4BWU4_9TELE/152-282  AC A0A2I4BWU4.1
#=GS A0A673J404_9TELE/144-274  AC A0A673J404.1
#=GS A0A667YPT2_9TELE/155-285  AC A0A667YPT2.1
#=GS A0A402EUE6_9SAUR/155-285  AC A0A402EUE6.1
#=GS A0A3P8TBW2_AMPPE/133-263  AC A0A3P8TBW2.1
#=GS A0A673TI44_SURSU/151-281  AC A0A673TI44.1
#=GS A0A287A9V5_PIG/146-276    AC A0A287A9V5.2
#=GS A0A087VE81_BALRE/147-277  AC A0A087VE81.1
#=GS A0A091I7I5_CALAN/147-277  AC A0A091I7I5.1
#=GS A0A2U3V4U1_TURTR/147-277  AC A0A2U3V4U1.1
#=GS A0A1S3P151_SALSA/153-283  AC A0A1S3P151.1
#=GS A0A3Q2WKS5_HAPBU/150-280  AC A0A3Q2WKS5.1
#=GS M4AMI0_XIPMA/152-282      AC M4AMI0.1
#=GS A0A6P6QCM1_CARAU/140-270  AC A0A6P6QCM1.1
#=GS A0A7E5W504_TRINI/276-396  AC A0A7E5W504.1
#=GS A0A6J3HVW4_SAPAP/147-277  AC A0A6J3HVW4.1
#=GS A0A6I9HB78_GEOFO/158-288  AC A0A6I9HB78.1
#=GS A0A4X2K3H5_VOMUR/147-277  AC A0A4X2K3H5.1
#=GS A0A401RUG5_CHIPU/170-300  AC A0A401RUG5.1
#=GS U3IZG1_ANAPP/158-288      AC U3IZG1.1
#=GS A0A6P3Q4M0_PTEVA/147-277  AC A0A6P3Q4M0.1
#=GS K7G7I2_PELSI/158-288      AC K7G7I2.1
#=GS A0A6J1NWR9_BICAN/241-371  AC A0A6J1NWR9.1
#=GS A0A482X0Q3_LAOST/120-250  AC A0A482X0Q3.1
#=GS A0A673CIG4_9TELE/152-282  AC A0A673CIG4.1
#=GS H2TWX3_TAKRU/149-279      AC H2TWX3.3
#=GS A0A672V8F6_STRHB/158-288  AC A0A672V8F6.1
#=GS A0A3N0XFV4_ANAGA/140-270  AC A0A3N0XFV4.1
#=GS F7CVE4_HORSE/147-277      AC F7CVE4.1
#=GS A0A674AD91_SALTR/153-283  AC A0A674AD91.1
#=GS G1PDW2_MYOLU/147-277      AC G1PDW2.1
#=GS L5LYG3_MYODS/147-277      AC L5LYG3.1
#=GS A0A2K5RBH3_CEBIM/147-277  AC A0A2K5RBH3.1
#=GS A0A096MR80_PAPAN/147-277  AC A0A096MR80.1
#=GS A0A2P8YL54_BLAGE/254-382  AC A0A2P8YL54.1
#=GS A0A6J1X5Q0_GALME/278-408  AC A0A6J1X5Q0.1
#=GS W5JBR1_ANODA/260-390      AC W5JBR1.1
#=GS A0A7R5K6S9_9PASS/158-217  AC A0A7R5K6S9.1
#=GS A0A3N0YJJ9_ANAGA/140-270  AC A0A3N0YJJ9.1
#=GS A0A6J2RZU2_COTGO/152-282  AC A0A6J2RZU2.1
#=GS A0A226NN29_CALSU/157-287  AC A0A226NN29.1
#=GS A0A2A4K4H2_HELVI/277-407  AC A0A2A4K4H2.1
#=GS A0A2U3W023_ODORO/148-278  AC A0A2U3W023.1
#=GS A0A2K6RAF8_RHIRO/147-277  AC A0A2K6RAF8.1
#=GS A0A6P3J7S3_BISBI/147-277  AC A0A6P3J7S3.1
#=GS A0A4W6FFM2_LATCA/152-282  AC A0A4W6FFM2.1
#=GS TM169_BOVIN/147-277       AC Q2TBG9.1
#=GS A0A2I3H6X4_NOMLE/147-277  AC A0A2I3H6X4.1
#=GS A0A6A4JN76_APOLU/109-239  AC A0A6A4JN76.1
#=GS A0A671SAB0_9TELE/144-274  AC A0A671SAB0.1
#=GS A0A6P7YGB9_9AMPH/150-280  AC A0A6P7YGB9.1
#=GS A0A1S3AJ57_ERIEU/147-277  AC A0A1S3AJ57.1
#=GS B7PSW6_IXOSC/169-299      AC B7PSW6.1
#=GS A0A194RR65_PAPMA/277-407  AC A0A194RR65.1
#=GS A0A6J0CGK0_PERMB/147-277  AC A0A6J0CGK0.1
#=GS A0A2K5CJ03_AOTNA/147-277  AC A0A2K5CJ03.1
#=GS A0A1S3EK07_DIPOR/145-275  AC A0A1S3EK07.1
#=GS A0A2J8STT9_PONAB/147-277  AC A0A2J8STT9.1
#=GS A0A498M8H1_LABRO/147-277  AC A0A498M8H1.1
#=GS A0A2J8NGW5_PANTR/147-277  AC A0A2J8NGW5.1
#=GS A0A5N5SL10_9CRUS/247-353  AC A0A5N5SL10.1
#=GS A0A6I8TY60_AEDAE/252-382  AC A0A6I8TY60.1
#=GS V9KZB2_CALMI/138-268      AC V9KZB2.1
#=GS E0VPF9_PEDHC/208-338      AC E0VPF9.1
#=GS A0A1V4K5W7_PATFA/157-287  AC A0A1V4K5W7.1
#=GS A0A6F9CE54_9TELE/76-206   AC A0A6F9CE54.1
#=GS A0A6P3WFE2_CLUHA/151-281  AC A0A6P3WFE2.1
#=GS A0A091SNM4_NESNO/146-276  AC A0A091SNM4.1
#=GS A0A2Y9IWI2_ENHLU/148-278  AC A0A2Y9IWI2.1
#=GS A0A087U4N9_STEMI/193-254  AC A0A087U4N9.1
#=GS E7EZZ8_DANRE/136-266      AC E7EZZ8.1
#=GS A0A3Q3VTT1_MOLML/133-263  AC A0A3Q3VTT1.1
#=GS A0A5C6PMT0_9TELE/149-279  AC A0A5C6PMT0.1
#=GS A0A673LGM5_9TELE/140-198  AC A0A673LGM5.1
#=GS A0A6P8VSM6_GYMAC/152-282  AC A0A6P8VSM6.1
#=GS A0A452FS15_CAPHI/147-277  AC A0A452FS15.1
#=GS A0A2K6EV78_PROCO/147-277  AC A0A2K6EV78.1
#=GS H2ZK07_CIOSA/23-151       AC H2ZK07.1
#=GS L9JF11_TUPCH/148-278      AC L9JF11.1
#=GS A0A444U1H0_ACIRT/158-288  AC A0A444U1H0.1
#=GS V8PA07_OPHHA/158-288      AC V8PA07.1
#=GS A0A6I9Z462_9SAUR/156-286  AC A0A6I9Z462.1
#=GS R7UNB8_CAPTE/1-125        AC R7UNB8.1
#=GS A0A6P6GYY9_PUMCO/147-277  AC A0A6P6GYY9.1
#=GS A0A6J2J7U7_BOMMA/276-406  AC A0A6J2J7U7.1
#=GS A0A218VBL5_9PASE/158-288  AC A0A218VBL5.1
#=GS G3R751_GORGO/147-277      AC G3R751.1
#=GS A0A1A6GER1_NEOLE/148-278  AC A0A1A6GER1.1
#=GS A0A340XU91_LIPVE/147-277  AC A0A340XU91.1
#=GS A0A087X359_POEFO/162-292  AC A0A087X359.2
#=GS A0A670YCN8_PSETE/140-270  AC A0A670YCN8.1
#=GS A0A663N319_ATHCN/158-288  AC A0A663N319.1
#=GS A0A5G2QKD0_PIG/141-271    AC A0A5G2QKD0.1
#=GS A0A0M3QYB4_DROBS/271-401  AC A0A0M3QYB4.1
#=GS H3DGB8_TETNG/142-272      AC H3DGB8.1
#=GS A0A151M177_ALLMI/146-276  AC A0A151M177.1
#=GS A0A482X9Z2_LAOST/196-326  AC A0A482X9Z2.1
#=GS A0A433U8B4_ELYCH/171-302  AC A0A433U8B4.1
#=GS A0A6G1PXN1_9TELE/152-282  AC A0A6G1PXN1.1
#=GS H2XUX6_CIOIN/77-207       AC H2XUX6.1
#=GS A0A671FEJ5_RHIFE/147-277  AC A0A671FEJ5.1
#=GS A0A444UP80_ACIRT/161-291  AC A0A444UP80.1
#=GS G3NS41_GASAC/152-282      AC G3NS41.1
#=GS A0A099ZA42_TINGU/147-277  AC A0A099ZA42.1
#=GS G1NGL7_MELGA/157-287      AC G1NGL7.1
#=GS A0A6J2WFY8_CHACN/147-277  AC A0A6J2WFY8.1
#=GS A0A3Q0DXR4_CARSF/72-202   AC A0A3Q0DXR4.1
#=GS A0A673M255_9TELE/140-222  AC A0A673M255.1
#=GS A0A3B3HPU5_ORYLA/152-282  AC A0A3B3HPU5.1
#=GS A0A6I9ZM19_ACIJB/147-277  AC A0A6I9ZM19.1
#=GS A0A5A9NGN0_9TELE/140-270  AC A0A5A9NGN0.1
#=GS A0A485MXY9_LYNPA/147-277  AC A0A485MXY9.1
#=GS A0A3P9BRG2_9CICH/134-264  AC A0A3P9BRG2.1
#=GS A0A091DBQ3_FUKDA/147-277  AC A0A091DBQ3.1
#=GS G1U2U7_RABIT/147-277      AC G1U2U7.1
#=GS L5L0R8_PTEAL/147-277      AC L5L0R8.1
#=GS A0A2F0AU89_ESCRO/147-277  AC A0A2F0AU89.1
#=GS A0A6P7LE70_BETSP/151-281  AC A0A6P7LE70.1
#=GS A0A3L8SMW7_CHLGU/158-288  AC A0A3L8SMW7.1
#=GS B4NKW5_DROWI/272-402      AC B4NKW5.1
#=GS A0A671Z358_SPAAU/152-282  AC A0A671Z358.1
#=GS A0A091EEK7_CORBR/152-282  AC A0A091EEK7.1
#=GS B0W6A0_CULQU/258-388      AC B0W6A0.1
A0A6P7LET5_BETSP/150-280             ........k-RTCSLGVCQGPHVVLWSISCAPVVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPVLIMPMALSLALYSAVVQVSWAFGEWWQSVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A7E5W5N5_TRINI/276-406             .......md--ISKCSLYNGPHIFLFSLICIPFVACISALYSFYMGTMAWYNVFSHVTENFN..WIKKAVLAPIVILAYPFLIVIFTMGLGLYAGIVQLTFSAANWWKDVCDFEKGFYGWLCNTLGMSECSPYEVVVLMDV-k................................................
A0A060YVD9_ONCMY/55-186              .......sk-CSCGLGFFQGPHVILWSLLCAPLVFLIAFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMALSLALYSTLAQVSWVFSEWWLSVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A444SKL8_ARMVU/214-343             .......kp--KAKWSVRFGPHILLLSLIAFPFVGFISSLYSFYLGTLTWYSLLTRASE-ST..CLLKISLPPILILSYPFLIILFTLGLGIYASFAQVSLSFDSWFSQVSDPEKGFYGWLCSVLHVEECAPYETVVLMT--qp...............................................
A0A3P9NY52_POERE/152-282             ........k-RKCTLGVCQGPHVVLWSISCAPVVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPVLIMPLALSLALYSAVVQVSWAFSEWWLAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A091NEJ1_9PASS/154-284             .........KKKCDVGLDRGPHIVLWTIICLPIIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIISYPIIIMVVSFSLGLYSAVAQVAWSFGYWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A091QA83_LEPDC/147-277             .........KKKCDVGLDRGPHIVLWTIICLPIIFIVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGVYSAMAQVAWSFGYWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
E7F6S9_DANRE/142-272                 ........q-KPCALGLSQGPHVLLWSLSCSPFIFVLSFITSFYYGTLTWYNVFLVYNEERS..FLHKITLCPLLILLYPVLIMALCVCMGVYAAVSQLSWVFGEWWLAVRDLEKGFCGWMCGKLGLEDCAPYNVVELLDS-d................................................
A0A3Q3FTS7_KRYMA/133-263             ........k-RTCTLGVCEGPHVVLWSISCAPVVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPVLIMPLALSLALYSAVVQVSWAFSEWWQAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A6J2LCF0_9CHIR/147-277             ........r-KICPVAADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEECSPYSIVELLE--yd...............................................
A0A2Y9MM47_DELLE/146-276             ........r-KACQLGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A671PMR5_9TELE/157-285             .......sc--SCGFGLSQGPHAVLWSLSCAPVVFVLSFITSFYYGTLTWYNIFLVYNEERT..FCHKITVCPFLIIFYPGLIVA--LSLGLYLAVVQVSWAFSEWWLSVRDLEKGFCGWVCGKLGLEDCSPYSVVELLDS-d................................................
A0A6J1NVL3_BICAN/274-404             .......md--VSKCSLYNGPHIFLFSLLCIPFVACISAMYSFYMGTMAWYNIFTHVTEDFS..CIKKVFLAPIVILSYPFMIVIFTIGLGLYAGIAQLTFSGANWWKDVCDFEKGFYGWLCNTLGMSECSPYEVVVLMDV-k................................................
A0A2I2V108_FELCA/147-277             ........r-KACQMGVDRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A6I8P5C0_ORNAN/156-286             .......rp--ACPLGPDRGPHVLLWTVACLPVVFVLAFVVSFYYGTLTWYSVFLVYNEERA..FWHKVSCCPCLVLCYPPLIVALAGSLGLYAALAQLAWSWGAWWRAARDLEKGFCGWLCGRLGLDRCAPYSVVELLDA-t................................................
A0A5E4C979_MARMO/56-186              ........r-KACQMGADRGPHVVLWTLVCLPVVFVLSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A384AKT5_BALAS/147-277             ........r-KACQLGADRGPHVVLWTLACLPVVFILSFVVSFYYGTITWYSIFLVYNEERT..FWHKISCCPCLILLYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
H0WPW5_OTOGA/147-277                 ........r-EACQVGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKVSYCPCLVLFYPVLIMAMASALGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A6J2V705_CHACN/143-273             ........r-RSCALGLGQGPHVLLWSLSCSPFIFVLSFITSFYYGTLTWYNVFLVYNEERT..FLHKVTMCPLLILTYPVLIMVLCVCMGLYAAGAQLSWVFSEWWQAVKDLEKGFCGWLCGKLGLEDCAPYSVVELLDS-d................................................
A0A6P8QXA7_GEOSA/150-280             .........KKTCEVGLEKGPHVLLWSIFCIPVVFVLSFIMSFYYGTITWYNIFLVYNEERT..FWHKIIVCPFLIIFYPIIIMALSLSLGLYTAVTQISWSFMEWWHTVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
J9NSU3_CANLF/147-277                 ........r-KACQMGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A6J3DA61_AYTFU/158-288             .........KKKCDVGLDRGPHIILWTIVCLPVIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVTQVSWSFADWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A6J0XS50_ODOVR/147-277             ........r-EACQLGADRGPHVVLWTLVCLPVVFLLSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWEAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A212EJ21_DANPL/276-406             .......md--VSKCSLYNGPHIFIFTLICIPFVAIISATYSFYIGTMAWYNIFTHVTEDFS..CIKKVFFAPLVILSYPFLIVIFTVILGLYAGIAQLTFSGTNWWKDVSDFEKGFYGWLCNSLGMSECSPYEVVVLMDV-k................................................
A0A1S3K8E1_LINUN/108-238             .......ge--CTLCGLKKGIHVFLFTVIVTPFAFFGSLGLSFYLGAQTWYNIFIYFSEERT..IWHKVFLCPLLILTFPLTVGLSALGIALYAALIQISWWFKSWLKEMRDLEKGFFGWFCAKVDLMECSPYEVVVLDD--ip...............................................
A0A4W4H5L4_ELEEL/147-277             ........k-RPCRFGVCQGPHVVLWSLSCIPVVFVLSFIASFYYGTLTWYNVFLVYNEERM..FWHKVTICPCLIVFYPALIMVMSLSLALYSAVVQVSWAFSEWWGSAKDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A6J0UJQ8_9SAUR/158-288             ........k-NTCAVGLDKGPHVFLWSLACLPVIFVMSFVVSFYYGTITWYNVFLVYNEERT..FWHKITFCPFLIIFYPIIIMAVSFSLGLYTALTQISWAFGDWWHAVRDMEKGFCGWLCSKMGLEDCSPYSIVELLDS-d................................................
L8IIW0_9CETA/147-277                 ........r-KACQLGADRGPHVVLWTLVCLPVVFLLSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILCYPVLIMAMASSLGLYAAVVQLSWSWEAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A553NA28_9TELE/165-295             ........q-KPCSLGLCQGPHVLLWSISCSPFIFVLSFITSFYYGTLTWYNVFLVYNEERS..FLHKITVCPLLILTYPVLIVGLCFGLGVYTAVTQLSWVFGEWWLAVRDLEKGFCGWMCGKLGLEDCAPYNVVELLDS-d................................................
A0A452QGZ5_URSAM/148-278             ........r-KACQMGADRGPHVVLWTLVCLPVVFVLSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
B4GLD0_DROPE/275-405                 .......sl--CCTCSCAIGLHIFLISLLCLPFVTIISAVYSFYIGTLTWYNMFNYYCEEKS..YLHKIFVTPLLFLAYPLAIVLCTFGLGLYSGFRQLSLQYSSWVNDITDIEKGFYGWLCGFLHMPDCSPYEVVILTDI-c................................................
Q9VGV1_DROME/275-405                 .......nl--CCTCSCGTGLHILLISLFCLPFVTVVSAVYSFYIGTLTWYNMFNYYCEERT..YLHKILVTPLLFVIYPLAIVLCTFGLGIYSGLRQLSLQYSSWVNDITDIEKGFYGWLCGFLRMPDCSPYEVVILTDI-c................................................
A0A674HXH9_TERCA/147-277             .........KKTCDVGLDRGPHILLWSIICLPIIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPLLIIFYPVIIMVMSFFLGLYTAVTQIAWSFGGWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
V4A081_LOTGI/41-170                  ........k-DKCGCGLNQGPHIVLFSVIFIPIAWVMSLGMAFYMGVITLYNIYLYFSEERT..IWHKITVCPILVLTFPFTVGLCAIGIAFYSCIVQVSWRYKSWLREVFDFEKGFYGWLCLKLDLPHCAPYDVVILDE--s................................................
A0A6P5LQW6_PHACI/147-277             .........KKACQIGADRGPHVVLWTVICLPVIFVLSFIVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAVASSLGLYAAIAQXSWSWGAWWLAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A2G8KDC1_STIJA/18-148              .ssrwaftg--------SSGPHIVLLSICCSPLVFTCAVFYNAYLGVLTWYNIFLHFYDEKT..FLHRVTLCPLLIFIFPPALLLAVLVISVYTAVKQISWDIYRWKYDVCDLERGAYAKLCLKIGLQQCCPYETVIMQ---tde..............................................
A0A452GYL0_9SAUR/158-288             .........KKTCDIGMDRGPHVLLWSIICLPVIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPLLIIFYPVIIMVMSFFLGLYTAVTQIAWSFGGWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A6P4XJ43_BRABE/164-294             ........k-DDCIWGINKGIHIFIWSVLCFPVVFVIAFFVAFYYGTITWYNIFLHYNEERT..FLHKVSICPLLILFYPILIVVVSLGLGGYSAFVQLSWYCDSWREDVGDFEKGFFGWMCSKLRLDSCSPYDVVELTT--pe...............................................
A0A6L2Q294_COPFO/344-474             .....sswf----SCGPKKGPHITVWTALCLPFAVAISGVYSFYMGTITWYNVFTYYTDEKP..ILCRILVSPFLILLYPFLILIFTVGLGLYAGIVQISWFLDSWYKEITDLEKGFYGWLCAALKHEDCSPYEVVVLTDI-q................................................
A0A0L8HB75_OCTBM/89-218              .......ss--PCSWGLHSGLHIVFLSIICIPLAWLVSLGYSFYIGCNTWYNIYLYFSEEKT..IWHKISICPVLILTFPFTVGLSSLIISLYASVIQISWNFYKWLQEFQDYEKGFYGWFCNWIGLHQCCPYEVVIL----dcp..............................................
A0A1L8ENL2_XENLA/160-290             .....kkry----STGWDRGPHIVLWSLLCLPVVFVLSFVLSFYYGTITWYNIFLVYNEERT..FWHKITVCPFLIIFYPIIIMVVSLSLALYTAVTQISWSFEEWWQAVRDMEKGFCGWICSKLGLEDCSPYSIVELLDS-d................................................
A0A6P6Q1H6_CARAU/140-270             .......sr--SCGLGLSQGPHVVLWSLSCAPFVFVLSFITSFYYGTLTWYNIFLVYNEERT..FCHKITVCPFLIIFYPVLIVALSLSLGLYSAVVQVSWAFSEWWLSVRDLEKGFCGWACGKLGLEDCSPYSVVELLDS-d................................................
A0A1U7SDU7_ALLSI/157-287             .........KKTCNVAVDRGPHVLLWSIVCLPVIFVVSFVISFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMAVSFSLGLYTAVTQIAWSFGDWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A2Y9FHP7_PHYMC/147-277             ........r-KACQLGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A3Q4HEH1_NEOBR/131-261             ........k-RTCSLGVCQGPHVVLWSISCAPVVFILSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPLALSLALYSAVVQVSWAFSEWWQAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A2K6MCL5_RHIBE/147-277             ........r-MACHVGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A2I2Y3U3_GORGO/89-219              ........r-MACQMGADRGPHVVLWTLICLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLVLFYPVLIMAMASSLGLYAAVVQLSWSWEAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A6P6KLP5_CARAU/148-278             ........r-RSCGFGLSQGPHVVLWSLSCAPFVFVLSFITSFYYGTLTWYNIFLVYNEDRT..FCHKITVCPFLIVFYPGLIVALALSLGLYSAVVQVSWVFSEWWLSVRDLEKGFCGWACGKLGLEDCSPYSVVELLDS-d................................................
A0A2J7RCL2_9NEOP/248-378             .....sswl----TCGPKNGPHVMIWTALCFPFAVVISGVYSFYMGTITWYNVFTYYTEEKP..ILCRILVSPFLILLYPFLIIIFTIGLGLYAGIVQMSWYLDSWYKEITDLEKGFYGWLCATLKHEDCSPYEVVVLTEI-q................................................
F6Y0R9_XENTR/160-290                 .....kksy----STGWDRGPHIVLWSLLCLPVVFVLSFVLSFYYGTITWYNIFLVYNEERT..FWHKITVCPFLIIFYPIIIVAVSVSLALYTAVTQVSWSFEEWWHAVRDMEKGFCGWICSKLGLEDCSPYSIVELLDS-d................................................
A0A2P4SXK3_BAMTH/55-185              .........KKKCDVGLDRGPHIVLWTIICLPIIFIVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVTQVSWSFGDWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A2K5VI40_MACFA/147-277             ........r-MACQVGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A6J2TKV2_DROLE/266-396             .......nl--CCVCSCGIGLHILLLSLLCLPFVVVISAVYSFYIGTLTWYNMFNYYCEEKS..YLHKIFVTPILILAYPLAIVLCTFGLGLYSGFRQLSLQYSSWVNDITDIEKGFYGWLCGFLQMSDCSPYEVVILTDI-c................................................
A0A0P7UGE4_SCLFO/157-287             ........k-SSCGLGLSQGPHVVLWSLSCVPVVFLLSFVTSFYYGTLTWYNVFLVYNEERT..FCHKVTVCPFLIIFYPVLIMAVSLSLGLYAAVVQVSWVFSRWWGAVRDLEKGFCGWVCGKLGLEDCSPYSVVELLDS-d................................................
M3YYF0_MUSPF/148-278                 ........r-KACQMGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A5B7INE3_PORTR/38-131              .....kpkp----RCSQRYGPHITLLSLICFPFVFLVSSGYSFYLGTLTWYRVP--------..------------------------------------------------------------------------------sismmslppntpqyylsalvtvmvrgsvapllfhshhlwsvfplvcgly
A0A341CXP2_NEOAA/147-277             ........r-KACQLGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A3P8XZ32_ESOLU/156-286             ........k-RSCGFGFYQGPHVILWSISCAPVVFLLAFITSFYYGTLTWYNVFLVYNEERT..FWHKVTICPFLIIFYPLLIMPVALSLALYSALAQVSWAFSEWWLSVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
R0J9G8_ANAPL/147-277                 .........KKKCDVGLDRGPHIVLWTIICLPVIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVTQVSWSFADWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A3B0JR97_DROGU/278-408             .......sl--CCTCSCAIGLHIFLISLLCLPFVTIISAVYSFYIGTLTWYNMFNYYCEEKS..YLHKIFVTPLLFLAYPLAIVLCTFGLGLYSGFRQLSLQYSSWVNDITDIEKGFYGWLCGFLHMPDCSPYEVVILTDI-c................................................
A0A6I9K0A3_CHRAS/146-276             ........g-NVCQMGADRGPHVVLWTLVCLPVVFVLSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLVLFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A5B7CIB9_PORTR/236-286             ....ghsid-----------------------------------------------------..--------------------------------VKISLSYDSWWSEISDPEKGFYGWLCSLLHVEECAPYETVVLMT--ep...............................................
A0A668V5L3_OREAU/152-282             ........k-RTCSLGVCQGPHVVLWSISCAPVVFILSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPLALSLALYSAVVQVSWAFSEWWQAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
Q6NU88_XENLA/161-291                 .....kksy----STGWDRGPHIVLWSLLCLPVVFVLSFVLSFYYGTITWYNIFLVYNEERT..FWHKITVCPFLIMFYPIIIVVVSLSLALYTAVTQISWSFEEWWHAVRDMEKGFCGWICSKLGLEDCSPYSIVELLDS-d................................................
A0A2K6CFT0_MACNE/147-277             ........r-MACQVGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A3P8VQN2_CYNSE/136-266             ........k-RTCSLGVSQGPHIVLWSLSCAPVVFFLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIVFYPVLIMPMAVSLALYSAVVQVSWAFSEWWHAVRDLEKGFCGWACGKIGLEDCSPYSIVELLDS-d................................................
G3T5T9_LOXAF/147-277                 ........r-KVCQVGADRGPHVVLWTLVCLPVVFVLSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A6I9I9Y1_VICPA/147-277             ........r-KACQLGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYTIVELLES-d................................................
A0A3Q3EAD8_9LABR/152-282             ........k-RSCGLGVCQGPHVVLWSISCAPLVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMALSLALYSAVVQVSWAASEWWQVVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A3Q0H683_ALLSI/157-287             .........KKTCNVAVDRGPHVLLWSIVCLPVIFVVSFVISFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMAVSFSLGLYTAVTQIAWSFGDWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A2Y9I598_NEOSC/148-278             ........r-KACQMGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A671T3X5_9TELE/140-270             ........q-NPCALGVSQGPHVLLWSLSCSPFIFLLSFITSFYYGTLTWYNVFLVYNEERS..FLHKITVCPLLILLYPVLIMTLCVCMGVYAAVTQLSWVFGEWWLAVRDLEKGFCGWMCGKLGLEDCAPYNVVELLDS-d................................................
A0A6P8Z8I0_DROAB/279-409             .......nl--CCTCSCGIGLHIFLISLLCLPFVTIISAVYSFYIGTLTWYNMFNYYCEEKS..YLHKIFVTPVLFLAYPLVIILCTFGLGLYSGFRQLSLQYSSWVNDITDIEKGFYGWLCGFLHMPDCSPYEVVILTDI-c................................................
A0A3Q7Q7V2_CALUR/148-278             ........r-KACQMGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
B4QUM5_DROSI/275-405                 .......nl--CCTCSCGTGLHILLISLFCLPFVTVVSAVYSFYIGTLTWYNMFNYYCEERT..YLHKILVTPLLFVIYPLAIVLCTFGLGIYSGLRQLSLQYSSWVNDITDIEKGFYGWLCGFLRMPDCSPYEVVILTDI-c................................................
A0A553NU28_TIGCA/430-559             ........h-DRCFCGLQRGIHIFLFSLVCLPLFWVVATWQAFYLGTLTWYNIFIYYNEDRT..CCHKL-LSPFVLLAYPLWIIPITVLVGLFGGLYQISWYFDSWCTAIAALDGGFFGWFCNWLDVPDCCPYQVILLS---and..............................................
A0A672T9H6_SINGR/139-269             ........q-NPCALGVSQGPHVLLWSLSCSPFIFLLSFITSFYYGTLTWYNVFLVYNEERS..FLHKITVCPLLILLYPVLIMTLCVCMGVYAAVTQLSWVFGEWWLAVRDLEKGFCGWMCGKLGLEDCAPYNVVELLDS-d................................................
A0A0Q3PT46_AMAAE/157-287             ........x-KKCDVGLDRGPHIVLWTIXCLPIIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFXPFLIIFYPIIIMVVSFSLGLYSAVAQVAWSFGYWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
H2ZK06_CIOSA/101-186                 .......ss--GCRCGVDSGPHIFLLGILCLPFIFIGSFCVCFYFGLLTWYNIFSYFYDEKS..ICYRITLCPLLVIFFPILIMLFTLGISFYAAF----------------------------------------------v................................................
A0A182GV59_AEDAL/252-382             ........n-CCCQCTLRAGIHILLLSIICLPIVTLTTSIYSFYIGTVTWYNMFTYFNEEKS..YLHKLFMSPLLILAYPLAIVLCTVGLGIYAGFRQVSLHFTAWVNEISDIEKGFYGWLCSFLHLSDCSPYEVVILTDI-c................................................
G5C2J8_HETGA/146-276                 ........r-KACQVGADQGPHVVLWTLVCLPVVFILSFIVSFYYGTITWYNIFLVYNEERT..FWHKVSYCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A444T043_ARMVU/73-169              .......kp--KAKWSVRFGPHILLLSLIAFPFVGFISSLYSFYLGTLTWYSLLTRASE-ST..CLLKISLPPILILSYPFLIILFTLGLGIYASFAQLR------------------------------------------ekkplnnis........................................
A0A315W5C0_GAMAF/152-282             ........k-RKCTLGVCQGPHVVLWSISCAPVVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPVLIMPLALCLALYSAVVQVSWAFSEWWLAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A2U3XUH2_LEPWE/148-278             ........r-KACQMGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A6P7SBH2_OCTVU/89-218              .......ss--PCSWGLHSGLHIVFLSIICIPIAWLVSLGYSFYIGCNTWYNIYLYFSEEKT..IWHKISICPVLILTFPFTVGLSSLIISLYAPIIQISWNFYKWLQEFQDYEKGFYGWFCNWIGLHQCCPYEVVIL----dcp..............................................
A0A672QIQ4_SINGR/141-271             .......sr--SCGFGLSQGPHVVLWSLSCAPVVFVLSFITSFYYGTLTWYNIFLVYNEERT..FCHKITVCPFLIIFYPGLIVALSLSLGLYSAVAQVSWAFSEWWLSVRDLEKGFCGWACGKLGLEDCSPYSVVELLDS-d................................................
A0A4W4EQW9_ELEEL/109-239             .......we--ACSVGAGQGPHVLLWSLSCFPVVFLLSFVISFYYGTLTWYNIFLVYNEERT..FLHKIVVCPLLVLSYPVLMTALCACVGAYAAAAQLSWSISEWWQAMADLEKGACGWACGKLGLEDCAPYSVVELLDS-d................................................
Q7QD12_ANOGA/259-389                 ......ser---SCCTLRTGVHILLLSLVCLPFVTLTTGIYSFYMGTVTWYNMFTYFNEERS..YCHKLLMSPLLILAYPLGIVLCTVGLALYAGIRQISFHFRAWLNEIADIEKGFYGWLCSFLHLSDCSPYEVVILTDI-c................................................
A0A0D9R9S6_CHLSB/147-277             ........r-MACQVGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A3B1J351_ASTMX/148-278             ........k-RSCGLGFCQGPHVVLWSLSCAPIVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMVVSLSLGLYSAVVQVSWAFSEWWLSVKDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A5J5D0M8_9PERO/151-276             ........k-RNCGLGVCQGPHVVLWSIS-----FLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMALSLALYSAVVQVSWAFSEWWQAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A3Q1CYB9_AMPOC/133-263             ........k-RTCGFGVCQGPHVVLWSISCAPVIFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMALSLALYSAVVQVSWAFSEWWLSVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A6I8URV1_DROPS/275-405             .......sl--CCTCSCAIGLHIFLISLLCLPFVTIISAVYSFYIGTLTWYNMFNYYCEEKS..YLHKIFVTPLLFLAYPLAIVLCTFGLGLYSGFRQLSLQYSSWVNDITDIEKGFYGWLCGFLHMPDCSPYEVVILTDI-c................................................
A0A401Q925_SCYTO/56-186              .........KKACDLGLYRGPHVVLWTLLCAPVVFVLSFVMSFYYGTITWYNIFLVYNEERT..FWHKITICPFLIIFYPVLIVVMSVSLSVYTSVTQISWSFGEWWQAVRDLEKGFCGWLSAKLGLEDCSPYSIVELLDS-d................................................
A0A672M8T0_SINGR/140-270             ........q-KPCALGVSQGPHVLLWSLSCSPFIFLLSFITSFYFGTLTWYNVFLVYNEERS..FLHKITVCPLLILLYPVLIMALCVCMGVYAAVTQLSWVFGEWWLAVRDLEKGFCGWMCGKLGLEDCAPYNVVELLDS-d................................................
A0A084VE31_ANOSI/262-391             .....gqdc-----CTLRTGVHILLLSLVCLPFVTLTTGIYSFYMGTVTWYNMFTYFNEERS..YFHKLLMSPLLILAYPLCIVLCTIGLALYAGFRQISFHFRAWLNEVSDIEKGFYGWLCSFLHLSDCSPYEVVILTDI-c................................................
A0A669BAB0_ORENI/150-280             ........k-RTCSLGVCQGPHVVLWSISCAPVVFILSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPLALSLALYSAVVQVSWAFSEWWQAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A096LYU2_POEFO/144-274             ........r-RKCTLGVCQGPHVVLWSISCAPVVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPVLIMPLALSLALYSAVVQVSWAFSEWWLAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
T1JJW6_STRMM/154-284                 .......nr--KTQWSFHRGFHIIFLSILSCPLAAILSGSYSFYLGTLTWYNFYLFYNEERT..IWHKIFVCPLLLFLYPFLIVLSTLGLAIFGAVSQISWNFDRWLAEFQDYEKGFFGWFCGIVGLDDCAPYEVIILNES-s................................................
U3JMY0_FICAL/158-288                 .........KKKCDVGLDRGPHIVLWTIICLPIIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVAQVAWSFGYWWRAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
B4HIN1_DROSE/275-405                 .......nl--CCTCSCGTGLHILLISLFCLPFVTVVSAVYSFYIGTLTWYNMFNYYCEERT..YLHKILVTPLLFVIYPLAIVLCTFGLGIYSGLRQLSLQYSSWVNDITDIEKGFYGWLCGFLRMPDCSPYEVVILTDI-c................................................
A0A7N8WM51_9TELE/151-281             ........k-RNCRLGVCQGPHVVLWSISCFPVVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMALSLALYSAVVQVSWAFSEWWQAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A2R9CHJ7_PANPA/147-277             ........r-MACQMGADRGPHVVLWTLICLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLVLFYPVLIMAMASSLGLYAAVVQLSWSWEAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
W5QDJ2_SHEEP/147-277                 ........r-KACQLGADRGPHVVLWTLVCLPVVFLLSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWEAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
B4GLH3_DROPE/6-136                   ........q-KGCTCSCAIGLHIFLISLLCLPFVTIISAMYSFYIGTLTWYNMLNYYCEEKS..YLHKIFVTPLLFLAYPLAIVLCTFGLGLYSGFRQLSLQYSSWVNDITDIEKGFYGWLCGFLHMPDCSPYEVVILTDI-c................................................
G7N8V0_MACMU/147-277                 ........r-MACQVGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A2K5NQS9_CERAT/147-277             ........r-MACQVGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A6J2HST7_9PASS/158-288             .........KKKCDVGLDRGPHIVLWTIICLPVIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVAQVAWSFGYWWRAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
W5MU45_LEPOC/161-291                 ........k-RSCRVGVGQGPHVVLWSLSCAPVVFLLSFVTSFYYGTITWYNVFLVYNEERT..FWHKIIVCPFLIIFYPILIMVVSLSLGLYTAITQVSWAFGEWWVAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A663DUL9_AQUCH/158-288             .........KKKCDVGLDRGPHIVLWTIICLPIIFVLSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVAQVAWSFGYWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A6P9CDK1_PANGU/53-183              .........KKACEVGIDKGPHVLLWSLACLPIIFIMSFIVSFYYGTITWYNVFLVYNEERT..FWHKITFCPFLIIFYPIFIMVVSFSLGVYTAITQVSWAFGDWWHAVRDMEKGFCGWLCSKVGLEDCSPYSIVELLDS-d................................................
A0A5E4CB44_MARMO/31-161              ........r-KACQMGADRGPHVVLWTLVCLPVVFVLSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
E1C4T0_CHICK/157-287                 .........KKKCDVGLDRGPHIVLWTIICLPIIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVTQVSWSFGDWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A3M0L0Y9_HIRRU/158-288             .........KKKCDVGLDRGPHIILWTIICLPIIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVAQVAWSFGYWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A6J2J8L4_BOMMA/233-301             yltmtgtik-----------------------------------------------------..------------------RVIFTIGLGLYAGIVQLTFSAGNWWKDVCDFEKGYYGWLCNMLSLSECSPYEVVVLMDV-k................................................
A0A6I9VRY7_BACDO/251-381             .......nl--CCTCTPKTGLHILILSLICLPFITVISSIYSFYIGTLTWYNMFNYFNEEKS..CIYKFFMSPILILAYPVGILVCTLGLGLYSGIAQLSLQLNSWLNEVADIEKGFYGWLCSFLHLSDCSPYEVVILMDI-q................................................
S4RHY9_PETMA/170-300                 ........h-SRCRCGLNHGPHASLWSLLCLPFAFVASLVVAFYYGTITWYNVFLVYNEQRT..FWHKVTLCPLLMLLYPLLIAVTSLSLAAYAAVAQLSWSFTAWWGAVSDPEKGFFGWLCSHLGLEECAPYSIVELIES-g................................................
A0A6P3F8W8_OCTDE/147-277             ........r-KACQVGADQGPHVVLWTLVCLPVVFILSFIVSFYYGTITWYNIFLVYNEERT..FWHKVSYCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
M7AQ08_CHEMY/111-241                 .........KKTCDVGLDRGPHVLLWSIICLPVIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPLLIIFYPVIIMVMSFFLGLYTAVTQIAWSFGGWWHAVSDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A226PPK7_COLVI/157-287             ........k-KRCDVGLDRGPHVVLWTIVCLPVIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVTQVSWSFGDWWRAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A643CHD5_BALPH/147-277             ........s-KACQLGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A194PLI3_PAPXU/277-407             .......md--VSKCSLYNGPHIFIFSLLCIPFVTLISAAYSFYIGTLAWYNIFTHVTENFS..WIKKAIFAPMVILSYPFLIVVFTIGVGLYAGIVQLTFSGANWWKDVCDFEKGFYGWLCNFLGMSECSPYEVVVLMDV-k................................................
A0A2I0UKL6_LIMLA/158-288             .........KKKCDVGLDRGPHIVLWTIICLPIIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVAQVAWSFGYWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A3Q1GXT7_9TELE/153-283             ........k-RTCGFGVCQGPHVVLWSISCAPVIFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMALSLALYSAVVQVSWAFSEWWLSVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A182H6H0_AEDAL/252-382             ........n-CCCQCTLRAGIHILLLSIICLPIVTLTTSIYSFYIGTVTWYNMFTYFNEEKS..YLHKLFMSPLLILAYPLAIVLCTVGLGIYAGFRQVSLHFTAWVNEISDIEKGFYGWLCSFLHLSDCSPYEVVILTDI-c................................................
A0A6P3VR80_CLUHA/140-270             ........r-RSCTVGPGQGPHVLLWSLSCLPVVFLLSFITSFYYCTLTWYNVFLVYNEERT..FLHKVTLCPVLILVYPPLIVVLSLGMGVYAAVAQLSWVFAEWWLAVRDLEKGFCGWACGKLGLEDCAPYSVVELLDS-d................................................
A0A7E4SEK4_CIMLE/129-259             ....ekrrp-----CTLYSGPHVTLFTVLCFPVAFIMSSLYSFYMGTITWYSIFTYVTEEKN..IVYKLFISPFLILLYPFIIVAFTLGLGTYAAFVQVSWSFSSWQKEILDWEKGFYGWLCSVMKLEECSPYEVVVLTDI-k................................................
A0A3S2MF93_ORYJA/151-281             ........k-RNCTLGVGRGPHVILWSISCAPIVFVLAFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMAVFLALYSAVVQVSWAFSEWWLSVKDLEKGFCGWACGKLGLEDCSPYSVVELLDS-d................................................
A0A2K6V171_SAIBB/146-276             ........r-MACQMGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A5F8HJK2_MONDO/148-278             .........KKTCQIGADRGPHVVLWTVVCLPVVFVLSFIVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAVASSLGLYAAVAQLSWSWGAWWLAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A2I0MGD5_COLLI/157-287             .........KKKCDVGLDRGPHIILWTIICLPVIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVAQVAWSFGYWWRAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A3Q1JHA9_ANATE/152-282             ........k-RSCSLGVCQGPHVVLWSISCAPVIFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMALSLALYSAVVQVSWAFSEWWQSVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A5A9P027_9TELE/139-269             .......rr--PCALGISQGPHIVLWSLSCAPVVFVLSFITSFYYGTLTWYNVFLVYNEERT..FCHKITICPFLIVFYPVLIMPLALTLGLYSAVVQVSWAFSEWWISVRDLEKGFCGWACGKLGLEDCSPYSVVELLDS-d................................................
I3M7Y3_ICTTR/147-277                 ........r-KACQMGADRGPHVVLWTLVCLPVVFVLSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
W5KWK1_ASTMX/171-301                 ........n-AVCQLEAGRGPHVLLWTLSCSPFVFLVAFVTSFYYGTLTWYNIFLVYNEERS..FMHKVLVCPLLVLCYPLLMVLLCVGVAAYAAATQLSWSIAAWWQAVADLEKGVCGWACGKLGLEDCAPYSVVELLDS-d................................................
A0A093PTS6_9PASS/154-284             .........KKKCDVGLDRGPHIVLWTIICLPVIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVAQVAWSFGYWWRAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A210PVV1_MIZYE/106-236             ....essef-----IGKKSGPHVVLFSVICIPAAFIASMCVAFYYGASSWYNLYIYFSEEKS..IWHKVSICPVLILTFPFTVGLSSIGVAFFAAFVQLSWFYLSWHAEFLDFEKGFYGWLCNKIGLPQCCPYELIILNN--es...............................................
H3A7V9_LATCH/162-292                 ........k-RACEVGLDRGPHIVLWSLLCAPVILVFSFVMSFYYGTITWYNIFLVYNEERT..FWHKITICPFLIIFYPIIIVVVSLSLGLYTTVTQVSWSFGEWWQAVRDLEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
D4ACP3_RAT/147-277                   ........r-RACQVGADQGPHVVLWTLVCLPVVFVLSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWAAWWRAACDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A5N4E7P4_CAMDR/147-277             ........r-KACQLGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYTIVELLES-d................................................
A0A384C1J2_URSMA/148-278             ........r-KACQMGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
B4LZX3_DROVI/271-401                 .......nl--CCTCSCGVGLHIFLISLICLPFVTIVSAIYSFYIGTLTWYNMFNYYCEEKS..YVHKIFVTPILFLAYPLAIVLCTFGLGLYSGFRQLSLQYSSWVNDITDIEKGFYGWLCGFLHMPDCSPYEVVILTDI-c................................................
A0A093H7P9_STRCA/147-277             .........KKTCDVGLDRGPHIILWTIVCLPIVFVASFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVAQLTWSFGDWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A4Z2J3L4_9TELE/152-282             ........k-RNCSLGVCQGPHVVLWSLSCAPVIFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMALSLALYSALVQVSWAFSEWWQDVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A3Q2EDM3_CYPVA/212-342             ........k-RNCTLGVCQGPHVVLWTISCAPVVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPVLIMPVALSLALYSAVVQVSWAFSEWWQVVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A6P7HGZ6_9TELE/152-282             ........k-RTCSLGVCQGPHVVLWSISCAPVVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMALSLALYSAVVQVSWAFSEWWQAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A2I2YI43_GORGO/102-232             ........r-MACQMGADRGPHVVLWTLICLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLVLFYPVLIMAMASSLGLYAAVVQLSWSWEAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A3S2LUE9_CHISP/280-410             .......md--ISKCSIYNGLHIFLFSLFCAPIVACISALYSFYMGTITWYNIFSHVTEELN..CFKKMLLSPIVILSYPFLIVIFTVGLGLYAGIVQLTFSGANWWKDVCDFEKGFYGWLCSTLGMSECSPYEVVVLMDV-k................................................
A0A5E4Q955_9NEOP/267-397             .......md--VSRCSMYNGPHIFLFSLLCVPFVACISAIYSFYIGTLAWYNIFSHVTEELS..CIKKSFLAPIVILTYPFLIVIFTVGLGLYAGIVQLTFSGGNWWKDVCDFEKGFYGWLCNALGISDCSPYEVVVLLDV-k................................................
A0A6P6KYD9_CARAU/140-270             ........q-KPCALGVSQGPHVLLWSLSCSPFVFFLSFITLFYYGTLTWYNVFLVYNEERS..FLHKITVCPLLILLYPVLIMTLCVCMGVYAALTQLSWVFGEWWLAVRDLEKGFCGWICGKLGLEDCAPYNVVELLDS-d................................................
A0A7N8YPL7_9TELE/143-273             ........k-RNCRLGVCQGPHVVLWSISCFPVVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMALSLALYSAVVQVSWAFSEWWQAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
TM169_MOUSE/147-277                  ........r-RACQVGADQGPHVVLWTLVCLPVVFVLSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMTMASSLGLYAAVAQLSWSWAAWWRAACDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A665WWF4_ECHNA/152-282             ........k-RTCSLGVSQGPHVVLWSISCAPVVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPVLIMPMALSLALYSAVVQVSWAFSEWWLAVRDLEKGFCGWACGKLGLEDCSPYSVVELLDS-d................................................
A0A6G1A7Y6_CROCR/147-277             ........r-KACQMGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A6P4F0K5_DRORH/274-404             .......nl--CCTCSCGTGLHILLISLFCLPFVTVISAVYSFYIGTLTWYNMFNYYCEERT..YLHKILVTPLLFVAYPLAILLCTFGLGIYSGVRQLSLQYSSWVNDITDIEKGFYGWLCGFLRMPDCSPYEVVILTDI-c................................................
A0A212D2X5_CEREH/147-277             ........r-EACQLGADRGPHVVLWTLVCLPVVFLLSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWEAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A3B1JGG4_ASTMX/133-263             ........n-AVCQLEAGRGPHVLLWTLSCSPFVFLVAFVTSFYYGTLTWYNIFLVYNEERS..FMHKVLVCPLLVLCYPLLMVLLCVGVAAYAAATQLSWSIAAWWQAVADLEKGVCGWACGKLGLEDCAPYSVVELLDS-d................................................
A0A2K5IFW4_COLAP/147-277             ........r-MACQVGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A6J1TR31_9SAUR/158-288             .........KKACEVGMDKGPHILLWSLACLPIIFIMSFIVSFYYGTITWYNVFLVYNEERT..FWHKITFCPFLIIFYPIFIMVVSFSLGVYTAITQVSWAFGDWWHAVRDMEKGFCGWLCSKVGLEDCSPYSIVELLDS-d................................................
A0A0L7L7Q4_9NEOP/199-328             .......md--ISKCSLRNGPHIFLFTMCCLPFVALVSAGYSFYIGTLAWYNIFLNLADTFT..-WKTILLLPIVVMLYPFLIVIFNIGIGLYAGIVQLTFSSVNWWMGVCDFEKGFYGWLCNAIGMSDCSPYEVVILMDV-k................................................
C3YL36_BRAFL/163-293                 ........k-DDCIWGINKGIHIFIWSVLCFPVVFVIAFFVAFYYGTITWYNIFLHYNEERT..FLHKVSICPLLILFYPILIVVVSLSLGGYSACVQLSWYCDSWREDVGDFEKGFFGWMCSKLRLDSCSPYDVVELTT--pe...............................................
A0A286Y371_CAVPO/146-276             ........g-KACQVGADQGPHVVLWTLVCLPVVFILSFIVSFYYGTITWYNIFLVYNEERT..FWHKVSCCPCLVLFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A672JKH2_SALFA/152-282             ........k-RNCGFGVCQGPHVVLWSISCAPVVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMALSLALYSAVVQVSWAFSEWWQAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
B4K5T4_DROMO/269-399                 .......nl--CCTCSCGVGLHIFLISLICLPFVTIISAAYSFYIGTLTWYNMFNYYCEEKS..YLHKIFVTPILFLAYPLAIVLCTFGLGLYSGFKQLSLQYSSWVNDITDIEKGFYGWLCGFLHMSDCSPYEVVILTDI-c................................................
H9JGH7_BOMMO/276-406                 .......md--ISKCSIRNGPHVFLFTLICIPFVTCISALYSFYMGTITWYNIFTHITENFS..CIKKVVLAPLIILCYPFLIVIFTIGLGLYAGIVQLTFSAGNWWKDVCDFEKGYYGWLCNMLSLSECSPYEVVVLMDV-k................................................
A0A0F8ALS0_LARCR/152-282             ........k-RNCSLGVCEGPHVVLWSVSCAPVVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMALSLALYSAVVQVSWAFSEWWQVVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A6I8W0X7_DROPS/6-136               ........q-KGCTCSCAIGLHIFLISLLCLPFVTIISAMYSFYIGTLTWYNMLNYYCEEKS..YLHKIFVTPMLFLAYPLAIVLCTFGLGLYSGFRQLSLQYSSWVNDITDIEKGFYGWLCGFLHMPDCSPYEVVILTDI-c................................................
A0A2U9C9U9_SCOMX/151-282             .......sk-CNCGLSWCQGPHVVLWSISCAPVVFLLSFITSFYYGTLTWYSVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMALSLALYSAVVQVSWAFSEWWEVVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
G3H3Z1_CRIGR/147-277                 ........r-RVCQVGADQGPHVVLWTLVCLPVVFVLSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILLYPVLIMAMASSLGLYAAVVQLSWSWGAWWRAACDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A6A5ETB8_PERFL/151-281             ........k-RNCSLGVCQGPHVVLWSLSCAPVIFLLAFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMALSLALYCAVVQVSWAFSEWWQAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
S7NLV9_MYOBR/72-202                  ........r-KVCQMSADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLE--yd...............................................
H9GFK9_ANOCA/158-288                 .........KKACQVGVDKGPHVLLWSFACLPVIFVMSFVVSFYYGTITWYNVFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYTALTQISWAFGEWWHAVRDMEKGFCGWLCSKMGLEDCSPYSIVELLDS-d................................................
A0A3Q7SN38_VULVU/147-277             ........r-KACQMGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A2K6ACF2_MANLE/147-277             ........r-MACQVGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A3Q7V6Q7_URSAR/148-278             ........r-KACQMGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A067QFN8_ZOONE/237-367             .....sswf----TCGQRKGPHITIWTVLCLPFVIAISCVYSFYMGTITWYNVFTYYTEEKP..ILCRILVTPFLILLYPFLILIFTIGLGLYAGIVQISWFFDSWYKEITDLEKGFYGWLCAALKHEDCSPYEVVVLTDI-q................................................
A0A182XV45_ANOST/260-390             ......tdr---SCCTLRTGVHILLLSLVCLPFVAFTTGIYSFYMGTVTWYNMFTYFNEERS..FCHKLLMSPLLILAYPLGIVLCTVGLALYAGIRQISVHFRAWLNEVSDIEKGFYGWLCSVLHLSDCSPYEVVILTEI-c................................................
A0A5N5SL10_9CRUS/360-407             ......ppf-----------------------------------------------------..---------------------------------RVSLSFDSWFSQVSDPEKGFYGWLCAVLHVEECAPYETVVLMT--qp...............................................
A0A4U5TZZ9_COLLU/93-223              ........k-RNCSLGVCEGPHVVLWSVSCAPVVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMALSLALYSAVVQVSWAFSEWWQVVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
G3VBS0_SARHA/148-278                 .........KKTCQIGADRGPHVVLWTVVCLPVIFVLSFIVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAVASSLGLYAAVVQLSWSWGAWWLAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A669PE30_PHACC/157-287             .........KKKCDVGLDRGPHIVLWTIICLPIVFVVSFVVSFYYGTITWYNVFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVTQVSWSFGDWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A484CVQ0_PERFV/174-253             .........---------------------------------------------------RT..FWHKITICPFLIIFYPMLIMPMALSLALYSAVVQVSWAFSEWWQAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A4C1VWJ8_EUMVA/291-349             ......glh-----------------------------------------------------..----------------------VFLLGLYAGIIQLSFSGSNWWKEVCDFEKGFYGWLCNFLGVSECSPYEVVVLMDV-k................................................
T1GIS9_MEGSC/194-322                 .........KSCCVCNLETGLHIFLFSFLCMPFVCLITSVYSFYIGTLTWYNMFTYFTEERS..YFHKLFLSPLIILLYPFMILLCTFGLGLYAGISQLSVKFSTWWNEVGDIEKGFYGWLCNFVNLSDCAPYEV-------nfkfs............................................
B3LZG4_DROAN/272-402                 .......sl--CCRCSCGVGLHILLISLLCLPFVTVISGVYSFYIGTLTWYNMFNYYCEERT..YLHKILVTPLLFAVYPLVIVLCTFGLGIYSGIRQLSLQYSSWVNDITDIEKGFYGWLCGFLRMPDCSPYEVVILTDI-c................................................
A0A5J5MI46_MUNRE/147-277             ........r-EACQLGADRGPHVVLWTLVCLPVVFLLSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWEAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A4U1FGD1_MONMO/147-277             ........r-KACQLGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A4W2E8W7_BOBOX/302-432             ........r-KACQLGADRGPHVVLWTLVCLPVVFLLSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILCYPVLIMAMASSLGLYAAVVQLSWSWEAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
D2GXF2_AILME/148-278                 ........r-KACQMGADRGPHVVLWTLVCLPVVFTLSFVVSFYYGTITWYNVFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A2Y9DL91_TRIMA/151-281             ........r-KVCQMGADRGPHVVLWTLVCLPVVFVLSFIVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILFYPVLIMAMASSVGLYAAVVQLSWSWEAWWQAARDMEKGFYGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A672VBA2_STRHB/158-280             .........KKKCDVGLDRGPHIVLWTIICFPIIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVAQVAWSFGYWWHAVRDMEKGFCGWLCSKLGVGHN------------sdpl.............................................
A0A6P4JB25_DROKI/275-405             .......sl--WCTCSCGTGLHILLISLLCLPFVTVISAVYSFYIGTLTWYNMFNYYCEERT..YLHKILVTPLLFVAYPLAIVLCTFGLGIYSGVRQLSLQYSSWVNDITDIEKGFYGWLCGFLHMPDCSPYEVVILTDI-c................................................
R7VK65_CAPTE/73-203                  ......ddg---GKCGIRKGPHIVLWTLIFCPLSFLSSIAVCFYVGTMCWYNIYLYLSEERS..IWHRMFLCPLLILFYPVLLISTLLPLALFAACKQVSWNLLSWLTEIRDYDKGFYGWLCNRLGLPECAPYEVVIIDDS-n................................................
A0A671PI01_9TELE/144-272             .......sc--SCGFGLSQGPHAVLWSLSCAPVVFVLSFITSFYYGTLTWYNIFLVYNEERT..FCHKITVCPFLIIFYPGLIVA--LSLGLYLAVVQVSWAFSEWWLSVRDLEKGFCGWVCGKLGLEDCSPYSVVELLDS-d................................................
A0A091FJ77_9AVES/147-277             .........KKKCDVGLDRGPHIVLWTIICLPIIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVVQVAWSFGYWWRAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A6I9N4E8_9TELE/152-282             ........k-RNCGLGVCQGPHVVLWSLSCAPVIFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMALSLALYSAVVQVSWAFSEWWQDVRDMEKGFCGWACGKLGLEDCSPYSIVELIDS-d................................................
A0A671NPA7_9TELE/78-208              ........q-KPCALGVSQGPHVLLWSLSCSPFIFLLSFITSFYYGTLTWYNVFLVYNEERS..FLHKITVCPLLILLYPVLIMALCVCMGVYAAVTQLSWVFGEWWLAVRDLEKGFCGWMCGKLGLEDCAPYNVVELLDS-d................................................
TM169_HUMAN/147-277                  ........r-MACQMGADRGPHVVLWTLICLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLVLFYPVLIMAMASSLGLYAAVVQLSWSWEAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A670JYU7_PODMU/158-288             .........KKTCEVGLSKGPHVLLWSLTCLPVIFIMSFVVSFYYGTIAWYNVFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYTAVTQISWAFGDWWHAVRDMEKGFCGWLCSKMGLEDCSPYSIVELLDS-d................................................
A0A5N5PDF2_PANHP/148-278             ........k-RSCGFGLDQGPHVVLWSLSCAPVIFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITVCPFLIISYPLIIMAVSLSLGLYSAVVQVSWVFSEWWFSVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A674HCJ1_TAEGU/158-288             .........KKKCDVGLDRGPHIVLWTIICLPIIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIISYPIIIMVVSFSLGLYSAVAQVAWSFGYWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A671PJ29_9TELE/149-277             .......sc--SCGFGLSQGPHAVLWSLSCAPVVFVLSFITSFYYGTLTWYNIFLVYNEERT..FCHKITVCPFLIIFYPGLIVA--LSLGLYLAVVQVSWAFSEWWLSVRDLEKGFCGWVCGKLGLEDCSPYSVVELLDS-d................................................
A0A1U7QMA7_MESAU/147-277             ........r-SVCQVGADQGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILLYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAACDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
F7IHX4_CALJA/147-277                 ........r-MACQMGADRGPHVVLWTLVCLPVVFVLSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
B4JGE5_DROGR/270-400                 .......nl--CCTCSCGVGLHIFLISLICLPFVTVISAIYSFYIGTLTWYNMFNYYCEEKS..YLHKIFVTPILFLAYPLAIFLCTIGLGLYSGFRQLSLQYSSWINDVTDIEKGFYGWLCGFLHMPDCSPYEVVILTDI-c................................................
A0A484GT41_SOUCH/147-277             ........r-KACQLGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A484BAJ9_DRONA/268-398             .......nl--CCTCSCGVGLHIFLISLICLPFVTIISAAYSFYIGTLTWYNMFNYYCEEKS..YLHKIFVTPILFLAYPLAIVLCTFGLGLYSGFKQLSLQYSSWVNDITDIEKGFYGWLCGFLHMSDCSPYEVVILTDI-c................................................
A0A3R7MQR9_PENVA/261-390             .....kpkp----SCSLRYGLHITLLSILCFPFVFLVSGAYSFYLGTLTWYSMLTRVTEAR-..CLPKITLPPLLILLYPFLIIVFTLGLGIYAACVQISISYDSWWCEVSDPEKGFYGWLCSLLHVEECAPYETVVLMT--ep...............................................
A0A2I4BWU4_9TELE/152-282             ........r-RSCTFGVCQGPHVVLWSLSCAPVVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITVCPFLIVFYPVLIMPLALSLALYSAVVQVSWAFSEWWQAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A673J404_9TELE/144-274             .......sr--SCGFGLSQGPHVVLWSLSCAPVVFVLSFITSFYYGTLTWYNIFLVYNEERT..FCHKITVCPFLIIFYPGLIVALSLSLGLYSAVAQVSWAFSEWWLSVRDLEKGFCGWACGKLGLEDCSPYSVVELLDS-d................................................
A0A667YPT2_9TELE/155-285             ........k-RTCSLGFGEGPHVVLWSLSCAPVVFLLSFVTSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMAVTLALYSAVVQVSWAFSEWWQAVRDLEKGFCGWACGKMGLEDCSPYSIVELLDS-d................................................
A0A402EUE6_9SAUR/155-285             .........KKACEVGLAKGPHILIWSLACLPVIFIMSFVVSFYYGTITWYNVFLVYNEERT..FWHKITFCPFLIIFYPIIIMVISCSLGLYTAVTQISWAFGDWWHAVRDMEKGFCGWLCSKMGLEDCSPYSIVELLDS-d................................................
A0A3P8TBW2_AMPPE/133-263             ........k-RTCGFGVCQGPHVVLWSISCAPVIFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMALSLALYSAVVQVSWAFSEWWLSVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A673TI44_SURSU/151-281             ........r-RACQMGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A287A9V5_PIG/146-276               ........r-KACQLGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A087VE81_BALRE/147-277             .........KKKCDVGLDRGPHIVLWTIICLPIIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVVQVAWSFGYWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A091I7I5_CALAN/147-277             .........KKNCDVGLDRGPHIVLWTIICLPVIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVAQVAWSFGYWWRVVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A2U3V4U1_TURTR/147-277             ........r-KACQLGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A1S3P151_SALSA/153-283             ........k-CSCGLGVFQGPHVILWSLLCAPLVFLIAFVTSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIVFYPMLIMPMALSLALYSTLAQVSWVFSEWWLSVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A3Q2WKS5_HAPBU/150-280             ........k-RTCSLGACQGPHVVLWSISCAPVVFILSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPLALSLALYSAVVQVSWAFSEWWQAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
M4AMI0_XIPMA/152-282                 ........k-RKCTLGVCQGPHVVLWSISCAPVVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPVLIMPLALSLALYSAVVQVSWAFSEWWLAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A6P6QCM1_CARAU/140-270             ........e-KPCALGVSQGPHVLLWSLSCSPFIFLLSFITSFYYGTLTWYNVFLVYNEERS..FLHKITVCPLLILFYPVLIMTLCICMGVYAAVTQLSWVFGEWWLAVRDLEKGFCGWMCGKLGLEDCAPYNIVELLDS-d................................................
A0A7E5W504_TRINI/276-396             .......md--ISKCSLYNGPHIFLFSLICIPFVACISALYSFYMGTMAWYNVFSHVTENFN..WIKKAVLAPIVILAYPFLIVIFTMGLGLYAGIVQLTFSAANWWKDVCDFEKGFYGWLCNTLGMSECSP----------.................................................
A0A6J3HVW4_SAPAP/147-277             ........r-MACQMGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A6I9HB78_GEOFO/158-288             .........KKKCDVGLDRGPHIVLWTIICLPIIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIISYPIIIMVVSFSLGLYSAVAQVAWSFGYWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A4X2K3H5_VOMUR/147-277             .........KKACQIAADQGPHVVLWTVICLPVIFVLSFIVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAVASSLGLYAAVAQLSWSWGAWWLAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A401RUG5_CHIPU/170-300             .........KKACDVGLHRGPHVVIWSLVCAPVVFVLSFVMSFYYGTITWYNIFLVYNEERS..FWHKITICPFLIIFYPVLIVAMSVSLAVYTTVTQISWSFGEWWQAVRDLEKGFCGWLSGKLGLEDCSPYSIVELLDS-d................................................
U3IZG1_ANAPP/158-288                 .........KKKCDVGLDRGPHIVLWTIICLPVIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVTQVSWSFADWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A6P3Q4M0_PTEVA/147-277             ........r-KACQMAADRGPHVVLWTLICLPVVFVLSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAAQDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
K7G7I2_PELSI/158-288                 .........KKTCDIGLERGPHVLLWSIICLPVIFVMSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPLLIIFYPIIIMVMAFFLGLYTAVTQITWSFSSWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A6J1NWR9_BICAN/241-371             .......md--VSKCSLYNGPHIFLFSLLCIPFVACISAMYSFYMGTMAWYNIFTHVTEDFS..CIKKVFLAPIVILSYPFMIVIFTIGLGLYAGIAQLTFSGANWWKDVCDFEKGFYGWLCNTLGMSECSPYEVVVLMDV-k................................................
A0A482X0Q3_LAOST/120-250             ......qsf---TFCGFTKGLHIFLWTLLCFPVATLISSIYSFYIGTLMWHNIFTYVTEEKN..LLYRILLSPLLIIFFPFFIILFTLGLGVYAGLIQISWYLDSWSKEIMDWEKGFYGWLCSMIGLEDCSPYEVVVLTDI-q................................................
A0A673CIG4_9TELE/152-282             ........k-RSCSLGVGEGPHVVLWSISCVPVVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMALSLALYSAVVQVSWAFSEWWQAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
H2TWX3_TAKRU/149-279                 ........k-RKCSLGVSQGPHVVLWSISCVPMVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPVLIMPMALSLALYSAVVQVSWAFSEWWQAVRDLEKGFCGWACGKMGLEDCSPYSVVELLDS-d................................................
A0A672V8F6_STRHB/158-288             .........KKKCDVGLDRGPHIVLWTIICFPIIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVAQVAWSFGYWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A3N0XFV4_ANAGA/140-270             ........q-KPCALGVSQGPHVLLWSLSCSPFIFLLSFITSFYYGTLTWYNVFLVYNEERS..FLHKITVCPLLILLYPVLIMALCVCMGVYVAVTQLSWVFGEWWLAVRDLEKGFCGWMCGKLGLEDCAPYNVVELLDS-d................................................
F7CVE4_HORSE/147-277                 ........r-KACQMAADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A674AD91_SALTR/153-283             ........k-CSCGFGVFQGPHVILWSLLCAPLVFLIAFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIVFYPMLIMPMALSLALYSTLAQVSWVFSEWWLSVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
G1PDW2_MYOLU/147-277                 ........r-KVCQMSADQGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLE--yd...............................................
L5LYG3_MYODS/147-277                 ........r-KVCQMSADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLE--yd...............................................
A0A2K5RBH3_CEBIM/147-277             ........r-MACQMGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A096MR80_PAPAN/147-277             ........r-MACQVGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A2P8YL54_BLAGE/254-382             ......wfg-----CSPKKGPHVTLWTTLCMPFAFAVSSIYSFYMGTITWYNVFTYYTEEKP..VLCRILVSPFLILLYPFLILIFTLGLGLYAGIIQISWFLDSWYKEITDLEKGFYGWLCAALKHEDCSPYEVVVLTEI-q................................................
A0A6J1X5Q0_GALME/278-408             .......md--ISKCSLYNGPHIFLFTLICIPFVACISAMYSFYMGTMTWYNIFTHVTENLN..CVKKVFLAPIVILLYPFLIVTFTIGLGLYAGIVQLTFSGANWWKDVCDFEKGFYGWLCSTLGISECSPYEVVVLMDV-k................................................
W5JBR1_ANODA/260-390                 ......akq---GCCTLRTGVHILLLSLLCLPFVTLTTGIYSFYMGTVTWYNMFTYFNEERS..YFHKLLMSPLLILAYPLGIVLCTIGLGLYAGFRQLSFHFRSWLNEVSDIEKGFYGWLCSFLHLSDCSPYEVVILTEI-c................................................
A0A7R5K6S9_9PASS/158-217             .........KKKCDVGLDRGPHIVLWTIICLPVIFVVSFVVSFYYGTITW------------..------------------------------------------------------------------------------pvfscgpgsmvlwvlvacc..............................
A0A3N0YJJ9_ANAGA/140-270             .......sr--SCGFGISQGPHVVLWSLSCAPVVFVLSFITSFYYGTLTWYNIFLVYNEERT..FCHKITVCPFLIIFYPVLIVALSLSLALYSAVVQVSWAFSEWWMSVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A6J2RZU2_COTGO/152-282             ........k-RNCSLGLCQGPHVVLWSLSCAPVIFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMALSLALYSAVVQVSWVFSEWWQDVRDLEKGFCGWACGILGLEDCSPYSIVELLDS-d................................................
A0A226NN29_CALSU/157-287             ........k-KRCDVGLDRGPHIVLWTIVCLPVVFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVTQVSWSFGDWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A2A4K4H2_HELVI/277-407             .......md--ISKCSLYNGPHIFLFSLICIPIVACISALYSFYMGTMAWYNVFSHVTENFS..CIKKVLLAPIVILSYPFLIVIFTIGLGLYAGIVQLTFSAANWWKDVCDFEKGFYGWLCNTLGMSECSPYEVVVLMDV-k................................................
A0A2U3W023_ODORO/148-278             ........r-KACQMGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A2K6RAF8_RHIRO/147-277             ........r-MACHVGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A6P3J7S3_BISBI/147-277             ........r-KACQLGADRGPHVVLWTLVCLPVVFLLSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILCYPVLIMAMASSLGLYAAVVQLSWSWEAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A4W6FFM2_LATCA/152-282             ........k-RNCSLGVCQGPHVVLWSISCAPVVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMALSLALYSAVVQVSWAFSEWWQAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
TM169_BOVIN/147-277                  ........r-KACQLGADRGPHVVLWTLVCLPVVFLLSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILCYPVLIMAMASSLGLYAAVVQLSWSWEAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A2I3H6X4_NOMLE/147-277             ........r-MACQMGADRGPHVVLWTLICLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWEAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A6A4JN76_APOLU/109-239             ....tkrkg-----CTLYTGLHVTLFTILCFPVAFVMSSLYSFYMGTVTWYSIFTYISEEKN..LLIKILVTPMLILLYPFAIVIFTLGLGVYSAVVQISWCIFSWQKEITDWEKGFYGWLCSVLKLEDCAPYEVVVLTDI-k................................................
A0A671SAB0_9TELE/144-274             .......sr--SCGFGLSQGPHVVLWSLSCAPVIFVLSFITSFYYGTLTWYNIFLVYNEERT..FCHKITVCPFLIIFYPGLIVALSLSLGLYSAVAQVSWAFSEWWLSVRDLEKGFCGWACGKLGLEDCSPYSVVELLDS-d................................................
A0A6P7YGB9_9AMPH/150-280             .........KKTCEVGLEKGPHVLLWSLFCIPVVFVLSFIMSFYYGTITWYNIFLVYNEERT..FWHKIIVCPFLIIFYPVIIMALSLSLGLYTAVTQISWSFMEWWPTVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A1S3AJ57_ERIEU/147-277             ........r-KACLMAADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
B7PSW6_IXOSC/169-299                 ........d-DDCFFGMSKGPHVLLLSLSLLPVVFVVAAANSFYVGTMTWYNILVVLIEKRS..IFHKIFVSPFWIIFYPFLIVPAVLGLGLYAAVAQVSWEYTRWKREIPDWEKGFYGWLCCLLHMEECSPYEVVVLTDV-q................................................
A0A194RR65_PAPMA/277-407             .......md--VSKCSLYNGPHIFIFSLLCIPFVACISAAYSFYIGTLAWYNIFTHVTENFS..WIKKAIFAPMVILSYPFLIVVFTIGVGLYAGIVQLTFSGANWWKDVCDFEKGFYGWLCNFLGMSECSPYEVVVLMDV-k................................................
A0A6J0CGK0_PERMB/147-277             ........r-RACEVGADQGPHVVLWTLVCLPVVFVLSFVVAFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILLYPVLIMAMASSLGLYAAVVQLSWSWGAWWRAACDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A2K5CJ03_AOTNA/147-277             ........r-MACQMGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWEAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A1S3EK07_DIPOR/145-275             ........r-KSCQVGADQGPHVVLWTIVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILFYPVLIMAMASSLGIYAAVIQLSWSWGAWWQTARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A2J8STT9_PONAB/147-277             ........r-MACQMGADRGPHVVLWTLICLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWEAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A498M8H1_LABRO/147-277             .......sr--LCGFGLSQGPHVVLWSLSCAPVVFVLSFITSFYYGTLTWYNIFLVYNEERT..FCHKITVCPFLIIFYPVLIVALSLSLGLYSAVVQVSWAFSEWWLSVRDLEKGFCGWACGKLGLEDCSPYSVVELLDS-d................................................
A0A2J8NGW5_PANTR/147-277             ........r-MACQMGADRGPHVVLWTLICLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLVLFYPVLIMAMASSLGLYAAVVQLSWSWEAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A5N5SL10_9CRUS/247-353             .......kp--KAKWSVRFGPHILLLSLIAFPFVGFISSLYSFYLGTLTWYSLLTRAS-ESS..CLLKISLSPILILSYPFLIILFTLGLGIYASFAQIYKI----------------------------------------nkkkyksiyiettrswc................................
A0A6I8TY60_AEDAE/252-382             ........n-CCCQCTLRAGIHILLLSIICLPIVTLTTSIYSFYIGTVTWYNMFTYFNEEKS..YLHKLLMSPLLILAYPLAIVLCTVGLGIYAGFKQVSLHFTAWVNEISDIEKGFYGWLCSFLHLSDCSPYEVVILTDI-c................................................
V9KZB2_CALMI/138-268                 ........r-KPCDVGPRRGPHVVLWSLLCAPVIFVLSFVMSFYYGTIAWYNIFLVYNEERT..FWHKVTVCPLLIILYPVLIVATSASLGLYTMVTQVSWSLGEWWQAVRDLEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
E0VPF9_PEDHC/208-338                 ........k-NICYNSLNGGMHVFLWSIICSPISLILSSMYSFFMGTLTWYGIFSMFSETKS..FKYKIIVPPILIILYPFLIVFVSLCLGIYAGFKQVSWYWNIWLDEFTDYDKGFFGWLCNVLDIPECSPYEIIILSNV-y................................................
A0A1V4K5W7_PATFA/157-287             .........KKKCDVGLDRGPHIILWTIICLPVIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVAQVAWSFGYWWRAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A6F9CE54_9TELE/76-206              ....krtfg-----LGFCQGPHVILWSLSCAPVVFLLAFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMALALALYCALAQVSWAFSEWWLSVRDLEKGFCGWACGKLGMEDCSPYSIVELLDS-d................................................
A0A6P3WFE2_CLUHA/151-281             .......ch--SCGLGVCQGPHVVLWSLSCAPVVFLLSFITSFYFGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMAVSVSLAVYSAVVQVSWAFGEWWQAVRDLEKGFCGWACGKLGMEECSPYSIVELLDS-d................................................
A0A091SNM4_NESNO/146-276             ........r-KKCDVGLDRGPHIVLWTIICFPIIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIMIMVVSFSLGLYSAVAQVAWSFGYWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A2Y9IWI2_ENHLU/148-278             ........r-KACQMGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLDA-d................................................
A0A087U4N9_STEMI/193-254             ........d-DRCFFGLRKGPHILTLSLILVPFVMILSAAYSFYMGTMTWYNILVYFSEKKT..IFHKIFVSP---------------------------------------------------------------------.................................................
E7EZZ8_DANRE/136-266                 .......sr--SCGFGLSQGPHIVLWSLSCAPVVFVLSFITSFYYGTLTWYNIFLVYNEERT..FCHKITVCPFLIIFYPVLIVALSASLGLYSAVVQVSWAFSEWWMSVRDLEKGFCGWICGKLGLEDCSPYSVVELLES-d................................................
A0A3Q3VTT1_MOLML/133-263             .......kg--TCSLGMCQGPHIVLWSVSCAPVVFFLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITVCPFLIIFYPMLIMPMALLLALYSAVVQVSWAFSEWWQAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A5C6PMT0_9TELE/149-279             ........k-RKCSLGVSQGPHVVLWSISCVPMVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPVLIMPMALSLALYSAVVQVSWAFSEWWQAVRDLEKGFCGWACGKMGLEDCSPYSVVELLDS-d................................................
A0A673LGM5_9TELE/140-198             ........q-KPCALGVSQGPHVLLWSLSCSPFIFLLSFITSFYYGTLTWYNVFLVYNEERS..FLHKIT------------------------------------------------------------------------.................................................
A0A6P8VSM6_GYMAC/152-282             ........k-RNCGLGVCQGPHVVLWSLSCVPVIFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMALSLALYSAVVQVSWAFSEWWQDVRDMEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A452FS15_CAPHI/147-277             ........r-KACQLGADRGPHVVLWTLVCLPVVFLLSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWEAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A2K6EV78_PROCO/147-277             ........r-EACQVGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAVASALGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
H2ZK07_CIOSA/23-151                  .......ss--GCRCGVDSGPHIFLLGILCLPFIFIGSFCVCFYFGLLTWYNIFSYFYDEKS..ICYRITLCPLLVIFFPILIMLFTLGISFYAAFVQLTCSFEDWRSEVGSFEKGFYGWLCSWLGVEHCSPYTVVTLTE--.................................................
L9JF11_TUPCH/148-278                 ........r-KACQVGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A444U1H0_ACIRT/158-288             ........k-RACRVGAGRGPHVLLWSLSCTPVVFLLSFVMSFYYGTITWYNVFLVYNEERT..FWHKITVCPCLIIFYPILIVTLSLSLGVYTAVTQVSWAFAEWWQAVRDLEKGLCGWICGKLGLEDCSPYSIVELLDS-d................................................
V8PA07_OPHHA/158-288                 .........KKACEVGMDKGPHILLWSLACLPIIFIMSFIVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIFIMVVSFSLGVYTAITQVSWVFGDWWHAVRDMEKGFCGWLCSKVGLEDCSPYSIVELLDS-d................................................
A0A6I9Z462_9SAUR/156-286             ........t-KACEVGMDKGPHILLWSLACLPIIFIMSFIVSFYYGTITWYNVFLVYNEERT..FWHKITFCPFLIIFYPIFIMVVSFSLGVYTAITQVSWAFGDWWHAVRDMEKGFCGWLCSKVGLEDCSPYSIVELLDS-d................................................
R7UNB8_CAPTE/1-125                   ........g-------IRKGPHIVLWTLIFCPLSFLSSIAVCFYVGTMCWYNIYLYLSEERS..IWHRMFLCPLLILFYPLLLISTLLPLALFAACKQVSWNLLSWLTEIRDYDKGFYGWLCNRLGLPECAPYEVVIIDDS-n................................................
A0A6P6GYY9_PUMCO/147-277             ........r-KACQMGVDRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A6J2J7U7_BOMMA/276-406             .......md--ISKCSIRNGPHVFLFTLICIPFVTCISALYSFYMGTITWYNIFTHITENFS..CIKKVVLAPLIILCYPFLIVIFTIGLGLYAGIVQLTFSAGNWWKDVCDFEKGYYGWLCNMLSLSECSPYEVVVLMDV-k................................................
A0A218VBL5_9PASE/158-288             .........KKKCDVGLDRGPHIVLWTIICLPIIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIISYPIIIMVVSFSLGLYSAVAQVAWSFGYWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
G3R751_GORGO/147-277                 ........r-MACQMGADRGPHVVLWTLICLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLVLFYPVLIMAMASSLGLYAAVVQLSWSWEAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A1A6GER1_NEOLE/148-278             ........r-RACEVGADQGPHVVLWTLVCLPVVFVLSFVVSFYYGTITWYNIFLVYNEERT..FWHKISXCPCLILLYPVLIMAMASSLGLYAAVVQLSWSWGAWWRAACDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A340XU91_LIPVE/147-277             ........r-KACQLGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A087X359_POEFO/162-292             ........r-RKCTLGVCQGPHVVLWSISCAPVVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPVLIMPLALSLALYSAVVQVSWAFSEWWLAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A670YCN8_PSETE/140-270             .........KKACEVGMDKGPHILLWSLACLPIIFIMSFIVSFYYGTITWYNVFLVYNEERT..FWHKITFCPFLIIFYPIFIMVVSFSLGVYTAITQVSWAFGDWWHAVRDMEKGFCGWLCSKVGLEDCSPYSIVELLDS-d................................................
A0A663N319_ATHCN/158-288             .........KKKCDVGLDRGPHIVLWTIICLPIIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVLSFSLGLYSAVAQVAWSFGYWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A5G2QKD0_PIG/141-271               ........r-KACQLGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A0M3QYB4_DROBS/271-401             .......ni--FCTCGCGVGLHIFLISLLCLPFVTVISAIYSFYIGTLTWYNMFNYYCEEKS..YLHKIFITPILFLAYPLAIVLCTFGLGIYSGFRQLSLRYSSWVNDITDIEKGFYGWLCGFLHMSDCSPYEVVILTDI-c................................................
H3DGB8_TETNG/142-272                 ........k-CKCRLGVAQGPHVLLWSISCVPLVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPVLIMPMALSLALYSAVVQVSWAFSEWWQAVRDLEKGFCGWACGKMGLEDCSPYSVVELLDS-d................................................
A0A151M177_ALLMI/146-276             .........KKTCNVAVDRGPHVLLWSIVCFPVIFVVSFVISFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMAVSFSLGLYTAVTQIAWSFGDWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A482X9Z2_LAOST/196-326             ......qsf---TFCGFTKGLHIFLWTLLCFPVATLISSIYSFYIGTLMWHNIFTYVTEEKN..LLYRILLSPLLIIFFPFFIILFTLGLGVYAGLIQISWYLDSWSKEIMDWEKGFYGWLCSMIGLEDCSPYEVVVLTDI-q................................................
A0A433U8B4_ELYCH/171-302             .....hprs-----LGLRHGPHVTAWSLLCMPAALLYSFGSAFFNGAMTWYNLIVYLSEERSasLVHRVLLCPLVILSFPLTVGLSCLFLAIAAMFMQISWSWHSWWLEFSDGEKGFYGWVCSKVGLPDCSPYQVVVLDD--tg...............................................
A0A6G1PXN1_9TELE/152-282             ........k-CNCSLGMCQGPHVVLWSVSCVPVVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPVLIMPVALSLALYSAVVQVSWAFSEWWQSVRDLEKGFCGWACGKMGLEDCSPYSIVELLDS-d................................................
H2XUX6_CIOIN/77-207                  .......gd--GCRCGIDAGPHIILLGILCWPFIFIGSFFVCFYFGLLTWYNIFSYFYDERT..LCHRITLCPLLVLFFPGLIMVFTTSISFYAAFAQLTCSFEDWKSEVGSFEKGFYGWLCSWLDIESCSPYIVITLTES-e................................................
A0A671FEJ5_RHIFE/147-277             ........r-KACQMAADQGPHVVLWTLVCLPVVFLLSFIVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A444UP80_ACIRT/161-291             ........k-RACCVGAGRGPHVLLWSLSCAPVVFLLSFVMSFYYGTITWYNVFLVYNEERT..FWHKITICPCLIIFYPILIVALSLSLGVYTAITQVSWAFTEWWQAVRDLEKGLCGWICGKLGLEDCSPYSIVELLDS-d................................................
G3NS41_GASAC/152-282                 ........k-RTCSLGVCHGPHVVLWSLSCAPVIFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPVALSLALYSAVVQVSWAFSEWWQDVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A099ZA42_TINGU/147-277             ........k-NTCDVGLDRGPHIVLWTLICLPISFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPFIIMVLSFSLGLYSAVTQVTWSFGDWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
G1NGL7_MELGA/157-287                 .........KKKCHVGLDRGPHIVLWTIICLPIVFVVSFVVSFYYGTITWYNVFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVTQVSWSFGDWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
A0A6J2WFY8_CHACN/147-277             ........k-RSCGFGCNQGPHIVLWSLSCAPVVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITVCPCLIVFYPMLIMAVSLSLGLYAAVVQVSWTFSEWWLAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A3Q0DXR4_CARSF/72-202              ........r-RVCQMGADRGPHVVLWTLVCLPVVFVLSFVVSFYYGTITWYNIFLVYNEERT..FWHKISYCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A673M255_9TELE/140-222             ........q-NPCALGVSQGPHVLLWSLSCSPFIFLLSFITSFYYGTLTWYNVFLVYNEERS..FLQKITVCPLLILLYPVLIMTLCVCMGVYA------------------------------------------------.................................................
A0A3B3HPU5_ORYLA/152-282             .......tr--NCTLGVGRGPHVVLWSISCAPIVFVLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPVAVFLALYSAVVQVSWAFSEWWQSVKDLEKGFCGWACGKLGLEDCSPYSVVELLDS-d................................................
A0A6I9ZM19_ACIJB/147-277             ........r-KACQMGVDRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A5A9NGN0_9TELE/140-270             ........q-NPCTLGVSQGPHVLLWSLSCSPFIFLLSFITSFYYGTLTWYNIFLVYNEERS..FLHKITLCPLLILLYPVLIMVLCVCMGVYAAVNQLSWVFGEWWLAVRDLEKGFFGWMCGKLGLEDCAPYNVVELLDS-d................................................
A0A485MXY9_LYNPA/147-277             ........r-KACQMGVDRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A3P9BRG2_9CICH/134-264             ........k-RTCSLGACQGPHVVLWSISCAPVVFILSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPLALSLALYSAVVQVSWAFSEWWQAVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A091DBQ3_FUKDA/147-277             ........r-KACQVGADQGPHVVLWTLVCLPVVFILSFIVSFYYGTITWYNIFLVYNEERT..FWHKVSYCPCLILFYPLLIMAMASSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
G1U2U7_RABIT/147-277                 ........r-NACQMGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGIYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
L5L0R8_PTEAL/147-277                 ........r-KACQMAADRGPHVVLWTLICLPVVFVLSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMASSLGLYAAVVQLSWSWGAWWQAAQDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A2F0AU89_ESCRO/147-277             ........r-KACQLGADRGPHVVLWTLVCLPVVFILSFVVSFYYGTITWYNIFLVYNEERT..FWHKISCCPCLILFYPVLIMAMSSSLGLYAAVVQLSWSWGAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLES-d................................................
A0A6P7LE70_BETSP/151-281             ........k-RTCSLGVCQGPHVVLWSISCAPVVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPVLIMPMALSLALYSAVVQVSWAFGEWWQSVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A3L8SMW7_CHLGU/158-288             .........KKKCDVGLDRGPHIVLWTIICLPIIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIISYPIIIMVVSFSLGLYSAVAQVAWSFGYWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
B4NKW5_DROWI/272-402                 .......nl--CCTCSCGIGLHIFLISLICLPFVTVISSVYSFYIGTLTWYNMFNYYCEEKS..YFHKIFVTPLLFMAYPLVIVLCTFGLGLYSGFKQLSLQYSSWVNDITDIEKGFYGWLCGFLRMPDCSPYEVVILTDI-c................................................
A0A671Z358_SPAAU/152-282             ........k-RACSLGVCQGPHVVLWSVSCAPLVFLLSFITSFYYGTLTWYNVFLVYNEERT..FWHKITICPFLIIFYPMLIMPMAVSLALYSAVVQVSWAFSEWWMSVRDLEKGFCGWACGKLGLEDCSPYSIVELLDS-d................................................
A0A091EEK7_CORBR/152-282             .........KKKCDVGLDRGPHIVLWTIICLPIIFVVSFVVSFYYGTITWYNIFLVYNEERT..FWHKITFCPFLIIFYPIIIMVVSFSLGLYSAVAQVAWSFGYWWHAVRDMEKGFCGWLCSKLGLEDCSPYSIVELLDS-d................................................
B0W6A0_CULQU/258-388                 ........q-CCCQCTLRAGLHVLLLSLVCLPFVTLTTSIYSFYIGTVTWYNMFTYFNEEKS..YFHKLLMSPLLILAYPLAIVFCTLGLGLYAGLKQISLHFTAWLNEISDVEKGFYGWLCSFLHLSDCSPYEVVILTDI-c................................................
#=GC seq_cons                        ........c.psCphGhspGPHVVLWoLlClPlVFllSFlsSFYYGTlTWYNlFLVYNEERT..FWHKIohCPhLIlFYPlLIMshuhSLGLYuAVsQlSWuautWWpAlRDhEKGFCGWLCuKLGLEDCSPYSIVELLDS.D................................................
//
DBGET integrated database retrieval system