
Database: Pfam
Entry: Thioredoxin_6
LinkDB: Thioredoxin_6
Original site: Thioredoxin_6 
#=GF ID   Thioredoxin_6
#=GF AC   PF13848.9
#=GF DE   Thioredoxin-like domain
#=GF AU   Coggill P;0000-0001-5731-1588
#=GF SE   Jackhmmer:Q96DN0
#=GF GA   27.00 27.00;
#=GF TC   27.00 27.00;
#=GF NC   26.90 26.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Thioredoxin_fold
#=GF CL   CL0172
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF SQ   8228
#=GS A0A1Y2E334_9PEZI/151-332    AC A0A1Y2E334.1
#=GS K7F6Z5_PELSI/1-120          AC K7F6Z5.1
#=GS A0A3P6UBV8_LITSI/119-289    AC A0A3P6UBV8.1
#=GS A0A671U7U2_SPAAU/556-755    AC A0A671U7U2.1
#=GS A0A1B9IS13_9TREE/310-485    AC A0A1B9IS13.1
#=GS A0A663EXN3_AQUCH/1-130      AC A0A663EXN3.1
#=GS A0A452F670_CAPHI/238-342    AC A0A452F670.1
#=GS A0A2S5B441_9BASI/153-335    AC A0A2S5B441.1
#=GS A0A3M9YI13_9PEZI/148-323    AC A0A3M9YI13.1
#=GS PDIA4_RAT/310-502           AC P38659.2
#=GS PDIA4_RAT/310-502           DR PDB; 3EC3 B; 310-502;
#=GS PDIA4_RAT/310-502           DR PDB; 3EC3 A; 310-502;
#=GS A0A2G5SSL5_9PELO/157-341    AC A0A2G5SSL5.1
#=GS A0A6J1NQ02_BICAN/158-340    AC A0A6J1NQ02.1
#=GS A0A232FII7_9HYME/160-344    AC A0A232FII7.1
#=GS A0A2Y9FGV3_PHYMC/314-506    AC A0A2Y9FGV3.1
#=GS A0A1L9WUX5_ASPA1/160-341    AC A0A1L9WUX5.1
#=GS G5E7I2_MELGA/253-445        AC G5E7I2.1
#=GS A0A674E3M2_SALTR/167-350    AC A0A674E3M2.1
#=GS A0A6J0A3K6_ACIJB/534-723    AC A0A6J0A3K6.1
#=GS A7AVK4_BABBO/160-326        AC A7AVK4.1
#=GS M3YPG6_MUSPF/180-365        AC M3YPG6.1
#=GS A0A2U3V4L0_TURTR/158-338    AC A0A2U3V4L0.1
#=GS A0A6J0PBT0_RAPSA/179-351    AC A0A6J0PBT0.1
#=GS A0A670IA89_PODMU/168-352    AC A0A670IA89.1
#=GS A0A0D2SWW0_GOSRA/172-330    AC A0A0D2SWW0.1
#=GS A0A437APU1_9MICR/254-444    AC A0A437APU1.1
#=GS A0A090MX54_STRRB/163-347    AC A0A090MX54.1
#=GS B9EL99_SALSA/47-235         AC B9EL99.1
#=GS A0A183KVC7_9TREM/5-140      AC A0A183KVC7.1
#=GS A0A1E5VI43_9POAL/228-412    AC A0A1E5VI43.1
#=GS A0A5D2Z3T3_GOSMU/228-411    AC A0A5D2Z3T3.1
#=GS A0A5A7P488_STRAF/182-364    AC A0A5A7P488.1
#=GS A0A2K5N302_CERAT/178-365    AC A0A2K5N302.1
#=GS Q4E3F7_TRYCC/152-345        AC Q4E3F7.1
#=GS A0A5J9V317_9POAL/353-529    AC A0A5J9V317.1
#=GS B6HK48_PENRW/162-343        AC B6HK48.1
#=GS J9JPW0_ACYPI/529-687        AC J9JPW0.2
#=GS A0A428QY51_9HYPO/455-566    AC A0A428QY51.1
#=GS A0A6P6B7X5_DURZI/168-353    AC A0A6P6B7X5.1
#=GS A0A452RJ89_URSAM/312-504    AC A0A452RJ89.1
#=GS A2E4B8_TRIVA/21-120         AC A2E4B8.1
#=GS A0A6I9VB65_BACDO/523-679    AC A0A6I9VB65.1
#=GS A0A194XQD0_9HELO/148-328    AC A0A194XQD0.1
#=GS A0A2C9V3A2_MANES/207-391    AC A0A2C9V3A2.1
#=GS A0A6P8QFI6_GEOSA/301-492    AC A0A6P8QFI6.1
#=GS A0A452DLH3_CAPHI/158-338    AC A0A452DLH3.1
#=GS A0A5E8AYB6_9ASCO/153-345    AC A0A5E8AYB6.1
#=GS A0A453QTJ8_AEGTS/204-384    AC A0A453QTJ8.1
#=GS A0A2J7PQD1_9NEOP/168-354    AC A0A2J7PQD1.1
#=GS A0A1V4J931_PATFA/158-338    AC A0A1V4J931.1
#=GS A0A4S4DY28_CAMSI/174-359    AC A0A4S4DY28.1
#=GS A0A6J3H5Z9_SAPAP/186-373    AC A0A6J3H5Z9.1
#=GS B4MDX8_DROVI/158-343        AC B4MDX8.1
#=GS H2TSN9_TAKRU/150-297        AC H2TSN9.3
#=GS A0A4U6WF02_SETVI/58-242     AC A0A4U6WF02.1
#=GS A0A453HJU0_AEGTS/137-322    AC A0A453HJU0.1
#=GS A0A7F8K9F8_DELLE/159-346    AC A0A7F8K9F8.1
#=GS A0A4P1RDJ5_LUPAN/232-412    AC A0A4P1RDJ5.1
#=GS A0A672KNU7_SINGR/159-319    AC A0A672KNU7.1
#=GS A0A6J1V4P6_9SAUR/249-441    AC A0A6J1V4P6.1
#=GS G8BQ75_TETPH/165-357        AC G8BQ75.1
#=GS A0A328DK11_9ASTE/249-428    AC A0A328DK11.1
#=GS A0A6A5E0T6_PERFL/209-406    AC A0A6A5E0T6.1
#=GS A0A671XUZ4_SPAAU/153-348    AC A0A671XUZ4.1
#=GS A0A444UBB6_ACIRT/633-817    AC A0A444UBB6.1
#=GS A0A0N4YFC4_NIPBR/141-295    AC A0A0N4YFC4.2
#=GS A0A3N6QWS7_BRACR/220-367    AC A0A3N6QWS7.1
#=GS A0A1X7V4D7_AMPQE/99-247     AC A0A1X7V4D7.1
#=GS A0A673IM74_9TELE/152-349    AC A0A673IM74.1
#=GS A0A287NRR0_HORVV/5-129      AC A0A287NRR0.1
#=GS A0A6P6KCT5_CARAU/159-343    AC A0A6P6KCT5.1
#=GS A0A4W3IEU7_CALMI/536-727    AC A0A4W3IEU7.1
#=GS A0A6J2GUN4_9PASS/158-339    AC A0A6J2GUN4.1
#=GS A0A0V0V2Q5_9BILA/617-807    AC A0A0V0V2Q5.1
#=GS A0A091TL80_PHALP/513-702    AC A0A091TL80.1
#=GS A0A2I2ZH86_GORGO/303-495    AC A0A2I2ZH86.1
#=GS A0A2A9NTT7_9AGAR/155-340    AC A0A2A9NTT7.1
#=GS A0A671EU81_RHIFE/311-428    AC A0A671EU81.1
#=GS C5XRG2_SORBI/233-413        AC C5XRG2.1
#=GS A0A665W759_ECHNA/157-341    AC A0A665W759.1
#=GS B9HQ95_POPTR/239-419        AC B9HQ95.1
#=GS H9GMS8_ANOCA/201-316        AC H9GMS8.1
#=GS G8ZQS4_TORDC/166-338        AC G8ZQS4.1
#=GS R0IEZ0_9BRAS/211-396        AC R0IEZ0.1
#=GS E2R7L1_CANLF/309-501        AC E2R7L1.2
#=GS A0A0V1M4C6_9BILA/116-304    AC A0A0V1M4C6.1
#=GS A0A6P6Q687_CARAU/186-373    AC A0A6P6Q687.1
#=GS A0A672ZFT1_9TELE/154-348    AC A0A672ZFT1.1
#=GS A0A6P8XDI6_DROAB/158-343    AC A0A6P8XDI6.1
#=GS A0A674JMH7_TERCA/138-246    AC A0A674JMH7.1
#=GS L1JWF0_GUITC/172-350        AC L1JWF0.1
#=GS A0A1V4KBQ7_PATFA/546-735    AC A0A1V4KBQ7.1
#=GS A0A182YNV8_ANOST/518-676    AC A0A182YNV8.1
#=GS D7G1P0_ECTSI/277-418        AC D7G1P0.1
#=GS L5KH49_PTEAL/179-366        AC L5KH49.1
#=GS A0A668ST48_OREAU/159-343    AC A0A668ST48.1
#=GS A0A0V0RHQ2_9BILA/645-834    AC A0A0V0RHQ2.1
#=GS A0A1R3IFE7_9ROSI/214-391    AC A0A1R3IFE7.1
#=GS A0A672MAQ1_SINGR/160-344    AC A0A672MAQ1.1
#=GS I3MEW0_ICTTR/167-350        AC I3MEW0.2
#=GS A0A674GVV9_TAEGU/196-327    AC A0A674GVV9.1
#=GS A0A7N6C428_ANATE/193-379    AC A0A7N6C428.1
#=GS B3RSE4_TRIAD/134-321        AC B3RSE4.1
#=GS A0A0K6FVD9_9AGAM/152-338    AC A0A0K6FVD9.1
#=GS A0A0K0EKT9_STRER/152-340    AC A0A0K0EKT9.1
#=GS C5LZ44_PERM5/155-330        AC C5LZ44.1
#=GS W7LHM7_GIBM7/155-336        AC W7LHM7.1
#=GS A0A2U1L2R7_ARTAN/177-363    AC A0A2U1L2R7.1
#=GS L8YAU6_TUPCH/174-369        AC L8YAU6.1
#=GS A0A446WFD2_TRITD/109-283    AC A0A446WFD2.1
#=GS A0A2P5WEI2_GOSBA/170-353    AC A0A2P5WEI2.1
#=GS U3IT25_ANAPP/314-505        AC U3IT25.1
#=GS A0A6J0XPB9_ODOVR/313-505    AC A0A6J0XPB9.1
#=GS A0A6I9PKZ0_9TELE/555-754    AC A0A6I9PKZ0.1
#=GS A0A1S3BAI2_CUCME/175-359    AC A0A1S3BAI2.1
#=GS A0A0V0SLZ7_9BILA/173-258    AC A0A0V0SLZ7.1
#=GS A0A6J2A9A2_ACIJB/225-406    AC A0A6J2A9A2.1
#=GS A0A1R2ALJ5_9CILI/150-327    AC A0A1R2ALJ5.1
#=GS A0A2H5PB57_CITUN/187-371    AC A0A2H5PB57.1
#=GS A0A6J0BF84_NEOLC/167-353    AC A0A6J0BF84.1
#=GS A0A2K6EEW0_PROCO/311-503    AC A0A2K6EEW0.1
#=GS A0A3P8ZIK7_ESOLU/153-332    AC A0A3P8ZIK7.2
#=GS A0A2K6B708_MACNE/178-365    AC A0A2K6B708.1
#=GS A0A6P6RHX1_CARAU/158-352    AC A0A6P6RHX1.1
#=GS A0A2Y9QJG4_TRIMA/434-623    AC A0A2Y9QJG4.1
#=GS A0A7N8WQH6_9TELE/182-365    AC A0A7N8WQH6.1
#=GS A0A6J2RT75_COTGO/306-498    AC A0A6J2RT75.1
#=GS B4HB66_DROPE/169-355        AC B4HB66.1
#=GS A0A3E2HS58_SCYLI/231-412    AC A0A3E2HS58.1
#=GS A0A3Q3NJ85_9TELE/159-353    AC A0A3Q3NJ85.1
#=GS A0A6H5GYR4_9HEMI/117-293    AC A0A6H5GYR4.1
#=GS A0A218VDX5_9PASE/158-339    AC A0A218VDX5.1
#=GS A0A660KQY8_9ROSI/227-407    AC A0A660KQY8.1
#=GS A0A484E2Z2_BRELC/164-340    AC A0A484E2Z2.1
#=GS W4ISQ2_PLAFP/165-332        AC W4ISQ2.1
#=GS A0A2K6MCY6_RHIBE/310-502    AC A0A2K6MCY6.1
#=GS A0A077ZC57_TRITR/81-238     AC A0A077ZC57.1
#=GS A0A0F7UU04_TOXGV/160-329    AC A0A0F7UU04.1
#=GS A0A1J6IXH9_NICAT/206-391    AC A0A1J6IXH9.1
#=GS A0A6J1WSZ9_GALME/157-343    AC A0A6J1WSZ9.1
#=GS A0A673K259_9TELE/159-343    AC A0A673K259.1
#=GS W5PSR4_SHEEP/180-365        AC W5PSR4.1
#=GS A8XBT0_CAEBR/154-342        AC A8XBT0.1
#=GS W5N2M2_LEPOC/1-181          AC W5N2M2.1
#=GS G1RPI0_NOMLE/533-711        AC G1RPI0.3
#=GS A0A1R2AWY3_9CILI/150-321    AC A0A1R2AWY3.1
#=GS A0A182GFX8_AEDAL/163-346    AC A0A182GFX8.1
#=GS A0A1D6J739_MAIZE/225-409    AC A0A1D6J739.1
#=GS A0A1Y1VFW4_9FUNG/317-509    AC A0A1Y1VFW4.1
#=GS A0A0V0TX29_9BILA/195-370    AC A0A0V0TX29.1
#=GS A0A1V6RGD3_9EURO/162-343    AC A0A1V6RGD3.1
#=GS A0A2P4TGL8_BAMTH/73-259     AC A0A2P4TGL8.1
#=GS A0A0Q9X0P2_DROWI/733-856    AC A0A0Q9X0P2.1
#=GS A0A6A4VRP1_AMPAM/166-346    AC A0A6A4VRP1.1
#=GS A0A6I8VRB8_DROPS/531-687    AC A0A6I8VRB8.1
#=GS A0A238BT48_9BILA/16-137     AC A0A238BT48.1
#=GS A0A1B8E8I2_9PEZI/153-334    AC A0A1B8E8I2.1
#=GS D7KKU1_ARALL/168-353        AC D7KKU1.1
#=GS PDI52_ARATH/178-347         AC Q94F09.1
#=GS A0A087YN41_POEFO/174-355    AC A0A087YN41.2
#=GS A0A328D3I3_9ASTE/226-412    AC A0A328D3I3.1
#=GS C3XU09_BRAFL/555-742        AC C3XU09.1
#=GS A0A5D3AI10_GOSMU/169-354    AC A0A5D3AI10.1
#=GS A0A5N4E2M3_CAMDR/416-605    AC A0A5N4E2M3.1
#=GS A0A0V1NKA3_9BILA/195-370    AC A0A0V1NKA3.1
#=GS H2SH82_TAKRU/148-318        AC H2SH82.3
#=GS A0A060SM32_PYCCI/153-337    AC A0A060SM32.1
#=GS A0A446Y2H2_TRITD/88-271     AC A0A446Y2H2.1
#=GS A0A3Q4ANH8_MOLML/292-483    AC A0A3Q4ANH8.1
#=GS A0A6P7Y5C4_9AMPH/317-508    AC A0A6P7Y5C4.1
#=GS A0A671S0D6_9TELE/118-281    AC A0A671S0D6.1
#=GS A0A1L9UUR7_ASPBC/157-338    AC A0A1L9UUR7.1
#=GS A0A179FDI1_METCM/157-337    AC A0A179FDI1.1
#=GS A0A671DNB4_RHIFE/536-725    AC A0A671DNB4.1
#=GS A0A3B1IWY6_ASTMX/158-352    AC A0A3B1IWY6.1
#=GS A0A493TQY5_ANAPP/120-295    AC A0A493TQY5.1
#=GS A0A5J5DMR4_9PERO/93-276     AC A0A5J5DMR4.1
#=GS A0A1S3CNJ1_CUCME/235-338    AC A0A1S3CNJ1.1
#=GS A0A667Z3I0_9TELE/154-335    AC A0A667Z3I0.1
#=GS X0CDJ3_FUSOX/155-336        AC X0CDJ3.1
#=GS A0A6I9UB38_SESIN/197-304    AC A0A6I9UB38.1
#=GS A0A0E0FZQ5_ORYNI/214-404    AC A0A0E0FZQ5.1
#=GS I3KEV4_ORENI/150-335        AC I3KEV4.2
#=GS A0A2I3SI55_PANTR/299-491    AC A0A2I3SI55.1
#=GS A0A7N6A4T0_ANATE/130-312    AC A0A7N6A4T0.1
#=GS E2RD86_CANLF/160-355        AC E2RD86.1
#=GS A0A3B6NIJ7_WHEAT/237-416    AC A0A3B6NIJ7.1
#=GS A0A287AX21_PIG/186-373      AC A0A287AX21.1
#=GS A0A178EHJ9_9PLEO/150-331    AC A0A178EHJ9.1
#=GS A0A4S4L5S1_9AGAM/354-493    AC A0A4S4L5S1.1
#=GS A0A5F5Y659_FELCA/177-364    AC A0A5F5Y659.1
#=GS A0A1V9YW66_9STRA/182-347    AC A0A1V9YW66.1
#=GS A0A507FPX9_9FUNG/181-377    AC A0A507FPX9.1
#=GS A0A1S3ADE4_ERIEU/64-251     AC A0A1S3ADE4.1
#=GS A0A287B4Y1_PIG/128-311      AC A0A287B4Y1.1
#=GS A0A1E3HNX6_9TREE/159-334    AC A0A1E3HNX6.1
#=GS S0E6F9_GIBF5/145-319        AC S0E6F9.1
#=GS A0A182XYR3_ANOST/156-341    AC A0A182XYR3.1
#=GS A0A067GVX5_CITSI/185-363    AC A0A067GVX5.1
#=GS A0A484BYW3_PERFV/544-741    AC A0A484BYW3.1
#=GS A0A2I0KGC2_PUNGR/175-360    AC A0A2I0KGC2.1
#=GS A0A1S2ZJW9_ERIEU/175-358    AC A0A1S2ZJW9.1
#=GS Q4WH99_ASPFU/160-341        AC Q4WH99.1
#=GS A0A2A2L7S1_9BILA/276-473    AC A0A2A2L7S1.1
#=GS A0A6P4XWQ7_BRABE/158-342    AC A0A6P4XWQ7.1
#=GS A0A1E4RNQ6_9ASCO/379-505    AC A0A1E4RNQ6.1
#=GS M7YXL3_TRIUA/3-182          AC M7YXL3.1
#=GS A0A4D8ZV89_SALSN/617-798    AC A0A4D8ZV89.1
#=GS A0A6P7Z753_9AMPH/541-730    AC A0A6P7Z753.1
#=GS A0A3Q1E912_9TELE/160-343    AC A0A3Q1E912.1
#=GS A0A673L0C0_9TELE/148-309    AC A0A673L0C0.1
#=GS A0A3S3P4Z5_9ACAR/164-360    AC A0A3S3P4Z5.1
#=GS A0A6P8WZ59_DROAB/157-352    AC A0A6P8WZ59.1
#=GS A0A671XW50_SPAAU/155-320    AC A0A671XW50.1
#=GS A0A4V1XMQ0_9PEZI/363-541    AC A0A4V1XMQ0.1
#=GS A0A1U7YJ27_NICSY/162-348    AC A0A1U7YJ27.1
#=GS A0A3B6B0W6_WHEAT/173-364    AC A0A3B6B0W6.1
#=GS A0A0V0XBY0_9BILA/172-356    AC A0A0V0XBY0.1
#=GS A0A3P8JFW8_TRIRE/13-68      AC A0A3P8JFW8.1
#=GS A0A287TG47_HORVV/36-147     AC A0A287TG47.1
#=GS A0A3S7RNE6_GIAMU/143-324    AC A0A3S7RNE6.1
#=GS A0A0E0NG92_ORYRU/192-367    AC A0A0E0NG92.1
#=GS A0A2U1L9W6_ARTAN/97-325     AC A0A2U1L9W6.1
#=GS A0A4P9YV19_9FUNG/169-351    AC A0A4P9YV19.1
#=GS I3J5R9_ORENI/197-385        AC I3J5R9.2
#=GS A0A6J3AIF9_VICPA/258-416    AC A0A6J3AIF9.1
#=GS A0A2T2NT54_CORCC/195-373    AC A0A2T2NT54.1
#=GS A0A6P7IU58_9TELE/48-234     AC A0A6P7IU58.1
#=GS A0A653CNU9_CALMS/168-354    AC A0A653CNU9.1
#=GS A0A0Q3E8K2_BRADI/92-268     AC A0A0Q3E8K2.1
#=GS A0A0G4GLE0_VITBC/143-290    AC A0A0G4GLE0.1
#=GS A0A672GGU9_SALFA/303-500    AC A0A672GGU9.1
#=GS A0A0D9VH17_9ORYZ/152-334    AC A0A0D9VH17.1
#=GS A0A3Q1ATE7_AMPOC/31-213     AC A0A3Q1ATE7.1
#=GS A0A3Q2DYC6_CYPVA/149-342    AC A0A3Q2DYC6.1
#=GS G1L5C5_AILME/534-723        AC G1L5C5.2
#=GS A0A5D2ZCE4_GOSMU/169-354    AC A0A5D2ZCE4.1
#=GS A0A319DTL7_ASPSB/157-338    AC A0A319DTL7.1
#=GS A0A5C3NF07_9AGAM/156-341    AC A0A5C3NF07.1
#=GS A0A445L569_GLYSO/1-85       AC A0A445L569.1
#=GS A0A663N8T4_ATHCN/167-274    AC A0A663N8T4.1
#=GS A0A0P1B4I0_PLAHL/175-341    AC A0A0P1B4I0.1
#=GS A0A078HMI0_BRANA/168-352    AC A0A078HMI0.1
#=GS A0A1U8PXI5_GOSHI/238-418    AC A0A1U8PXI5.1
#=GS A0A3Q1J9A0_ANATE/149-344    AC A0A3Q1J9A0.1
#=GS C4VA22_NOSCE/1-152          AC C4VA22.1
#=GS A0A6P4J216_DROKI/168-354    AC A0A6P4J216.1
#=GS A0A195AW38_9HYME/159-343    AC A0A195AW38.1
#=GS A0A084VAX6_ANOSI/1413-1575  AC A0A084VAX6.1
#=GS J9EIH3_9SPIT/4-165          AC J9EIH3.1
#=GS A0A1Y1XVG1_9FUNG/296-468    AC A0A1Y1XVG1.1
#=GS A0A182GZ16_AEDAL/155-352    AC A0A182GZ16.1
#=GS A0A5Q4BD89_9PEZI/153-319    AC A0A5Q4BD89.1
#=GS D8TEH2_SELML/140-323        AC D8TEH2.1
#=GS A0A091LA26_CATAU/148-331    AC A0A091LA26.1
#=GS A9RDR2_PHYPA/206-388        AC A9RDR2.1
#=GS A0A6G0HLQ2_LARCR/305-497    AC A0A6G0HLQ2.1
#=GS A0A2Y9HBJ6_NEOSC/167-350    AC A0A2Y9HBJ6.1
#=GS A0A091I000_CALAN/112-296    AC A0A091I000.1
#=GS A0A0Q9X0P2_DROWI/534-691    AC A0A0Q9X0P2.1
#=GS A0A3M0L245_HIRRU/191-377    AC A0A3M0L245.1
#=GS A0A287WG89_HORVV/14-123     AC A0A287WG89.1
#=GS A0A5J5C8Q4_9ASTE/236-417    AC A0A5J5C8Q4.1
#=GS A0A6A6NA91_HEVBR/221-386    AC A0A6A6NA91.1
#=GS A0A4D8YEQ9_SALSN/215-396    AC A0A4D8YEQ9.1
#=GS C5M068_PERM5/156-329        AC C5M068.1
#=GS A0A2Y9QRU1_TRIMA/357-546    AC A0A2Y9QRU1.1
#=GS A0A1S3J7L9_LINUN/556-747    AC A0A1S3J7L9.1
#=GS A0A6P6YEX8_DERPT/162-348    AC A0A6P6YEX8.1
#=GS A0A2Y9HZZ6_NEOSC/534-723    AC A0A2Y9HZZ6.1
#=GS H2L7V0_ORYLA/158-352        AC H2L7V0.1
#=GS A0A2K5JS86_COLAP/158-338    AC A0A2K5JS86.1
#=GS A0A383VY14_TETOB/183-370    AC A0A383VY14.1
#=GS A0A667YSP6_9TELE/124-308    AC A0A667YSP6.1
#=GS A0A0W7VHM0_9HYPO/154-335    AC A0A0W7VHM0.1
#=GS A0A1Y2LU31_EPING/151-332    AC A0A1Y2LU31.1
#=GS A0A1X6MVI3_9APHY/156-341    AC A0A1X6MVI3.1
#=GS A0A6J3DHV5_AYTFU/159-354    AC A0A6J3DHV5.1
#=GS A0A5E4QBS8_9NEOP/516-671    AC A0A5E4QBS8.1
#=GS A0A1U7SUP7_ALLSI/79-263     AC A0A1U7SUP7.2
#=GS A0A1A6AHQ9_9TREE/155-342    AC A0A1A6AHQ9.1
#=GS A0A6G1BDY7_CROCR/534-618    AC A0A6G1BDY7.1
#=GS A0A1S3PX04_SALSA/159-342    AC A0A1S3PX04.1
#=GS A0A182DY12_ONCOC/158-338    AC A0A182DY12.1
#=GS ERP44_MOUSE/167-350         AC Q9D1Q6.1
#=GS A0A2G9UG26_TELCI/41-152     AC A0A2G9UG26.1
#=GS A0A1X2IKM7_9FUNG/176-325    AC A0A1X2IKM7.1
#=GS A0A074ZQM0_9TREM/158-342    AC A0A074ZQM0.1
#=GS A2DA45_TRIVA/164-342        AC A2DA45.1
#=GS A0A3N0XRJ4_ANAGA/5-88       AC A0A3N0XRJ4.1
#=GS A0A559MH49_9HELO/152-333    AC A0A559MH49.1
#=GS A0A2I2GC87_9EURO/161-342    AC A0A2I2GC87.1
#=GS A0A3P9NLN2_POERE/590-789    AC A0A3P9NLN2.1
#=GS G1KLM1_ANOCA/158-338        AC G1KLM1.2
#=GS A0A498SF86_ACAVI/191-373    AC A0A498SF86.1
#=GS A0A2Z7A114_9LAMI/194-300    AC A0A2Z7A114.1
#=GS Q5EUD8_MAIZE/226-407        AC Q5EUD8.1
#=GS A0A6P7KWY6_BETSP/153-333    AC A0A6P7KWY6.1
#=GS A0A673YWK3_SALTR/97-261     AC A0A673YWK3.1
#=GS A0A3P6UX69_LITSI/158-330    AC A0A3P6UX69.1
#=GS A0A0N4TUD6_BRUPA/315-484    AC A0A0N4TUD6.1
#=GS Q5EUD2_MAIZE/182-360        AC Q5EUD2.1
#=GS A0A4U6TPC9_SETVI/176-360    AC A0A4U6TPC9.1
#=GS A0A3Q1BID9_AMPOC/160-354    AC A0A3Q1BID9.1
#=GS A0A2J6L4A6_LACSA/166-349    AC A0A2J6L4A6.1
#=GS A0A0N4V9C6_ENTVE/199-333    AC A0A0N4V9C6.1
#=GS A0A7N6FBR9_ANATE/165-350    AC A0A7N6FBR9.1
#=GS A0A2V3IFT3_9FLOR/171-340    AC A0A2V3IFT3.1
#=GS A0A444USX7_ACIRT/462-657    AC A0A444USX7.1
#=GS T1GU08_MEGSC/309-465        AC T1GU08.1
#=GS A0A1L8EYS9_XENLA/183-368    AC A0A1L8EYS9.1
#=GS A0A2I3NF27_PAPAN/161-344    AC A0A2I3NF27.1
#=GS A0A5E4F6Q0_PRUDU/228-404    AC A0A5E4F6Q0.1
#=GS A0A1U8Q2B2_NELNU/209-394    AC A0A1U8Q2B2.1
#=GS A0A6I8TS42_AEDAE/530-688    AC A0A6I8TS42.1
#=GS A0A093NIW8_PYGAD/123-304    AC A0A093NIW8.1
#=GS A0A671XVI5_SPAAU/147-333    AC A0A671XVI5.1
#=GS A0A0B7N181_9FUNG/220-428    AC A0A0B7N181.1
#=GS A0A1W2TK79_ROSNE/2-96       AC A0A1W2TK79.1
#=GS A0A1S3Y2R6_TOBAC/226-406    AC A0A1S3Y2R6.1
#=GS A0A671G3V1_RHIFE/178-363    AC A0A671G3V1.1
#=GS A0A6A1Q7X0_BALPH/14-169     AC A0A6A1Q7X0.1
#=GS K1Q6X5_CRAGI/156-340        AC K1Q6X5.1
#=GS A0A2B4RWB1_STYPI/2-130      AC A0A2B4RWB1.1
#=GS A0A6Q2Y5Y7_ESOLU/159-353    AC A0A6Q2Y5Y7.1
#=GS A0A0D2TWY7_GOSRA/59-240     AC A0A0D2TWY7.1
#=GS R0JYQ9_ANAPL/111-291        AC R0JYQ9.1
#=GS A0A2K6MD00_RHIBE/324-516    AC A0A2K6MD00.1
#=GS A0A6J2IN21_9PASS/161-356    AC A0A6J2IN21.1
#=GS A0A674E611_SALTR/158-341    AC A0A674E611.1
#=GS A0A0B1SDS5_OESDE/2-80       AC A0A0B1SDS5.1
#=GS A0A445K853_GLYSO/6-104      AC A0A445K853.1
#=GS A0A484BA98_DRONA/157-341    AC A0A484BA98.1
#=GS A0A2R9AJW4_PANPA/160-355    AC A0A2R9AJW4.1
#=GS A0A091TG89_PELCR/514-703    AC A0A091TG89.1
#=GS A0A1Y1YBX3_9PLEO/181-365    AC A0A1Y1YBX3.1
#=GS A0A6S7MB36_LACSI/244-423    AC A0A6S7MB36.1
#=GS A0A3Q0J1D0_DIACI/159-287    AC A0A3Q0J1D0.1
#=GS A0A1V8UIH6_9PEZI/150-334    AC A0A1V8UIH6.1
#=GS A0A3P9NV49_POERE/149-329    AC A0A3P9NV49.1
#=GS A0A674NDT3_TAKRU/146-309    AC A0A674NDT3.1
#=GS F2UHF4_SALR5/159-343        AC F2UHF4.1
#=GS G0PBC5_CAEBE/237-374        AC G0PBC5.1
#=GS A0A672ZEV2_9TELE/163-357    AC A0A672ZEV2.1
#=GS A0A4X3PBM4_PRIPA/168-356    AC A0A4X3PBM4.1
#=GS A0A672MRW7_SINGR/168-352    AC A0A672MRW7.1
#=GS A0A4W6FWB7_LATCA/149-344    AC A0A4W6FWB7.1
#=GS A0A084GAU2_PSEDA/154-336    AC A0A084GAU2.1
#=GS A0A452GBK0_CAPHI/160-343    AC A0A452GBK0.1
#=GS A0A0F7ZLN4_9HYPO/156-337    AC A0A0F7ZLN4.1
#=GS A0A251T4I9_HELAN/171-278    AC A0A251T4I9.1
#=GS A0A4D9ELG9_9SAUR/311-502    AC A0A4D9ELG9.1
#=GS A0A3Q4GJV0_NEOBR/131-321    AC A0A3Q4GJV0.1
#=GS A0A3P9PBE4_POERE/47-234     AC A0A3P9PBE4.1
#=GS A0A674MVU0_TAKRU/128-297    AC A0A674MVU0.1
#=GS H9JQ66_BOMMO/113-309        AC H9JQ66.1
#=GS A0A6J2SWH2_DROLE/531-687    AC A0A6J2SWH2.1
#=GS A0A5D2V239_GOSMU/169-354    AC A0A5D2V239.1
#=GS A0A167N658_PHYB8/290-466    AC A0A167N658.1
#=GS A0A2J6QY30_9HELO/147-328    AC A0A2J6QY30.1
#=GS G5AZ30_HETGA/167-350        AC G5AZ30.1
#=GS A0A6F9BE70_9TELE/129-323    AC A0A6F9BE70.1
#=GS A0A287B766_PIG/180-364      AC A0A287B766.1
#=GS A0A261AP14_9PELO/161-341    AC A0A261AP14.1
#=GS A0A6P6U8U9_COFAR/235-415    AC A0A6P6U8U9.1
#=GS A0A395NS47_TRIAR/65-234     AC A0A395NS47.1
#=GS A0A6P8WTR4_DROAB/536-693    AC A0A6P8WTR4.1
#=GS A0A674ERU4_SALTR/191-376    AC A0A674ERU4.1
#=GS F0VPV8_NEOCL/375-592        AC F0VPV8.1
#=GS A0A093EPF3_TYTAL/44-228     AC A0A093EPF3.1
#=GS A0A3Q1H5W5_ANATE/150-333    AC A0A3Q1H5W5.2
#=GS A0A3P8UH28_CYNSE/148-343    AC A0A3P8UH28.1
#=GS A0A453C021_AEGTS/184-339    AC A0A453C021.1
#=GS A0A6G1B718_CROCR/64-251     AC A0A6G1B718.1
#=GS A0A2H3BJ19_9AGAR/158-343    AC A0A2H3BJ19.1
#=GS A0A0E0NGC8_ORYRU/218-404    AC A0A0E0NGC8.1
#=GS A0A091VK99_OPIHO/127-307    AC A0A091VK99.1
#=GS A0A1L9RLK5_ASPWE/157-338    AC A0A1L9RLK5.1
#=GS A0A6P7SBL9_OCTVU/152-337    AC A0A6P7SBL9.1
#=GS A0A540LYI2_MALBA/223-402    AC A0A540LYI2.1
#=GS A0A075ASG8_ROZAC/130-317    AC A0A075ASG8.1
#=GS A0A136JKS6_9PEZI/220-366    AC A0A136JKS6.1
#=GS A0A2Y9KZJ4_ENHLU/163-347    AC A0A2Y9KZJ4.1
#=GS A0A087QM22_APTFO/1-139      AC A0A087QM22.1
#=GS A0A5C7GYH0_9ROSI/236-410    AC A0A5C7GYH0.1
#=GS A0A1Y1ZZY2_9PLEO/150-331    AC A0A1Y1ZZY2.1
#=GS A0A6J1P0V3_BICAN/702-873    AC A0A6J1P0V3.1
#=GS A0A024WR84_PLAFA/165-332    AC A0A024WR84.1
#=GS G3PX45_GASAC/165-351        AC G3PX45.1
#=GS A0A0N5CV37_THECL/149-332    AC A0A0N5CV37.1
#=GS A0A2I0AUS5_9ASPA/284-463    AC A0A2I0AUS5.1
#=GS A0A093SH01_9PASS/283-474    AC A0A093SH01.1
#=GS A0A370THR8_9HELO/152-333    AC A0A370THR8.1
#=GS A0A096LWJ1_POEFO/556-755    AC A0A096LWJ1.1
#=GS A0A671QZ18_9TELE/150-345    AC A0A671QZ18.1
#=GS A0A1S3FVI9_DIPOR/65-252     AC A0A1S3FVI9.1
#=GS A0A0T6B0M2_9SCAR/501-657    AC A0A0T6B0M2.1
#=GS A0A6G1F5K7_9ORYZ/231-415    AC A0A6G1F5K7.1
#=GS S7ZKV4_PENO1/165-346        AC S7ZKV4.1
#=GS A0A6J3DY14_AYTFU/175-359    AC A0A6J3DY14.1
#=GS A0A5N4BZ96_CAMDR/178-365    AC A0A5N4BZ96.1
#=GS A0A103YFN6_CYNCS/172-311    AC A0A103YFN6.1
#=GS A0A674CRA5_SALTR/163-357    AC A0A674CRA5.1
#=GS A0A1S3XD70_TOBAC/179-361    AC A0A1S3XD70.1
#=GS M3AUF9_SPHMS/150-334        AC M3AUF9.1
#=GS A0A5N4C5Q9_CAMDR/64-251     AC A0A5N4C5Q9.1
#=GS A0A6G0HHK4_LARCR/559-756    AC A0A6G0HHK4.1
#=GS Q7Q4R7_ANOGA/163-349        AC Q7Q4R7.5
#=GS M7Z226_TRIUA/181-366        AC M7Z226.1
#=GS A0A4U1EZ03_MONMO/1-140      AC A0A4U1EZ03.1
#=GS A0A553Q2H4_9TELE/150-297    AC A0A553Q2H4.1
#=GS A0A673ZJS6_SALTR/110-304    AC A0A673ZJS6.1
#=GS H2ZMY9_CIOSA/115-294        AC H2ZMY9.1
#=GS A0A1U7WMU3_NICSY/226-406    AC A0A1U7WMU3.1
#=GS G1ND06_MELGA/115-300        AC G1ND06.2
#=GS A0A673IQN7_9TELE/153-350    AC A0A673IQN7.1
#=GS G7II21_MEDTR/196-381        AC G7II21.1
#=GS A0A5S6PVN0_BRUMA/167-323    AC A0A5S6PVN0.1
#=GS A0A674HDF0_TAEGU/137-321    AC A0A674HDF0.1
#=GS A0A1X2ITV9_9FUNG/273-454    AC A0A1X2ITV9.1
#=GS B3RMN2_TRIAD/142-327        AC B3RMN2.1
#=GS A0A0D9YTH2_9ORYZ/192-367    AC A0A0D9YTH2.1
#=GS D8SJJ7_SELML/206-393        AC D8SJJ7.1
#=GS A0A423TJ95_PENVA/154-340    AC A0A423TJ95.1
#=GS A0A4W5JEJ6_9TELE/394-586    AC A0A4W5JEJ6.1
#=GS A0A453DG00_AEGTS/15-195     AC A0A453DG00.1
#=GS W4KDU6_HETIT/161-340        AC W4KDU6.1
#=GS B4M4G7_DROVI/162-341        AC B4M4G7.1
#=GS A0A3P8X195_CYNSE/135-308    AC A0A3P8X195.1
#=GS PDILT_MACFA/180-365         AC Q95LM0.1
#=GS A0A086T567_ACRC1/156-337    AC A0A086T567.1
#=GS A0A7N8X5H7_9TELE/168-351    AC A0A7N8X5H7.1
#=GS A0A668TWX1_OREAU/129-236    AC A0A668TWX1.1
#=GS A0A6J2T1Z1_DROLE/530-687    AC A0A6J2T1Z1.1
#=GS A0A4W4GCZ6_ELEEL/131-325    AC A0A4W4GCZ6.1
#=GS U7Q523_SPOS1/146-323        AC U7Q523.1
#=GS M3VX30_FELCA/311-428        AC M3VX30.3
#=GS A0A2A2JAL0_9BILA/157-341    AC A0A2A2JAL0.1
#=GS A0A1S3FKN8_DIPOR/309-501    AC A0A1S3FKN8.1
#=GS B0XCN5_CULQU/554-718        AC B0XCN5.1
#=GS A0A367IU16_RHIST/31-134     AC A0A367IU16.1
#=GS A0A6P5LYS2_PHACI/190-376    AC A0A6P5LYS2.1
#=GS A0A6A2Y6V6_HIBSY/169-354    AC A0A6A2Y6V6.1
#=GS A0A665WIR8_ECHNA/167-350    AC A0A665WIR8.1
#=GS A0A016SKS3_9BILA/413-589    AC A0A016SKS3.1
#=GS A0A3P8VRB9_CYNSE/311-503    AC A0A3P8VRB9.1
#=GS A0A2R8QUS4_DANRE/168-352    AC A0A2R8QUS4.1
#=GS A0A3P6RIP0_CYLGO/164-348    AC A0A3P6RIP0.1
#=GS M3W668_FELCA/160-355        AC M3W668.1
#=GS A0A443S9V8_9ACAR/129-291    AC A0A443S9V8.1
#=GS A0A091HX76_CALAN/201-315    AC A0A091HX76.1
#=GS A0A2U3WEL4_ODORO/64-251     AC A0A2U3WEL4.1
#=GS D6WHD6_TRICA/161-345        AC D6WHD6.1
#=GS A0A1I7VBG1_LOALO/163-349    AC A0A1I7VBG1.1
#=GS A0A3Q7GYS3_SOLLC/178-358    AC A0A3Q7GYS3.1
#=GS A0A670YNR2_PSETE/166-349    AC A0A670YNR2.1
#=GS A0A7N6BCK9_ANATE/170-353    AC A0A7N6BCK9.1
#=GS B4H284_DROPE/162-359        AC B4H284.1
#=GS A0A3P7KM07_STRVU/11-164     AC A0A3P7KM07.1
#=GS A0A099Z861_TINGU/1-149      AC A0A099Z861.1
#=GS A0A6I9R6A9_ELAGV/228-408    AC A0A6I9R6A9.1
#=GS X1WDB3_DANRE/3-129          AC X1WDB3.1
#=GS A0A6P4FKG6_DRORH/155-352    AC A0A6P4FKG6.1
#=GS A0A2I4BEJ3_9TELE/544-737    AC A0A2I4BEJ3.1
#=GS A0A3M6UC59_POCDA/165-285    AC A0A3M6UC59.1
#=GS E2B286_CAMFO/161-344        AC E2B286.1
#=GS I3JFG1_ORENI/140-323        AC I3JFG1.2
#=GS A0A6P5TTZ1_PRUAV/224-405    AC A0A6P5TTZ1.1
#=GS A0A1R3IFJ6_9ROSI/176-353    AC A0A1R3IFJ6.1
#=GS A0A7E4W1L6_PANRE/196-380    AC A0A7E4W1L6.1
#=GS A0A6A4MA76_9ERIC/240-432    AC A0A6A4MA76.1
#=GS A0A2P5IEH3_9PEZI/153-334    AC A0A2P5IEH3.1
#=GS A0A1I7V8Z9_LOALO/237-435    AC A0A1I7V8Z9.1
#=GS S8EKF3_FOMPI/161-339        AC S8EKF3.1
#=GS A0A1U8DKA0_ALLSI/320-512    AC A0A1U8DKA0.1
#=GS A0A498SK21_ACAVI/163-346    AC A0A498SK21.1
#=GS A0A6J0L7B6_RAPSA/168-353    AC A0A6J0L7B6.1
#=GS A0A4D9AK01_SALSN/215-400    AC A0A4D9AK01.1
#=GS A0A6J0LRH4_RAPSA/170-354    AC A0A6J0LRH4.1
#=GS A0A1X2HSX3_SYNRA/301-482    AC A0A1X2HSX3.1
#=GS A0A6P6HTF8_PUMCO/179-366    AC A0A6P6HTF8.1
#=GS A0A443NZQ4_9MAGN/232-410    AC A0A443NZQ4.1
#=GS A0A672S0W5_SINGR/149-344    AC A0A672S0W5.1
#=GS A0A2V3IN98_9FLOR/154-338    AC A0A2V3IN98.1
#=GS A0A5F8GUL6_MONDO/175-358    AC A0A5F8GUL6.1
#=GS C1GR41_PARBA/160-341        AC C1GR41.1
#=GS B4I4S6_DROSE/165-298        AC B4I4S6.1
#=GS A0A2K6EXS2_PROCO/140-328    AC A0A2K6EXS2.1
#=GS A0A6I8UAP6_DROPS/162-359    AC A0A6I8UAP6.1
#=GS A0A2K1K838_PHYPA/233-418    AC A0A2K1K838.1
#=GS A0A4W4GUI5_ELEEL/153-336    AC A0A4W4GUI5.1
#=GS A0A2G5DW06_AQUCA/171-355    AC A0A2G5DW06.1
#=GS A0A6P3WRP8_DINQU/553-714    AC A0A6P3WRP8.1
#=GS A0A3P9C1X8_9CICH/148-342    AC A0A3P9C1X8.1
#=GS A0A5A7PY75_STRAF/180-362    AC A0A5A7PY75.1
#=GS A0A3M7PW31_BRAPC/158-343    AC A0A3M7PW31.1
#=GS A0A2H5QTD9_CITUN/42-194     AC A0A2H5QTD9.1
#=GS A0A0V1LTP1_9BILA/177-361    AC A0A0V1LTP1.1
#=GS A0A0V1BSI0_TRISP/116-291    AC A0A0V1BSI0.1
#=GS A0A4W5N3Z3_9TELE/141-320    AC A0A4W5N3Z3.1
#=GS A0A5J5B9L5_9ASTE/231-411    AC A0A5J5B9L5.1
#=GS A0A5J5BQP4_9ASTE/219-398    AC A0A5J5BQP4.1
#=GS A0A6J2I6C7_9PASS/167-350    AC A0A6J2I6C7.1
#=GS A0A3B0JCU2_DROGU/140-301    AC A0A3B0JCU2.1
#=GS A0A6J3KUB9_9HYME/159-343    AC A0A6J3KUB9.1
#=GS A0A6J3JGA7_SAPAP/160-355    AC A0A6J3JGA7.1
#=GS H2YVH1_CIOSA/163-345        AC H2YVH1.1
#=GS A0A2A2LJ50_9BILA/205-343    AC A0A2A2LJ50.1
#=GS A0A1Y1WQ93_9FUNG/176-371    AC A0A1Y1WQ93.1
#=GS A0A673UQJ1_SURSU/187-304    AC A0A673UQJ1.1
#=GS A0A445FVG9_GLYSO/197-306    AC A0A445FVG9.1
#=GS L8IJI0_9CETA/180-365        AC L8IJI0.1
#=GS A0A167FN73_METRR/156-337    AC A0A167FN73.1
#=GS A0A482R4J7_9EURY/130-273    AC A0A482R4J7.1
#=GS A0A2R5GL95_9STRA/156-339    AC A0A2R5GL95.1
#=GS A0A6P8PA94_GEOSA/312-503    AC A0A6P8PA94.1
#=GS A0A0D2XX19_FUSO4/318-430    AC A0A0D2XX19.1
#=GS A0A0V0YAF3_TRIPS/171-355    AC A0A0V0YAF3.1
#=GS A0A0D3DQU3_BRAOL/168-352    AC A0A0D3DQU3.1
#=GS A0A6P7JYU6_9TELE/158-352    AC A0A6P7JYU6.1
#=GS A0A4W4HBE7_ELEEL/150-345    AC A0A4W4HBE7.1
#=GS I2JW68_DEKBR/169-350        AC I2JW68.1
#=GS A0A3P6UX89_LITSI/200-387    AC A0A3P6UX89.1
#=GS A0A0N0U3A0_9HYME/151-349    AC A0A0N0U3A0.1
#=GS T1EE17_HELRO/147-332        AC T1EE17.1
#=GS A0A5C6MXP4_9TELE/200-392    AC A0A5C6MXP4.1
#=GS A0A0W0FK37_9AGAR/163-348    AC A0A0W0FK37.1
#=GS A0A0D3FW11_9ORYZ/183-355    AC A0A0D3FW11.1
#=GS A0A2T0FC20_9ASCO/156-337    AC A0A2T0FC20.1
#=GS A0A0D2S054_GOSRA/213-397    AC A0A0D2S054.1
#=GS A0A137P7I6_CONC2/1-110      AC A0A137P7I6.1
#=GS A0A1D5RKD4_MACMU/163-347    AC A0A1D5RKD4.2
#=GS A0A218UB60_9PASE/319-510    AC A0A218UB60.1
#=GS A0A485MUN1_LYNPA/194-311    AC A0A485MUN1.1
#=GS A0A6Q2X4K8_ESOLU/230-415    AC A0A6Q2X4K8.1
#=GS A0A077ZJZ3_TRITR/158-342    AC A0A077ZJZ3.1
#=GS A0A3Q0HFA4_ALLSI/201-316    AC A0A3Q0HFA4.1
#=GS A0A3P8T857_AMPPE/160-343    AC A0A3P8T857.1
#=GS A0A6Q2XEC9_ESOLU/152-345    AC A0A6Q2XEC9.1
#=GS A0A6I9VHM9_BACDO/535-691    AC A0A6I9VHM9.1
#=GS A0A010QKZ1_9PEZI/173-346    AC A0A010QKZ1.1
#=GS A0A4W5R8I7_9TELE/124-318    AC A0A4W5R8I7.1
#=GS A0A7N4P5G7_SARHA/263-449    AC A0A7N4P5G7.1
#=GS A0A2K5ZY12_MANLE/158-338    AC A0A2K5ZY12.1
#=GS A0A0E0MDJ6_ORYPU/180-365    AC A0A0E0MDJ6.1
#=GS C3YCF8_BRAFL/158-324        AC C3YCF8.1
#=GS R8BF18_TOGMI/153-334        AC R8BF18.1
#=GS A0A667XR59_9TELE/145-328    AC A0A667XR59.1
#=GS A0A4S8K3R2_MUSBA/237-418    AC A0A4S8K3R2.1
#=GS A0A3R7L858_TRYRA/152-328    AC A0A3R7L858.1
#=GS A0A151GG08_9HYPO/155-336    AC A0A151GG08.1
#=GS A0A3P8SUM2_AMPPE/154-328    AC A0A3P8SUM2.1
#=GS A0A1B6PL31_SORBI/172-356    AC A0A1B6PL31.1
#=GS A0A229X3U9_9EURO/161-342    AC A0A229X3U9.1
#=GS A0A3S0ZS10_ELYCH/163-349    AC A0A3S0ZS10.1
#=GS A0A7N6FGV2_ANATE/159-343    AC A0A7N6FGV2.1
#=GS A0A4D9BUH7_SALSN/166-349    AC A0A4D9BUH7.1
#=GS A0A6P7M7K1_BETSP/126-313    AC A0A6P7M7K1.1
#=GS D3K382_CAPHI/160-355        AC D3K382.1
#=GS A0A6J1PBY8_9HYME/170-372    AC A0A6J1PBY8.1
#=GS A0A672N9N6_SINGR/224-413    AC A0A672N9N6.1
#=GS A0A6J3FMK5_SAPAP/463-652    AC A0A6J3FMK5.1
#=GS A0A287NYR9_HORVV/107-266    AC A0A287NYR9.1
#=GS A0A1J4KX11_9EUKA/146-318    AC A0A1J4KX11.1
#=GS A0A671N5N0_9TELE/285-477    AC A0A671N5N0.1
#=GS A9UX07_MONBE/122-297        AC A9UX07.1
#=GS A0A0G4EK32_VITBC/156-324    AC A0A0G4EK32.1
#=GS A0A6P5A0V1_BRABE/155-346    AC A0A6P5A0V1.1
#=GS G4MW51_MAGO7/79-222         AC G4MW51.1
#=GS A0A5B6X4Y4_9ROSI/213-397    AC A0A5B6X4Y4.1
#=GS A0A3B6TE48_WHEAT/204-384    AC A0A3B6TE48.1
#=GS H2LX92_ORYLA/202-387        AC H2LX92.2
#=GS A0A1S4A6U7_TOBAC/162-348    AC A0A1S4A6U7.1
#=GS A0A3P8WT92_CYNSE/155-335    AC A0A3P8WT92.1
#=GS A0A673YXM3_SALTR/98-267     AC A0A673YXM3.1
#=GS B4QZL9_DROSI/165-352        AC B4QZL9.1
#=GS A0A5N6SCT7_ASPPS/161-342    AC A0A5N6SCT7.1
#=GS A0A096MWP6_PAPAN/64-251     AC A0A096MWP6.1
#=GS A0A3Q1F7R3_9TELE/46-234     AC A0A3Q1F7R3.1
#=GS A0A091K359_EGRGA/123-304    AC A0A091K359.1
#=GS A0A673GJI4_9TELE/151-346    AC A0A673GJI4.1
#=GS A0A2P5IE81_9PEZI/46-225     AC A0A2P5IE81.1
#=GS A0A0N4V8R3_ENTVE/157-344    AC A0A0N4V8R3.1
#=GS W5JR44_ANODA/336-498        AC W5JR44.1
#=GS A0A667Z3I5_9TELE/155-334    AC A0A667Z3I5.1
#=GS A0A151ZDZ3_9MYCE/363-566    AC A0A151ZDZ3.1
#=GS A0A087TCT3_STEMI/67-233     AC A0A087TCT3.1
#=GS A0A0H4BK46_STIJA/168-342    AC A0A0H4BK46.1
#=GS A0A2H6KHV2_9APIC/162-328    AC A0A2H6KHV2.1
#=GS A0A067LHH9_JATCU/236-416    AC A0A067LHH9.1
#=GS A0A0V1CJ39_TRIBR/214-404    AC A0A0V1CJ39.1
#=GS A0A251SFT9_HELAN/177-362    AC A0A251SFT9.1
#=GS A0A287II78_HORVV/1-125      AC A0A287II78.1
#=GS S9V6G7_9TRYP/153-333        AC S9V6G7.1
#=GS A0A096NH79_PAPAN/180-365    AC A0A096NH79.1
#=GS A0A2A2LBU6_9BILA/158-340    AC A0A2A2LBU6.1
#=GS F7G717_MONDO/184-371        AC F7G717.2
#=GS A0A0R3PTN2_ANGCS/139-321    AC A0A0R3PTN2.1
#=GS A0A210PWA6_MIZYE/289-482    AC A0A210PWA6.1
#=GS A0A2P5XQN8_GOSBA/169-354    AC A0A2P5XQN8.1
#=GS A0A1D3TKS8_9APIC/198-379    AC A0A1D3TKS8.1
#=GS A0A340X2Y1_LIPVE/313-428    AC A0A340X2Y1.1
#=GS A0A6A4J420_APOLU/148-335    AC A0A6A4J420.1
#=GS A0A2K5F1I6_AOTNA/533-722    AC A0A2K5F1I6.1
#=GS A0A0P7V7X7_SCLFO/178-360    AC A0A0P7V7X7.1
#=GS A0A2H2IIQ2_CAEJA/154-342    AC A0A2H2IIQ2.1
#=GS A0A2K6AUK8_MACNE/160-355    AC A0A2K6AUK8.1
#=GS A0A6P5TQ12_PRUAV/212-397    AC A0A6P5TQ12.1
#=GS A0A7P0Z4S2_HUMAN/195-279    AC A0A7P0Z4S2.1
#=GS F2UL09_SALR5/163-335        AC F2UL09.1
#=GS A0A199UJ25_ANACO/185-370    AC A0A199UJ25.1
#=GS A0A1D3CV74_9EIME/169-337    AC A0A1D3CV74.1
#=GS A0A2Y9LRR5_DELLE/180-365    AC A0A2Y9LRR5.1
#=GS V4T8L8_CITCL/185-363        AC V4T8L8.1
#=GS A0A7N8X1H1_9TELE/150-345    AC A0A7N8X1H1.1
#=GS A0A091D3D3_FUKDA/191-345    AC A0A091D3D3.1
#=GS A0A3Q0CPL0_MESAU/160-355    AC A0A3Q0CPL0.1
#=GS A0A0R3T280_RODNA/8-212      AC A0A0R3T280.1
#=GS A0A3P6GD21_9CEST/134-275    AC A0A3P6GD21.1
#=GS A0A3Q0E703_CARSF/132-312    AC A0A3Q0E703.1
#=GS A0A314ZIF4_PRUYE/276-384    AC A0A314ZIF4.1
#=GS A0A1R1PYN9_ZANCU/185-364    AC A0A1R1PYN9.1
#=GS A0A158ND66_ATTCE/170-372    AC A0A158ND66.1
#=GS A0A6F9C8C6_9TELE/101-285    AC A0A6F9C8C6.1
#=GS A0A673KS22_9TELE/168-352    AC A0A673KS22.1
#=GS A0A674E580_SALTR/134-317    AC A0A674E580.1
#=GS A0A2I2Z610_GORGO/2-143      AC A0A2I2Z610.1
#=GS U3JQE4_FICAL/105-288        AC U3JQE4.1
#=GS A0A453HJY5_AEGTS/118-303    AC A0A453HJY5.1
#=GS A0A6F9B7I1_9TELE/149-344    AC A0A6F9B7I1.1
#=GS A0A0G4N8Z1_9PEZI/140-350    AC A0A0G4N8Z1.1
#=GS A0A3Q1D106_AMPOC/165-349    AC A0A3Q1D106.1
#=GS A0A015KIY8_RHIIW/312-497    AC A0A015KIY8.1
#=GS A0A195FGR4_9HYME/151-353    AC A0A195FGR4.1
#=GS A0A2T3ZNE2_9HYPO/146-317    AC A0A2T3ZNE2.1
#=GS A0A2U1MC18_ARTAN/469-654    AC A0A2U1MC18.1
#=GS A0A484B226_DRONA/168-354    AC A0A484B226.1
#=GS A0A1N6LWQ8_BABMR/186-329    AC A0A1N6LWQ8.1
#=GS Q751V7_ASHGO/171-346        AC Q751V7.2
#=GS A0A2H3JJG6_WOLCO/307-491    AC A0A2H3JJG6.1
#=GS A0A087VIN1_BALRE/98-293     AC A0A087VIN1.1
#=GS A0A5F4D866_CANLF/157-320    AC A0A5F4D866.1
#=GS A0A2I4GXR6_JUGRE/177-354    AC A0A2I4GXR6.1
#=GS A0A6J1T706_FRAOC/166-352    AC A0A6J1T706.1
#=GS A0A1Y2H1D1_9FUNG/310-472    AC A0A1Y2H1D1.1
#=GS A0A6J2TU06_DROLE/39-223     AC A0A6J2TU06.1
#=GS A0A6J1XG10_ACIJB/15-202     AC A0A6J1XG10.1
#=GS A0A0V0UCC0_9BILA/172-356    AC A0A0V0UCC0.1
#=GS A0A2H5QSS4_CITUN/641-797    AC A0A2H5QSS4.1
#=GS A0A6P6LIG9_CARAU/33-225     AC A0A6P6LIG9.1
#=GS A0A3Q7IZQ5_SOLLC/237-415    AC A0A3Q7IZQ5.1
#=GS W9HY93_FUSOX/150-330        AC W9HY93.1
#=GS A0A0V1P9W8_9BILA/172-356    AC A0A0V1P9W8.1
#=GS A0A2C9WFE9_MANES/174-350    AC A0A2C9WFE9.1
#=GS A0A6I9J8P3_CHRAS/262-443    AC A0A6I9J8P3.1
#=GS E9GYE5_DAPPU/167-353        AC E9GYE5.1
#=GS A0A4P9XW86_9FUNG/169-350    AC A0A4P9XW86.1
#=GS A0A034WBP8_BACDO/165-351    AC A0A034WBP8.1
#=GS H0V2A0_CAVPO/180-364        AC H0V2A0.2
#=GS A0A6I8VRC6_DROPS/520-675    AC A0A6I8VRC6.1
#=GS A0A0E0H135_ORYNI/170-354    AC A0A0E0H135.1
#=GS A0A673L8A0_9TELE/178-356    AC A0A673L8A0.1
#=GS A0A2I4D616_9TELE/159-343    AC A0A2I4D616.1
#=GS A0A6J2JHM3_BOMMA/158-343    AC A0A6J2JHM3.1
#=GS A0A074X0K6_9PEZI/151-331    AC A0A074X0K6.1
#=GS A0A512UER8_9ASCO/224-370    AC A0A512UER8.1
#=GS A0A6J3J4X7_SAPAP/158-338    AC A0A6J3J4X7.1
#=GS A0A0E0FZQ3_ORYNI/210-404    AC A0A0E0FZQ3.1
#=GS A0A167QDB5_9PEZI/118-291    AC A0A167QDB5.1
#=GS W2TLR4_NECAM/12-209         AC W2TLR4.1
#=GS A0A669Q1X9_PHACC/297-412    AC A0A669Q1X9.1
#=GS A0A6J0NLL2_RAPSA/58-147     AC A0A6J0NLL2.1
#=GS A0A3Q1CTG3_AMPOC/168-351    AC A0A3Q1CTG3.1
#=GS A0A6J1BGG7_9ROSI/213-398    AC A0A6J1BGG7.1
#=GS A0A669Q4M4_PHACC/123-232    AC A0A669Q4M4.1
#=GS A0A287II84_HORVV/1-123      AC A0A287II84.1
#=GS A0A2I0TAK8_LIMLA/105-242    AC A0A2I0TAK8.1
#=GS A0A6Q2ZBB9_ESOLU/158-352    AC A0A6Q2ZBB9.1
#=GS A0A7E6ERQ2_OCTVU/15-203     AC A0A7E6ERQ2.1
#=GS A0A668SDA6_OREAU/197-385    AC A0A668SDA6.1
#=GS U3DAB3_CALJA/158-338        AC U3DAB3.1
#=GS A0A6I9KQW4_CHRAS/180-365    AC A0A6I9KQW4.1
#=GS A0A4W5N3Y0_9TELE/157-351    AC A0A4W5N3Y0.1
#=GS A0A1E5VRN1_9POAL/187-361    AC A0A1E5VRN1.1
#=GS G3WFP5_SARHA/166-349        AC G3WFP5.2
#=GS A0A218V7Y9_9PASE/100-207    AC A0A218V7Y9.1
#=GS A0A1Y1JIM3_PLAGO/199-380    AC A0A1Y1JIM3.1
#=GS A0A2P6NVB4_9EUKA/180-361    AC A0A2P6NVB4.1
#=GS A0A067RD96_ZOONE/114-310    AC A0A067RD96.1
#=GS A0A078AC45_STYLE/269-385    AC A0A078AC45.1
#=GS G3SNI0_LOXAF/162-346        AC G3SNI0.1
#=GS PDIA3_MOUSE/160-355         AC P27773.2
#=GS A0A3Q1HZN7_ANATE/152-336    AC A0A3Q1HZN7.2
#=GS A0A3Q2HSV9_HORSE/64-251     AC A0A3Q2HSV9.1
#=GS A0A103YBE9_CYNCS/209-377    AC A0A103YBE9.1
#=GS A0A671PZE0_9TELE/152-346    AC A0A671PZE0.1
#=GS W7JQ08_PLAFA/165-332        AC W7JQ08.1
#=GS A0A0L9UFQ8_PHAAN/171-356    AC A0A0L9UFQ8.1
#=GS A0A0S3RD91_PHAAN/171-356    AC A0A0S3RD91.1
#=GS A0A3B1II08_ASTMX/155-345    AC A0A3B1II08.1
#=GS A0A0E0K124_ORYPU/454-634    AC A0A0E0K124.1
#=GS A0A3Q2ZGT1_KRYMA/158-351    AC A0A3Q2ZGT1.1
#=GS A0A2R9BPX1_PANPA/152-347    AC A0A2R9BPX1.1
#=GS A0A6A3BUE8_HIBSY/173-340    AC A0A6A3BUE8.1
#=GS PDILT_MOUSE/177-362         AC Q9DAN1.2
#=GS N1RET8_FUSC4/457-569        AC N1RET8.1
#=GS A0A0B1S8E1_OESDE/2-79       AC A0A0B1S8E1.1
#=GS A0A1U7RH50_MESAU/310-502    AC A0A1U7RH50.1
#=GS A0A2A4IT93_HELVI/449-605    AC A0A2A4IT93.1
#=GS A0A066XT40_COLSU/149-319    AC A0A066XT40.1
#=GS A0A091JVT5_EGRGA/78-273     AC A0A091JVT5.1
#=GS A0A6G0X952_9STRA/167-348    AC A0A6G0X952.1
#=GS A0A2I0W4H0_9ASPA/171-354    AC A0A2I0W4H0.1
#=GS A0A6J1K269_CUCMA/184-365    AC A0A6J1K269.1
#=GS A0A446VG90_TRITD/130-298    AC A0A446VG90.1
#=GS U3J3L7_ANAPP/121-305        AC U3J3L7.2
#=GS H2LU59_ORYLA/154-334        AC H2LU59.2
#=GS A0A5F4DJ87_CANLF/163-347    AC A0A5F4DJ87.1
#=GS U6GX23_EIMAC/227-438        AC U6GX23.1
#=GS A0A2T7E2P3_9POAL/203-388    AC A0A2T7E2P3.1
#=GS A0A6A6Z0G0_9PEZI/151-332    AC A0A6A6Z0G0.1
#=GS A0A0C3PVV2_PISTI/160-345    AC A0A0C3PVV2.1
#=GS A0A2I3NBR1_PAPAN/311-426    AC A0A2I3NBR1.1
#=GS A0A671E3S5_RHIFE/162-346    AC A0A671E3S5.1
#=GS A0A7F5RCW6_AGRPL/168-354    AC A0A7F5RCW6.1
#=GS A0A066W3C3_TILAU/106-288    AC A0A066W3C3.1
#=GS A0A0R3U3H9_9CEST/157-336    AC A0A0R3U3H9.1
#=GS E4XTQ0_OIKDI/160-336        AC E4XTQ0.1
#=GS A0A395SSN0_9HYPO/155-336    AC A0A395SSN0.1
#=GS A0A0R3VX09_TAEAS/157-341    AC A0A0R3VX09.1
#=GS A0A066X8J7_COLSU/152-333    AC A0A066X8J7.1
#=GS A0A2Y9QLD6_TRIMA/158-338    AC A0A2Y9QLD6.1
#=GS F4RQ49_MELLP/158-342        AC F4RQ49.1
#=GS B0WFQ4_CULQU/160-344        AC B0WFQ4.1
#=GS A0A2U3X7U7_LEPWE/60-255     AC A0A2U3X7U7.2
#=GS A0A5E4BW42_MARMO/51-234     AC A0A5E4BW42.1
#=GS A0A4D8YJS6_SALSN/178-359    AC A0A4D8YJS6.1
#=GS A0A4W2HSC6_BOBOX/180-365    AC A0A4W2HSC6.1
#=GS A0A135V369_9PEZI/152-333    AC A0A135V369.1
#=GS A0A6P3X372_DINQU/167-361    AC A0A6P3X372.1
#=GS A0A0K0FZF9_STRVS/155-337    AC A0A0K0FZF9.1
#=GS A0A0D9YTL1_9ORYZ/218-404    AC A0A0D9YTL1.1
#=GS I3J5M6_ORENI/159-343        AC I3J5M6.2
#=GS C1L502_SCHJA/159-342        AC C1L502.1
#=GS N4UGK6_FUSC1/457-569        AC N4UGK6.1
#=GS I4DIQ3_PAPXU/159-344        AC I4DIQ3.1
#=GS A0A0B2VF53_TOXCA/21-132     AC A0A0B2VF53.1
#=GS A0A2K5DYK3_AOTNA/9-150      AC A0A2K5DYK3.1
#=GS A0A341CL30_NEOAA/183-274    AC A0A341CL30.1
#=GS A0A2A3E8F9_APICC/159-343    AC A0A2A3E8F9.1
#=GS A0A3P8ZID7_ESOLU/160-332    AC A0A3P8ZID7.2
#=GS A0A2K5F6Q1_AOTNA/180-365    AC A0A2K5F6Q1.1
#=GS A0A3P9PBP9_POERE/47-234     AC A0A3P9PBP9.1
#=GS H3A399_LATCH/158-342        AC H3A399.1
#=GS A0A3Q7SEA5_VULVU/158-338    AC A0A3Q7SEA5.1
#=GS A0A059EZH3_9MICR/304-445    AC A0A059EZH3.1
#=GS A0A674KIH1_TERCA/60-175     AC A0A674KIH1.1
#=GS A0A067G0Y1_CITSI/1-139      AC A0A067G0Y1.1
#=GS W5NA80_LEPOC/175-370        AC W5NA80.1
#=GS A0A0D2MFD8_9CHLO/181-281    AC A0A0D2MFD8.1
#=GS A0A178ZZX1_9EURO/50-210     AC A0A178ZZX1.1
#=GS A0A226MH27_CALSU/210-325    AC A0A226MH27.1
#=GS A0A3P9AWY9_9CICH/546-743    AC A0A3P9AWY9.1
#=GS A0A4Q1BG12_TREME/314-473    AC A0A4Q1BG12.1
#=GS A0A673IX05_9TELE/144-316    AC A0A673IX05.1
#=GS A0A540LZR9_MALBA/183-338    AC A0A540LZR9.1
#=GS W5PMM7_SHEEP/104-299        AC W5PMM7.1
#=GS K3YZL9_SETIT/167-351        AC K3YZL9.1
#=GS A0A6A4KQ47_9ERIC/166-353    AC A0A6A4KQ47.1
#=GS A0A443RZZ1_9ACAR/1-117      AC A0A443RZZ1.1
#=GS V4KAC1_EUTSA/168-352        AC V4KAC1.1
#=GS A0A139A1Q7_GONPJ/322-509    AC A0A139A1Q7.1
#=GS X0BF87_FUSOX/146-319        AC X0BF87.1
#=GS A0A671S218_9TELE/118-281    AC A0A671S218.1
#=GS A0A384ALZ4_BALAS/177-362    AC A0A384ALZ4.1
#=GS A0A6Q2Z0A4_ESOLU/159-342    AC A0A6Q2Z0A4.1
#=GS A0A671N9L3_9TELE/310-502    AC A0A671N9L3.1
#=GS A0A1S3D615_DIACI/165-326    AC A0A1S3D615.1
#=GS A0A1C7M241_GRIFR/164-345    AC A0A1C7M241.1
#=GS A0A6G0U8J7_APHGL/163-350    AC A0A6G0U8J7.1
#=GS A0A674NQY5_TAKRU/159-343    AC A0A674NQY5.1
#=GS A0A6J0MI45_RAPSA/240-417    AC A0A6J0MI45.1
#=GS A0A6J2YCL2_SITOR/165-351    AC A0A6J2YCL2.1
#=GS A0A3P6VC75_LITSI/177-360    AC A0A3P6VC75.1
#=GS J8LJC2_SACAR/169-337        AC J8LJC2.1
#=GS A0A6A6K9H3_HEVBR/236-341    AC A0A6A6K9H3.1
#=GS A0A668ST29_OREAU/151-339    AC A0A668ST29.1
#=GS A0A5C2SW05_9APHY/154-342    AC A0A5C2SW05.1
#=GS A0A2T7NH06_POMCA/129-318    AC A0A2T7NH06.1
#=GS A0A4W3IG92_CALMI/83-266     AC A0A4W3IG92.1
#=GS A0A3M0L8R2_HIRRU/141-313    AC A0A3M0L8R2.1
#=GS A0A0B7FRG6_THACB/152-338    AC A0A0B7FRG6.1
#=GS A0A091KGI6_9GRUI/72-255     AC A0A091KGI6.1
#=GS A0A4Z2CMK3_SCHJA/159-342    AC A0A4Z2CMK3.1
#=GS A0A251VFV6_HELAN/171-347    AC A0A251VFV6.1
#=GS A0A3Q3RRL5_9TELE/158-341    AC A0A3Q3RRL5.2
#=GS L2G5I3_COLFN/145-317        AC L2G5I3.1
#=GS A0A1A6HTP7_NEOLE/1-74       AC A0A1A6HTP7.1
#=GS A0A0R0JFJ6_SOYBN/157-252    AC A0A0R0JFJ6.1
#=GS A0A493TNP0_ANAPP/47-162     AC A0A493TNP0.1
#=GS A0A2K5WUB6_MACFA/234-421    AC A0A2K5WUB6.2
#=GS A0A5N5J4H6_9ROSI/181-357    AC A0A5N5J4H6.1
#=GS A0A2R8MXP0_CALJA/9-150      AC A0A2R8MXP0.1
#=GS A0A3P8YKM3_ESOLU/133-327    AC A0A3P8YKM3.2
#=GS A0A3Q7TAK8_VULVU/303-495    AC A0A3Q7TAK8.1
#=GS A0A443P3A1_9MAGN/205-336    AC A0A443P3A1.1
#=GS A0A2Y9NV33_DELLE/63-250     AC A0A2Y9NV33.1
#=GS A0A194Q8C1_PAPXU/169-355    AC A0A194Q8C1.1
#=GS A0A0V1LK60_9BILA/153-341    AC A0A0V1LK60.1
#=GS A0A4W4GFS7_ELEEL/209-327    AC A0A4W4GFS7.1
#=GS A0A0D2C5C8_9EURO/157-343    AC A0A0D2C5C8.1
#=GS B0DKF7_LACBS/309-463        AC B0DKF7.1
#=GS A0A6P5A4I4_BRABE/164-347    AC A0A6P5A4I4.1
#=GS A0A3M2S930_9HYPO/454-563    AC A0A3M2S930.1
#=GS A0A498SA88_ACAVI/166-353    AC A0A498SA88.1
#=GS A0A3M7SXL1_BRAPC/199-389    AC A0A3M7SXL1.1
#=GS A0A1S3QAY5_SALSA/306-498    AC A0A1S3QAY5.1
#=GS A0A4W5Q8D7_9TELE/100-267    AC A0A4W5Q8D7.1
#=GS A0A6A6KSM6_HEVBR/103-281    AC A0A6A6KSM6.1
#=GS A0A341ADU1_NEOAA/63-250     AC A0A341ADU1.1
#=GS A0A3Q3EHZ0_9LABR/167-351    AC A0A3Q3EHZ0.1
#=GS A0A2I4AI80_9TELE/155-336    AC A0A2I4AI80.1
#=GS B4QDC1_DROSI/237-361        AC B4QDC1.1
#=GS K3Y8Z9_SETIT/66-243         AC K3Y8Z9.1
#=GS A0A673A7G2_9TELE/200-386    AC A0A673A7G2.1
#=GS A0A369HCA3_9HYPO/156-337    AC A0A369HCA3.1
#=GS A0A4S4EBW0_CAMSI/195-281    AC A0A4S4EBW0.1
#=GS S7MUF7_MYOBR/64-251         AC S7MUF7.1
#=GS A0A5B6UBF2_9ROSI/173-339    AC A0A5B6UBF2.1
#=GS A0A6P3VJP2_CLUHA/158-342    AC A0A6P3VJP2.1
#=GS A0A6J5V5V1_PRUAR/226-407    AC A0A6J5V5V1.1
#=GS E5QZ06_ARTGP/166-343        AC E5QZ06.1
#=GS A0A484GUR9_SOUCH/180-365    AC A0A484GUR9.1
#=GS A0A087VHV0_BALRE/283-474    AC A0A087VHV0.1
#=GS A0A4W2ETT4_BOBOX/530-719    AC A0A4W2ETT4.1
#=GS A0A151IL32_9HYME/193-396    AC A0A151IL32.1
#=GS A0A4W6EPY1_LATCA/208-394    AC A0A4W6EPY1.1
#=GS A0A3P8RNJ0_AMPPE/163-346    AC A0A3P8RNJ0.1
#=GS A0A672S1E1_SINGR/149-344    AC A0A672S1E1.1
#=GS A0A402F975_9SAUR/227-407    AC A0A402F975.1
#=GS A0A0F4YVZ8_TALEM/157-338    AC A0A0F4YVZ8.1
#=GS A0A6P8X5U6_DROAB/158-342    AC A0A6P8X5U6.1
#=GS A0A4W4HBK3_ELEEL/149-344    AC A0A4W4HBK3.1
#=GS G2HF11_PANTR/161-345        AC G2HF11.1
#=GS A0A452SIK4_URSAM/136-305    AC A0A452SIK4.1
#=GS F6HNH0_VITVI/213-398        AC F6HNH0.1
#=GS A0A0D9VB03_9ORYZ/213-397    AC A0A0D9VB03.1
#=GS A0A2A9MMI1_9APIC/632-819    AC A0A2A9MMI1.1
#=GS A0A6P9D8D4_PANGU/155-346    AC A0A6P9D8D4.1
#=GS A0A2Y9DKG5_TRIMA/241-432    AC A0A2Y9DKG5.1
#=GS A0A3Q3M4L6_9TELE/176-355    AC A0A3Q3M4L6.1
#=GS C5DZ36_ZYGRC/163-330        AC C5DZ36.1
#=GS A0A0D9YKX2_9ORYZ/280-372    AC A0A0D9YKX2.1
#=GS A0A3B0J7U5_DROGU/158-342    AC A0A3B0J7U5.1
#=GS E2C3Q5_HARSA/149-335        AC E2C3Q5.1
#=GS L2GM55_VITCO/117-270        AC L2GM55.1
#=GS A0A453HK38_AEGTS/102-287    AC A0A453HK38.1
#=GS A0A1X6P6S8_PORUM/187-357    AC A0A1X6P6S8.1
#=GS A0A118K5Y0_CYNCS/194-374    AC A0A118K5Y0.1
#=GS A0A6A4MG62_9ERIC/210-395    AC A0A6A4MG62.1
#=GS A0A6P3QEW4_PTEVA/306-498    AC A0A6P3QEW4.1
#=GS A0A5F8ABB1_MACMU/310-502    AC A0A5F8ABB1.1
#=GS A0A446RWU1_TRITD/176-361    AC A0A446RWU1.1
#=GS V7AHC4_PHAVU/241-421        AC V7AHC4.1
#=GS A0A1V6T2L8_9EURO/159-340    AC A0A1V6T2L8.1
#=GS A0A1B6PQR2_SORBI/173-358    AC A0A1B6PQR2.1
#=GS A0A315W091_GAMAF/159-343    AC A0A315W091.1
#=GS A0A6A3B140_HIBSY/180-354    AC A0A6A3B140.1
#=GS A0A2K5XNH6_MANLE/175-358    AC A0A2K5XNH6.1
#=GS A0A2A2LAB4_9BILA/368-547    AC A0A2A2LAB4.1
#=GS A0A6J0BVD0_NEOLC/536-691    AC A0A6J0BVD0.1
#=GS A0A6P3F5U3_OCTDE/163-347    AC A0A6P3F5U3.1
#=GS A0A061FKP7_THECC/174-349    AC A0A061FKP7.1
#=GS F0ZEV7_DICPU/464-663        AC F0ZEV7.1
#=GS A0A4U0UCB3_9PEZI/150-334    AC A0A4U0UCB3.1
#=GS A0A2S7QFL0_9HELO/142-323    AC A0A2S7QFL0.1
#=GS A0A3Q7VAH9_URSAR/64-251     AC A0A3Q7VAH9.1
#=GS A0A2F0AV40_ESCRO/2-138      AC A0A2F0AV40.1
#=GS S4RYD0_PETMA/112-193        AC S4RYD0.1
#=GS A0A2Y9DFU5_TRIMA/176-359    AC A0A2Y9DFU5.1
#=GS A0A026WCE2_OOCBI/157-343    AC A0A026WCE2.1
#=GS A0A2G3CLV9_CAPCH/214-354    AC A0A2G3CLV9.1
#=GS A0A674EFD3_SALTR/47-235     AC A0A674EFD3.1
#=GS A0A0C3DAS2_9AGAM/7-159      AC A0A0C3DAS2.1
#=GS A0A2G9GVI7_9LAMI/205-364    AC A0A2G9GVI7.1
#=GS A0A2P5Y848_GOSBA/676-819    AC A0A2P5Y848.1
#=GS A0A2H5QST0_CITUN/560-722    AC A0A2H5QST0.1
#=GS A0A669DSW2_ORENI/172-355    AC A0A669DSW2.1
#=GS A0A5N5MVB6_9PEZI/123-298    AC A0A5N5MVB6.1
#=GS A0A196SIM6_BLAHN/1067-1254  AC A0A196SIM6.1
#=GS A0A668SWW3_OREAU/172-366    AC A0A668SWW3.1
#=GS A0A4W6DW81_LATCA/146-340    AC A0A4W6DW81.1
#=GS A0A167XZD0_9EURO/167-348    AC A0A167XZD0.1
#=GS A0A4W5QDR3_9TELE/105-299    AC A0A4W5QDR3.1
#=GS A0A445A9X7_ARAHY/290-469    AC A0A445A9X7.1
#=GS A0A0V1A4Z9_9BILA/398-582    AC A0A0V1A4Z9.1
#=GS A0A4S8I7G0_MUSBA/223-368    AC A0A4S8I7G0.1
#=GS A0A5F9DTT1_RABIT/167-350    AC A0A5F9DTT1.1
#=GS A0A3Q7Y9W8_URSAR/180-365    AC A0A3Q7Y9W8.1
#=GS A0A482VK28_9CUCU/157-344    AC A0A482VK28.1
#=GS A0A5N5PYC5_PANHP/160-344    AC A0A5N5PYC5.1
#=GS A0A2G9UL28_TELCI/67-263     AC A0A2G9UL28.1
#=GS E0VG74_PEDHC/105-291        AC E0VG74.1
#=GS B5SNJ7_OTOGA/161-356        AC B5SNJ7.1
#=GS A0A2H5P2A5_CITUN/256-400    AC A0A2H5P2A5.1
#=GS A0A6I9NEV4_9TELE/149-344    AC A0A6I9NEV4.1
#=GS F4W6B6_ACREC/160-344        AC F4W6B6.1
#=GS A0A1U7TKL5_CARSF/180-365    AC A0A1U7TKL5.1
#=GS A0A0G4GJK2_VITBC/265-389    AC A0A0G4GJK2.1
#=GS A0A218UU71_9PASE/203-318    AC A0A218UU71.1
#=GS Q5CPJ7_CRYPI/168-340        AC Q5CPJ7.1
#=GS A0A482XG57_LAOST/158-345    AC A0A482XG57.1
#=GS A0A2I0UMC0_LIMLA/64-250     AC A0A2I0UMC0.1
#=GS A0A670XUS1_PSETE/8-152      AC A0A670XUS1.1
#=GS L1JMY3_GUITC/214-407        AC L1JMY3.1
#=GS A0A6P4ICT2_DROKI/62-234     AC A0A6P4ICT2.1
#=GS A0A226NKZ2_COLVI/174-366    AC A0A226NKZ2.1
#=GS A0A671XCS0_SPAAU/198-382    AC A0A671XCS0.1
#=GS A0A484BIT1_DRONA/181-370    AC A0A484BIT1.1
#=GS H0ZG74_TAEGU/163-316        AC H0ZG74.2
#=GS M1AZ99_SOLTU/219-399        AC M1AZ99.1
#=GS A0A2K6L4R6_RHIBE/178-365    AC A0A2K6L4R6.1
#=GS TXD16_HUMAN/533-722         AC Q9P2K2.4
#=GS A0A287II21_HORVV/169-262    AC A0A287II21.2
#=GS A0A4U6TCL6_SETVI/171-356    AC A0A4U6TCL6.1
#=GS A0A087G3G5_ARAAL/179-349    AC A0A087G3G5.1
#=GS A0A091ICW9_CALAN/513-702    AC A0A091ICW9.1
#=GS U6KSC9_EIMTE/202-328        AC U6KSC9.1
#=GS H2ATH7_KAZAF/165-357        AC H2ATH7.1
#=GS A0A4V3XJ88_9APHY/337-497    AC A0A4V3XJ88.1
#=GS A0A545W7L4_9HYPO/337-471    AC A0A545W7L4.1
#=GS A0A0V0XC24_9BILA/172-356    AC A0A0V0XC24.1
#=GS A0A663LTS1_ATHCN/181-284    AC A0A663LTS1.1
#=GS A0A0M0JLB5_9EUKA/118-313    AC A0A0M0JLB5.1
#=GS A0A2V1ECE8_9PLEO/150-331    AC A0A2V1ECE8.1
#=GS A0A5C3PJ56_9APHY/156-341    AC A0A5C3PJ56.1
#=GS A0A671QYW6_9TELE/154-349    AC A0A671QYW6.1
#=GS A0DM80_PARTE/208-368        AC A0DM80.1
#=GS A0A6I9K7F6_CHRAS/163-347    AC A0A6I9K7F6.1
#=GS I3M8Q8_ICTTR/160-355        AC I3M8Q8.1
#=GS A0A287VRY6_HORVV/68-252     AC A0A287VRY6.1
#=GS A0A0L7LJK6_9NEOP/161-318    AC A0A0L7LJK6.1
#=GS A0A6I8U2R2_AEDAE/530-688    AC A0A6I8U2R2.1
#=GS A0A4W5MYR7_9TELE/146-340    AC A0A4W5MYR7.1
#=GS A0A158PPV0_BRUPA/275-473    AC A0A158PPV0.1
#=GS A0A287WGF0_HORVV/3-87       AC A0A287WGF0.1
#=GS A0A182DXV8_ONCOC/278-493    AC A0A182DXV8.1
#=GS A0A565BFR3_9BRAS/203-388    AC A0A565BFR3.1
#=GS A0A4W5RM70_9TELE/159-338    AC A0A4W5RM70.1
#=GS A0A5F8H3R2_MONDO/163-358    AC A0A5F8H3R2.1
#=GS A0A2I3NFU5_PAPAN/166-349    AC A0A2I3NFU5.1
#=GS A0A2U3W4Y7_ODORO/178-365    AC A0A2U3W4Y7.1
#=GS A0A6G1QVV3_9TELE/558-757    AC A0A6G1QVV3.1
#=GS A0A196S9L4_BLAHN/155-333    AC A0A196S9L4.1
#=GS A0A1S2ZT38_ERIEU/166-346    AC A0A1S2ZT38.1
#=GS A0A287TFR9_HORVV/127-235    AC A0A287TFR9.1
#=GS V3Z5U5_LOTGI/573-758        AC V3Z5U5.1
#=GS A0A482X2C4_LAOST/154-347    AC A0A482X2C4.1
#=GS J4GNL3_9APHY/129-308        AC J4GNL3.1
#=GS A0A4V6N796_9APHY/153-338    AC A0A4V6N796.1
#=GS A0A287TG55_HORVV/127-235    AC A0A287TG55.1
#=GS A0A6Q2XS69_ESOLU/159-215    AC A0A6Q2XS69.1
#=GS A0A4W6DU28_LATCA/159-354    AC A0A4W6DU28.1
#=GS A0A1R3J263_COCAP/177-353    AC A0A1R3J263.1
#=GS A0A3Q2IEH6_HORSE/312-504    AC A0A3Q2IEH6.1
#=GS U6GZG2_9EIME/194-405        AC U6GZG2.1
#=GS G1R9C4_NOMLE/176-363        AC G1R9C4.2
#=GS W5BSJ0_WHEAT/215-391        AC W5BSJ0.1
#=GS A0A2G3BBM2_CAPCH/230-409    AC A0A2G3BBM2.1
#=GS A0A022Q2R0_ERYGU/216-401    AC A0A022Q2R0.1
#=GS A0A5N5KRT3_PANHP/311-502    AC A0A5N5KRT3.1
#=GS A0A2I3HBL9_NOMLE/167-350    AC A0A2I3HBL9.1
#=GS G7DS28_MIXOS/362-538        AC G7DS28.1
#=GS F6RBW8_CIOIN/159-344        AC F6RBW8.2
#=GS K7G2G7_PELSI/105-288        AC K7G2G7.1
#=GS I3NFW9_ICTTR/181-368        AC I3NFW9.2
#=GS G1KKB8_ANOCA/162-373        AC G1KKB8.2
#=GS A0A427YTB9_9TREE/322-470    AC A0A427YTB9.1
#=GS A0A1J7I6D1_9PEZI/149-323    AC A0A1J7I6D1.1
#=GS A0A5D2VP20_GOSMU/238-418    AC A0A5D2VP20.1
#=GS A0A7P0TA71_HUMAN/161-345    AC A0A7P0TA71.1
#=GS A0A4W6ETF4_LATCA/208-394    AC A0A4W6ETF4.1
#=GS A0A7M7QUW7_NASVI/170-356    AC A0A7M7QUW7.1
#=GS A0A6Q2XCR5_ESOLU/160-317    AC A0A6Q2XCR5.1
#=GS A0A2G2VQ98_CAPBA/229-409    AC A0A2G2VQ98.1
#=GS A0A2R6RTQ6_ACTCC/224-399    AC A0A2R6RTQ6.1
#=GS A0A0V0UQL1_9BILA/276-473    AC A0A0V0UQL1.1
#=GS A0A094CFZ1_9PEZI/383-535    AC A0A094CFZ1.1
#=GS W2Y4Q7_PHYPR/179-347        AC W2Y4Q7.1
#=GS A0A3B5K1Y8_TAKRU/47-234     AC A0A3B5K1Y8.2
#=GS A0A5C7IZL0_9ROSI/230-413    AC A0A5C7IZL0.1
#=GS L8I377_9CETA/63-250         AC L8I377.1
#=GS A0A671RBF9_9TELE/135-295    AC A0A671RBF9.1
#=GS A0A498IN94_MALDO/227-412    AC A0A498IN94.1
#=GS W9R659_9ROSA/212-398        AC W9R659.1
#=GS A0A091PIP8_LEPDC/148-235    AC A0A091PIP8.1
#=GS A0A4W6E3G2_LATCA/559-758    AC A0A4W6E3G2.1
#=GS A0A653HKV7_9APIC/164-331    AC A0A653HKV7.1
#=GS A0A6I8S7K4_XENTR/135-314    AC A0A6I8S7K4.2
#=GS A0A0U1M8D3_TALIS/184-340    AC A0A0U1M8D3.1
#=GS A0A423X4J9_9PEZI/153-334    AC A0A423X4J9.1
#=GS A0A0L8GL71_OCTBM/3-66       AC A0A0L8GL71.1
#=GS M3VZK6_FELCA/64-251         AC M3VZK6.2
#=GS A0A328D2W2_9ASTE/172-349    AC A0A328D2W2.1
#=GS M7C0N4_CHEMY/107-293        AC M7C0N4.1
#=GS A0A6P5ZTB1_DURZI/232-413    AC A0A6P5ZTB1.1
#=GS A0A672L6Q5_SINGR/132-306    AC A0A672L6Q5.1
#=GS A0A287II14_HORVV/173-359    AC A0A287II14.1
#=GS A0A1X7V1N0_AMPQE/164-320    AC A0A1X7V1N0.1
#=GS A0A091VNN0_NIPNI/148-331    AC A0A091VNN0.1
#=GS A0A151QT09_CAJCA/200-385    AC A0A151QT09.1
#=GS A0A2Y9FL05_PHYMC/163-347    AC A0A2Y9FL05.1
#=GS A0A1S2ZB43_ERIEU/174-359    AC A0A1S2ZB43.1
#=GS A0A2U4BHQ9_TURTR/63-252     AC A0A2U4BHQ9.2
#=GS A0A663LTR6_ATHCN/136-317    AC A0A663LTR6.1
#=GS A0A668TZ81_OREAU/130-226    AC A0A668TZ81.1
#=GS M8A9W3_TRIUA/173-336        AC M8A9W3.1
#=GS A0A0D2DHV1_9EURO/153-333    AC A0A0D2DHV1.1
#=GS A0A5C3EMJ3_9BASI/442-608    AC A0A5C3EMJ3.1
#=GS A0A670J3X7_PODMU/8-154      AC A0A670J3X7.1
#=GS B2AY82_PODAN/153-334        AC B2AY82.1
#=GS A9SIY9_PHYPA/164-353        AC A9SIY9.1
#=GS A0A6P7GKN2_DIAVI/129-266    AC A0A6P7GKN2.1
#=GS M1CN22_SOLTU/177-354        AC M1CN22.1
#=GS A0A2G5U7Q0_9PELO/161-341    AC A0A2G5U7Q0.1
#=GS A0A6J3MFZ1_9PEZI/148-339    AC A0A6J3MFZ1.1
#=GS A0A3Q0GSK6_ALLSI/127-312    AC A0A3Q0GSK6.1
#=GS A0A446Y300_TRITD/204-384    AC A0A446Y300.1
#=GS A0A0B0N221_GOSAR/171-352    AC A0A0B0N221.1
#=GS A0A1S3Y8A7_TOBAC/7-174      AC A0A1S3Y8A7.1
#=GS A0A2K3NYG0_TRIPR/198-383    AC A0A2K3NYG0.1
#=GS A0A0V0XC41_9BILA/941-1106   AC A0A0V0XC41.1
#=GS A0A7E6FCP8_OCTVU/545-735    AC A0A7E6FCP8.1
#=GS A0A151IF25_9HYME/160-344    AC A0A151IF25.1
#=GS A0A420U2I8_FUSOX/150-330    AC A0A420U2I8.1
#=GS A0A6J2WLY7_CHACN/158-352    AC A0A6J2WLY7.1
#=GS A0A673ZJX7_SALTR/135-319    AC A0A673ZJX7.1
#=GS A0A5C3ERI3_9BASI/159-340    AC A0A5C3ERI3.1
#=GS A0A540K8M9_MALBA/169-354    AC A0A540K8M9.1
#=GS A0A1B7MM16_9AGAM/322-500    AC A0A1B7MM16.1
#=GS A0A6J1WT08_GALME/516-671    AC A0A6J1WT08.1
#=GS A0A2P6TZC6_CHLSO/162-345    AC A0A2P6TZC6.1
#=GS A0A2R6NKH8_9APHY/319-492    AC A0A2R6NKH8.1
#=GS A0A091EXR4_CORBR/56-206     AC A0A091EXR4.1
#=GS A0A094GCE0_9PEZI/382-534    AC A0A094GCE0.1
#=GS A0A2K0VY41_GIBNY/155-336    AC A0A2K0VY41.1
#=GS A0A6A4FL57_9STRA/166-343    AC A0A6A4FL57.1
#=GS A0A397YSF1_BRACM/168-353    AC A0A397YSF1.1
#=GS A0A2K5J2U8_COLAP/10-171     AC A0A2K5J2U8.1
#=GS A0A0K9R010_SPIOL/238-417    AC A0A0K9R010.1
#=GS A0A151N1C1_ALLMI/131-316    AC A0A151N1C1.1
#=GS A0A6P6HGA5_PUMCO/212-329    AC A0A6P6HGA5.1
#=GS A0A1Y2WQE5_9PEZI/144-326    AC A0A1Y2WQE5.1
#=GS A0A3Q3KY41_9TELE/18-234     AC A0A3Q3KY41.2
#=GS R0L6N6_ANAPL/78-273         AC R0L6N6.1
#=GS A0A1D6QVF7_MAIZE/221-324    AC A0A1D6QVF7.1
#=GS A0A388LAD3_CHABU/175-363    AC A0A388LAD3.1
#=GS A0A6J3L956_9HYME/157-341    AC A0A6J3L956.1
#=GS A7SHH5_NEMVE/157-342        AC A7SHH5.1
#=GS A0A175W2M4_9PEZI/38-216     AC A0A175W2M4.1
#=GS A0A671LKS7_9TELE/189-376    AC A0A671LKS7.1
#=GS T1JKD8_STRMM/151-339        AC T1JKD8.1
#=GS A0A3M7BI52_HORWE/33-217     AC A0A3M7BI52.1
#=GS A0A091ES72_CORBR/107-292    AC A0A091ES72.1
#=GS A0A093JN73_STRCA/193-308    AC A0A093JN73.1
#=GS A0A3Q7SQ18_VULVU/180-365    AC A0A3Q7SQ18.1
#=GS A0A2K6N1Z5_RHIBE/130-316    AC A0A2K6N1Z5.1
#=GS B4GU57_DROPE/1-148          AC B4GU57.1
#=GS Q6FSC0_CANGA/162-344        AC Q6FSC0.1
#=GS A0A6J0BU80_NEOLC/162-346    AC A0A6J0BU80.1
#=GS A0A077ZDL9_TRITR/1-112      AC A0A077ZDL9.1
#=GS A0A1S3K1I5_LINUN/186-370    AC A0A1S3K1I5.1
#=GS A0A1D6F5C4_MAIZE/1-174      AC A0A1D6F5C4.1
#=GS A0A0C3DNK6_9AGAM/330-505    AC A0A0C3DNK6.1
#=GS A0A4W5QDU4_9TELE/117-312    AC A0A4W5QDU4.1
#=GS A0A2N3MZI8_9PEZI/190-365    AC A0A2N3MZI8.1
#=GS A0A4X2JZ34_VOMUR/167-350    AC A0A4X2JZ34.1
#=GS Q7FYS2_WHEAT/176-361        AC Q7FYS2.1
#=GS A0A2K6LN97_RHIBE/158-338    AC A0A2K6LN97.1
#=GS G1MGJ0_AILME/163-347        AC G1MGJ0.2
#=GS A0A6P6PCX7_CARAU/159-361    AC A0A6P6PCX7.1
#=GS A0A6P5BRB4_BOSIN/311-502    AC A0A6P5BRB4.1
#=GS L2GT62_VAVCU/124-280        AC L2GT62.2
#=GS H9KVX1_CALJA/119-303        AC H9KVX1.2
#=GS A0A1V8TA36_9PEZI/150-334    AC A0A1V8TA36.1
#=GS A0A2G8SRY7_9APHY/319-495    AC A0A2G8SRY7.1
#=GS A0A2G7ELN9_9EURO/161-342    AC A0A2G7ELN9.1
#=GS A0A6P6F5N6_OCTDE/533-722    AC A0A6P6F5N6.1
#=GS A0A1S3QQT5_SALSA/45-145     AC A0A1S3QQT5.1
#=GS A0A1S3TLH8_VIGRR/240-421    AC A0A1S3TLH8.1
#=GS R7Q3Q0_CHOCR/158-343        AC R7Q3Q0.1
#=GS A0A023B1Z1_GRENI/151-321    AC A0A023B1Z1.1
#=GS A0A0E0HLJ6_ORYNI/202-386    AC A0A0E0HLJ6.1
#=GS A0A446RWL7_TRITD/177-362    AC A0A446RWL7.1
#=GS A0A384ARJ2_BALAS/158-338    AC A0A384ARJ2.1
#=GS A0A3L6QC76_PANMI/241-415    AC A0A3L6QC76.1
#=GS A0A4Z2CU48_SCHJA/353-545    AC A0A4Z2CU48.1
#=GS A0A075A1F0_9TREM/277-464    AC A0A075A1F0.1
#=GS A0A6D2IDL0_9BRAS/240-419    AC A0A6D2IDL0.1
#=GS W6KQG4_9TRYP/152-327        AC W6KQG4.1
#=GS A0A0L8GGN6_OCTBM/294-485    AC A0A0L8GGN6.1
#=GS A0A6P6LI52_CARAU/208-391    AC A0A6P6LI52.1
#=GS A0A5F7ZXJ8_MACMU/149-332    AC A0A5F7ZXJ8.1
#=GS A0A6Q2ZNP5_ESOLU/303-494    AC A0A6Q2ZNP5.1
#=GS G3R2R4_GORGO/179-366        AC G3R2R4.1
#=GS A0A6I9WRE5_9HYME/1568-1731  AC A0A6I9WRE5.1
#=GS A0A2F0B1K0_ESCRO/27-151     AC A0A2F0B1K0.1
#=GS A0A1Y2LMY2_EPING/151-327    AC A0A1Y2LMY2.1
#=GS A0A443PHK6_9MAGN/174-359    AC A0A443PHK6.1
#=GS A0A7J6J217_COLFN/145-279    AC A0A7J6J217.1
#=GS A0A401NT99_SCYTO/194-389    AC A0A401NT99.1
#=GS A0A158NIS9_ATTCE/155-349    AC A0A158NIS9.1
#=GS A0A6I9RR81_ELAGV/217-402    AC A0A6I9RR81.1
#=GS A0A067L9K0_JATCU/219-404    AC A0A067L9K0.1
#=GS A0A6P6MQL9_CARAU/529-721    AC A0A6P6MQL9.1
#=GS A0A672U5K1_STRHB/158-338    AC A0A672U5K1.1
#=GS G4YXR9_PHYSP/176-345        AC G4YXR9.1
#=GS A0A452H2X7_9SAUR/176-360    AC A0A452H2X7.1
#=GS G2YZD4_BOTF4/152-333        AC G2YZD4.1
#=GS A0A3Q7UJ44_URSAR/534-723    AC A0A3Q7UJ44.1
#=GS A0A2K1IN50_PHYPA/200-382    AC A0A2K1IN50.1
#=GS A0A4P9Y3K3_9FUNG/295-490    AC A0A4P9Y3K3.1
#=GS A0A6A3B0W8_HIBSY/162-312    AC A0A6A3B0W8.1
#=GS A0A2K5RAN3_CEBIM/180-363    AC A0A2K5RAN3.1
#=GS A0A0C4DRV4_MAGP6/153-334    AC A0A0C4DRV4.1
#=GS A0A672YR81_9TELE/160-344    AC A0A672YR81.1
#=GS A0A2K5TWT3_MACFA/209-404    AC A0A2K5TWT3.2
#=GS F9G9N9_FUSOF/150-330        AC F9G9N9.1
#=GS A0A6P8VBE0_GYMAC/168-351    AC A0A6P8VBE0.1
#=GS A9U0W2_PHYPA/161-343        AC A9U0W2.1
#=GS A0A261BGL9_9PELO/173-346    AC A0A261BGL9.1
#=GS R7TYJ0_CAPTE/148-333        AC R7TYJ0.1
#=GS A0A059CRQ0_EUCGR/180-357    AC A0A059CRQ0.1
#=GS K1WL01_MARBU/156-339        AC K1WL01.1
#=GS A0A671TW54_SPAAU/89-269     AC A0A671TW54.1
#=GS A0A6P6IHU6_PUMCO/64-251     AC A0A6P6IHU6.1
#=GS A0A0C3QA67_9AGAM/300-486    AC A0A0C3QA67.1
#=GS E9H808_DAPPU/159-363        AC E9H808.1
#=GS A0A267GBY1_9PLAT/193-374    AC A0A267GBY1.1
#=GS A0A6A4KUC5_9ERIC/176-353    AC A0A6A4KUC5.1
#=GS M3XCN6_FELCA/163-347        AC M3XCN6.3
#=GS A0A0R3PMD2_ANGCS/290-487    AC A0A0R3PMD2.1
#=GS A0A1L7WCT3_9HELO/152-333    AC A0A1L7WCT3.1
#=GS A0A1U7R217_MESAU/534-723    AC A0A1U7R217.1
#=GS A0A091RFA6_9GRUI/511-700    AC A0A091RFA6.1
#=GS E0VQN7_PEDHC/156-342        AC E0VQN7.1
#=GS A0A3M0KY80_HIRRU/171-354    AC A0A3M0KY80.1
#=GS A0A452SIM4_URSAM/136-317    AC A0A452SIM4.1
#=GS A0A2K6E9X5_MACNE/158-338    AC A0A2K6E9X5.1
#=GS B4L7Q4_DROMO/168-354        AC B4L7Q4.1
#=GS G0P4R4_CAEBE/130-308        AC G0P4R4.1
#=GS A0A2R9BS70_PANPA/2-143      AC A0A2R9BS70.1
#=GS A0A0L8GUB4_OCTBM/64-238     AC A0A0L8GUB4.1
#=GS A0A016X1P2_9BILA/152-340    AC A0A016X1P2.1
#=GS A0A0K0DPN2_ANGCA/4-165      AC A0A0K0DPN2.1
#=GS PDIA3_PONAB/160-355         AC Q5RDG4.1
#=GS A0A0L0DE47_THETB/152-325    AC A0A0L0DE47.1
#=GS A0A194QW92_PAPMA/574-760    AC A0A194QW92.1
#=GS A0A662YY58_ACIRT/157-253    AC A0A662YY58.1
#=GS A0A4Q4YR47_9PEZI/157-338    AC A0A4Q4YR47.1
#=GS A0A5C3QG90_9AGAR/161-343    AC A0A5C3QG90.1
#=GS H2L8E0_ORYLA/159-343        AC H2L8E0.2
#=GS A0A674HH31_TAEGU/91-253     AC A0A674HH31.1
#=GS A0A1D3SPL9_PLAMA/206-383    AC A0A1D3SPL9.1
#=GS A0A2Y9IBP0_NEOSC/309-426    AC A0A2Y9IBP0.1
#=GS A0A1G4JVM7_9SACH/166-350    AC A0A1G4JVM7.1
#=GS A0A6Q2Z0C6_ESOLU/198-383    AC A0A6Q2Z0C6.1
#=GS A0A7M7RGS2_STRPU/168-351    AC A0A7M7RGS2.1
#=GS A0A2K6UP58_SAIBB/139-319    AC A0A2K6UP58.1
#=GS A0A0V1H7E1_9BILA/152-340    AC A0A0V1H7E1.1
#=GS L8ICR9_9CETA/532-721        AC L8ICR9.1
#=GS A0A2K3PDZ9_TRIPR/232-411    AC A0A2K3PDZ9.1
#=GS A0A0V0WG95_9BILA/175-349    AC A0A0V0WG95.1
#=GS A0A384CYA8_URSMA/534-723    AC A0A384CYA8.1
#=GS A0A0G4L469_9PEZI/148-322    AC A0A0G4L469.1
#=GS A0A674C9E7_SALTR/166-345    AC A0A674C9E7.1
#=GS A0A1Y1I0K1_KLENI/193-374    AC A0A1Y1I0K1.1
#=GS M2N7I0_BAUPA/150-334        AC M2N7I0.1
#=GS A0A6P3FR62_OCTDE/167-350    AC A0A6P3FR62.1
#=GS A0A226PC11_COLVI/153-348    AC A0A226PC11.1
#=GS A0A1E3P0I1_WICAA/169-345    AC A0A1E3P0I1.1
#=GS A0A1Y3BLV0_EURMA/154-338    AC A0A1Y3BLV0.1
#=GS A0A0L0VNB3_9BASI/161-345    AC A0A0L0VNB3.1
#=GS T1HEY8_RHOPR/133-322        AC T1HEY8.1
#=GS A0A6P4IMH5_DROKI/534-690    AC A0A6P4IMH5.1
#=GS PDIA1_PONAB/161-345         AC Q5R5B6.1
#=GS A0A6J2Q7W6_COTGO/204-390    AC A0A6J2Q7W6.1
#=GS A0A3P9C0I1_9CICH/149-343    AC A0A3P9C0I1.1
#=GS J9IMT6_9SPIT/212-377        AC J9IMT6.1
#=GS B4GSZ0_DROPE/166-332        AC B4GSZ0.1
#=GS A0A091Q2J1_LEPDC/107-292    AC A0A091Q2J1.1
#=GS A0A2L2TUE0_9HYPO/155-336    AC A0A2L2TUE0.1
#=GS I3J5R6_ORENI/164-348        AC I3J5R6.1
#=GS D7G3W6_ECTSI/437-593        AC D7G3W6.1
#=GS A0A7I4CGK4_PHYPA/239-373    AC A0A7I4CGK4.1
#=GS A0A178ABZ1_9PLEO/150-331    AC A0A178ABZ1.1
#=GS A0A091UQS2_PHALP/124-304    AC A0A091UQS2.1
#=GS A0A2R9BZN0_PANPA/59-175     AC A0A2R9BZN0.1
#=GS A0A077ZSF8_STYLE/159-345    AC A0A077ZSF8.1
#=GS A0A078IT49_BRANA/205-390    AC A0A078IT49.1
#=GS A0A498M080_LABRO/69-248     AC A0A498M080.1
#=GS A0A7M7T905_NASVI/170-372    AC A0A7M7T905.1
#=GS A0A0T6BBT9_9SCAR/114-301    AC A0A0T6BBT9.1
#=GS A0A4Q4SVA2_9PEZI/157-338    AC A0A4Q4SVA2.1
#=GS A0A015LY80_RHIIW/309-487    AC A0A015LY80.1
#=GS A0A087VPN0_BALRE/1-139      AC A0A087VPN0.1
#=GS A0A261BYQ6_9PELO/157-338    AC A0A261BYQ6.1
#=GS A0A6J1JTT4_CUCMA/169-354    AC A0A6J1JTT4.1
#=GS A0A094BRE6_9PEZI/153-334    AC A0A094BRE6.1
#=GS A0A2K6TKP7_SAIBB/312-504    AC A0A2K6TKP7.1
#=GS A0A2I0U3T1_LIMLA/127-322    AC A0A2I0U3T1.1
#=GS A0A199UL81_ANACO/173-359    AC A0A199UL81.1
#=GS A0A177WFA6_BATDL/239-417    AC A0A177WFA6.1
#=GS A0A6H5GHH0_9HEMI/45-233     AC A0A6H5GHH0.1
#=GS G3ND82_GASAC/308-500        AC G3ND82.1
#=GS L2FUE7_COLFN/1-105          AC L2FUE7.1
#=GS Q6C781_YARLI/155-340        AC Q6C781.1
#=GS A0A1Z5TUU5_HORWE/150-334    AC A0A1Z5TUU5.1
#=GS I1S4Z7_GIBZE/155-336        AC I1S4Z7.1
#=GS A0A158QLE8_HAEPC/154-336    AC A0A158QLE8.1
#=GS V4B8B0_LOTGI/124-314        AC V4B8B0.1
#=GS A0A668SYY4_OREAU/172-355    AC A0A668SYY4.1
#=GS A0A0B1SFC5_OESDE/3-169      AC A0A0B1SFC5.1
#=GS A0A6J0VK64_9SAUR/39-226     AC A0A6J0VK64.1
#=GS A0A672M6F9_SINGR/143-320    AC A0A672M6F9.1
#=GS A5DNC3_PICGU/177-366        AC A5DNC3.2
#=GS A0A6J1VCV2_9SAUR/304-496    AC A0A6J1VCV2.1
#=GS A0A671QYX5_9TELE/153-348    AC A0A671QYX5.1
#=GS A0A132A999_SARSC/286-482    AC A0A132A999.1
#=GS A0A5N6L343_9ROSI/413-529    AC A0A5N6L343.1
#=GS A0A4W4GFX5_ELEEL/306-497    AC A0A4W4GFX5.1
#=GS A0A6J2MSU1_9CHIR/376-556    AC A0A6J2MSU1.1
#=GS A0A6P6UK46_COFAR/175-360    AC A0A6P6UK46.1
#=GS PDIA3_RAT/160-355           AC P11598.2
#=GS A0A6A4VIF3_AMPAM/156-340    AC A0A6A4VIF3.1
#=GS A0A6P7IEP5_9TELE/159-342    AC A0A6P7IEP5.1
#=GS A0A0V0YJ15_TRIPS/156-340    AC A0A0V0YJ15.1
#=GS A0A5A9N4S8_9TELE/133-312    AC A0A5A9N4S8.1
#=GS A0A4X3PA74_PRIPA/163-346    AC A0A4X3PA74.1
#=GS A0A671XCP7_SPAAU/168-352    AC A0A671XCP7.1
#=GS F7A514_MONDO/540-729        AC F7A514.2
#=GS A0A0P5CEM3_9CRUS/167-353    AC A0A0P5CEM3.1
#=GS A0A428NMP4_9HYPO/155-336    AC A0A428NMP4.1
#=GS A0A5E3WFT7_9AGAM/114-297    AC A0A5E3WFT7.1
#=GS A0A2C9VK39_MANES/1191-1380  AC A0A2C9VK39.1
#=GS G3X0T0_SARHA/311-502        AC G3X0T0.2
#=GS A0A5N5K8G3_PANHP/172-356    AC A0A5N5K8G3.1
#=GS A0A445L567_GLYSO/37-130     AC A0A445L567.1
#=GS A0A067CKY1_SAPPC/155-330    AC A0A067CKY1.1
#=GS A0A1Y2VTU1_9PEZI/150-321    AC A0A1Y2VTU1.1
#=GS A0A091KCM5_EGRGA/1-139      AC A0A091KCM5.1
#=GS A0A3Q7MU15_CALUR/309-501    AC A0A3Q7MU15.1
#=GS A0A5N5LN28_9ROSI/213-403    AC A0A5N5LN28.1
#=GS A0A6J3FNG9_SAPAP/418-607    AC A0A6J3FNG9.1
#=GS V4KC98_EUTSA/168-354        AC V4KC98.1
#=GS A0A654GS59_9CEST/7-123      AC A0A654GS59.1
#=GS A0A093BU67_TAUER/1-166      AC A0A093BU67.1
#=GS A0A5E8C182_9ASCO/386-531    AC A0A5E8C182.1
#=GS A0A2Z7C9U9_9LAMI/99-284     AC A0A2Z7C9U9.1
#=GS W3XI38_PESFW/156-319        AC W3XI38.1
#=GS A0A194PVF1_PAPXU/157-343    AC A0A194PVF1.1
#=GS A0A5E4EYA1_PRUDU/213-390    AC A0A5E4EYA1.1
#=GS C5MGL3_CANTT/174-369        AC C5MGL3.1
#=GS A0A2I4CKI7_9TELE/1-108      AC A0A2I4CKI7.1
#=GS A0A2K5C3Y5_AOTNA/160-355    AC A0A2K5C3Y5.1
#=GS A0A5N6PB21_9ASTR/180-356    AC A0A5N6PB21.1
#=GS V4TDU0_CITCL/185-363        AC V4TDU0.1
#=GS A0A067QYB0_ZOONE/168-354    AC A0A067QYB0.1
#=GS A0A674K3Y4_TERCA/538-727    AC A0A674K3Y4.1
#=GS A0A674MPD7_TAKRU/162-346    AC A0A674MPD7.1
#=GS A0A671Q7P7_9TELE/159-343    AC A0A671Q7P7.1
#=GS A0A4Q9LYN3_9MICR/130-291    AC A0A4Q9LYN3.1
#=GS A0A6I8NN86_ORNAN/276-460    AC A0A6I8NN86.1
#=GS A0A4U6W4Q0_SETVI/235-416    AC A0A4U6W4Q0.1
#=GS A0A433DCY9_9FUNG/261-443    AC A0A433DCY9.1
#=GS A0A0D2QPM2_GOSRA/167-352    AC A0A0D2QPM2.1
#=GS A0A452RIR3_URSAM/160-333    AC A0A452RIR3.1
#=GS A0A485P014_LYNPA/64-251     AC A0A485P014.1
#=GS A0A2T3AD55_9PEZI/112-293    AC A0A2T3AD55.1
#=GS A0A2Y9NPV6_DELLE/55-242     AC A0A2Y9NPV6.1
#=GS A0A674PEY1_TAKRU/159-343    AC A0A674PEY1.1
#=GS A0A4Z0A6M4_9AGAM/156-341    AC A0A4Z0A6M4.1
#=GS A0A2K5SD91_CEBIM/6-150      AC A0A2K5SD91.1
#=GS A0A671Q481_9TELE/164-326    AC A0A671Q481.1
#=GS A0A3B3IF56_ORYLA/206-385    AC A0A3B3IF56.1
#=GS A0A4P9YYZ2_9FUNG/299-504    AC A0A4P9YYZ2.1
#=GS G1S5F2_NOMLE/158-341        AC G1S5F2.2
#=GS A0A672FQQ5_SALFA/39-226     AC A0A672FQQ5.1
#=GS A0A2K5YPY1_MANLE/10-171     AC A0A2K5YPY1.1
#=GS L5M092_MYODS/157-338        AC L5M092.1
#=GS A0A453MNX1_AEGTS/44-225     AC A0A453MNX1.1
#=GS A0A340Y3N2_LIPVE/153-338    AC A0A340Y3N2.1
#=GS K1QCC9_CRAGI/290-450        AC K1QCC9.1
#=GS R4XAT8_TAPDE/150-329        AC R4XAT8.1
#=GS A0A6P4FQ00_DRORH/531-689    AC A0A6P4FQ00.1
#=GS S7QJ65_GLOTA/157-341        AC S7QJ65.1
#=GS A0A287T503_HORVV/245-426    AC A0A287T503.1
#=GS A0A0A0KDC9_CUCSA/169-365    AC A0A0A0KDC9.1
#=GS A0A5N3UVW4_MUNRE/183-370    AC A0A5N3UVW4.1
#=GS A0A6P8RQP2_GEOSA/542-731    AC A0A6P8RQP2.1
#=GS A0A669D7A4_ORENI/159-353    AC A0A669D7A4.1
#=GS A0A3Q7UFG4_URSAR/312-504    AC A0A3Q7UFG4.1
#=GS A0A2G2WHV8_CAPBA/165-348    AC A0A2G2WHV8.1
#=GS A0A067H8G1_CITSI/40-205     AC A0A067H8G1.1
#=GS A0A388LJ39_CHABU/72-254     AC A0A388LJ39.1
#=GS A0A2H9TQ41_9FUNG/148-313    AC A0A2H9TQ41.1
#=GS A0A6I9HKV5_GEOFO/193-308    AC A0A6I9HKV5.1
#=GS A0A2I0BG48_9ASPA/172-357    AC A0A2I0BG48.1
#=GS A0A672M0I7_SINGR/152-333    AC A0A672M0I7.1
#=GS A0A4Y7KAP4_PAPSO/186-371    AC A0A4Y7KAP4.1
#=GS A0A6J1WL33_GALME/516-671    AC A0A6J1WL33.1
#=GS A0A0K8LSR2_9EURO/161-342    AC A0A0K8LSR2.1
#=GS A0A218ZAK6_9HELO/151-331    AC A0A218ZAK6.1
#=GS A0A6P4BVD0_ARADU/234-414    AC A0A6P4BVD0.1
#=GS A0A1V4JA71_PATFA/64-250     AC A0A1V4JA71.1
#=GS A0A2G5F9K1_AQUCA/240-421    AC A0A2G5F9K1.1
#=GS A7STM8_NEMVE/311-504        AC A7STM8.1
#=GS A0A2K5S918_CEBIM/120-303    AC A0A2K5S918.1
#=GS A0A103XXG8_CYNCS/236-412    AC A0A103XXG8.1
#=GS B6QWC4_TALMQ/125-325        AC B6QWC4.1
#=GS A0A2K5JHS7_COLAP/140-335    AC A0A2K5JHS7.1
#=GS A0A444UHX2_ACIRT/307-435    AC A0A444UHX2.1
#=GS A0A2S6CHU9_9PEZI/150-334    AC A0A2S6CHU9.1
#=GS T1EGH6_HELRO/159-356        AC T1EGH6.1
#=GS J3LY27_ORYBR/173-359        AC J3LY27.1
#=GS A0A1E5RI23_9ASCO/170-365    AC A0A1E5RI23.1
#=GS A0A4Z2DXR8_SCHJA/161-346    AC A0A4Z2DXR8.1
#=GS A0A3P8FBN2_9TREM/78-271     AC A0A3P8FBN2.1
#=GS A0A158RAT8_THECL/161-348    AC A0A158RAT8.1
#=GS A0A448YPU5_BRENA/171-352    AC A0A448YPU5.1
#=GS A0A4D9E6M4_9SAUR/170-354    AC A0A4D9E6M4.1
#=GS A0A6P7KMY8_BETSP/168-351    AC A0A6P7KMY8.1
#=GS A0A287WG80_HORVV/5-115      AC A0A287WG80.1
#=GS A0A6P6I5N2_PUMCO/120-304    AC A0A6P6I5N2.1
#=GS A0A287A8T4_PIG/186-373      AC A0A287A8T4.1
#=GS A0A163KLL1_ABSGL/189-338    AC A0A163KLL1.1
#=GS A0A2K5X7K5_MACFA/16-171     AC A0A2K5X7K5.2
#=GS A0A0D9R5R0_CHLSB/180-365    AC A0A0D9R5R0.1
#=GS A0A1R3G7L3_COCAP/214-399    AC A0A1R3G7L3.1
#=GS A0A5Q4BLX4_9PEZI/392-573    AC A0A5Q4BLX4.1
#=GS G5BJ77_HETGA/163-347        AC G5BJ77.1
#=GS A0A1Y2EER0_9PEZI/90-330     AC A0A1Y2EER0.1
#=GS A0A2B4S150_STYPI/160-344    AC A0A2B4S150.1
#=GS A0A6I9XPH5_9SAUR/160-340    AC A0A6I9XPH5.1
#=GS A0A2I3RI73_PANTR/266-333    AC A0A2I3RI73.1
#=GS A0A0F9YUT0_9MICR/284-446    AC A0A0F9YUT0.1
#=GS A0A445HRP6_GLYSO/209-389    AC A0A445HRP6.1
#=GS A0A452GBM7_CAPHI/149-332    AC A0A452GBM7.1
#=GS U6M5R0_EIMMA/225-432        AC U6M5R0.1
#=GS A0A093ZMT2_9PEZI/153-228    AC A0A093ZMT2.1
#=GS E2C5K0_HARSA/158-344        AC E2C5K0.1
#=GS I1BIV3_RHIO9/156-338        AC I1BIV3.1
#=GS A0A2H5PFM2_CITUN/222-407    AC A0A2H5PFM2.1
#=GS A0A087R2B6_APTFO/112-296    AC A0A087R2B6.1
#=GS A0A6P6UEC6_COFAR/235-415    AC A0A6P6UEC6.1
#=GS H2T842_TAKRU/196-382        AC H2T842.3
#=GS X2JGP4_DROME/161-345        AC X2JGP4.1
#=GS A0A6J0V466_9SAUR/193-383    AC A0A6J0V466.1
#=GS B0WT65_CULQU/144-341        AC B0WT65.1
#=GS A0A6G1PC82_9TELE/168-352    AC A0A6G1PC82.1
#=GS A0A2A2LNN3_9BILA/197-343    AC A0A2A2LNN3.1
#=GS E3LEF9_CAERE/163-347        AC E3LEF9.1
#=GS A0A670KDC9_PODMU/151-346    AC A0A670KDC9.1
#=GS A0A1D2MT70_ORCCI/138-323    AC A0A1D2MT70.1
#=GS A0A087QNE3_APTFO/123-304    AC A0A087QNE3.1
#=GS A0A0A2KX17_PENIT/162-343    AC A0A0A2KX17.1
#=GS A0A371DST8_9APHY/155-341    AC A0A371DST8.1
#=GS J9K9Y0_ACYPI/166-350        AC J9K9Y0.1
#=GS A0A6I9LC19_PERMB/64-251     AC A0A6I9LC19.1
#=GS A0A067M2D0_9AGAM/156-337    AC A0A067M2D0.1
#=GS A0A177C753_9PLEO/150-331    AC A0A177C753.1
#=GS A0A3Q3F556_9LABR/174-355    AC A0A3Q3F556.1
#=GS A0A667X2D3_9TELE/168-351    AC A0A667X2D3.1
#=GS A0A0V0W8J3_9BILA/665-854    AC A0A0V0W8J3.1
#=GS A0A084VAX6_ANOSI/318-471    AC A0A084VAX6.1
#=GS A0A0V1CG67_TRIBR/316-513    AC A0A0V1CG67.1
#=GS A0A6I9VZM3_BACDO/535-691    AC A0A6I9VZM3.1
#=GS A0A0Q9X1D6_DROWI/533-692    AC A0A0Q9X1D6.1
#=GS A0A2U3W8F4_ODORO/163-347    AC A0A2U3W8F4.1
#=GS A0A0L0C696_LUCCU/285-469    AC A0A0L0C696.1
#=GS A0A4W5R985_9TELE/158-352    AC A0A4W5R985.1
#=GS A0A067RBI3_ZOONE/159-343    AC A0A067RBI3.1
#=GS A0A6G1C0T8_9ORYZ/182-356    AC A0A6G1C0T8.1
#=GS A0A5N6RMD5_9ROSI/173-358    AC A0A5N6RMD5.1
#=GS Q5EUE0_MAIZE/170-385        AC Q5EUE0.1
#=GS A0A4W5PQ49_9TELE/149-344    AC A0A4W5PQ49.1
#=GS A0A0L0GC39_9EUKA/123-314    AC A0A0L0GC39.1
#=GS A0A4X2LX20_VOMUR/158-339    AC A0A4X2LX20.1
#=GS A0A445A9Y2_ARAHY/247-426    AC A0A445A9Y2.1
#=GS A0A0F8CI24_LARCR/149-344    AC A0A0F8CI24.1
#=GS A0A2I4G0S9_JUGRE/213-398    AC A0A2I4G0S9.1
#=GS A0A5N6PZR5_9ASTR/176-361    AC A0A5N6PZR5.1
#=GS A0A428QDV3_9HYPO/155-336    AC A0A428QDV3.1
#=GS D6X463_TRICA/158-348        AC D6X463.2
#=GS A0A2I4BEJ7_9TELE/544-737    AC A0A2I4BEJ7.1
#=GS A0A673M253_9TELE/115-290    AC A0A673M253.1
#=GS A0A556VXC3_BAGYA/936-1120   AC A0A556VXC3.1
#=GS A0A6H5I108_9HYME/553-710    AC A0A6H5I108.1
#=GS A2DQ93_TRIVA/134-318        AC A2DQ93.1
#=GS A0A6P7MB02_BETSP/154-335    AC A0A6P7MB02.1
#=GS L1JQA2_GUITC/158-350        AC L1JQA2.1
#=GS A0A7C8MBE0_9PLEO/98-280     AC A0A7C8MBE0.1
#=GS A0A0D1BUP3_USTMA/439-622    AC A0A0D1BUP3.1
#=GS A0A484C0W6_PERFV/155-335    AC A0A484C0W6.1
#=GS A0A1Q8RW80_9PEZI/152-333    AC A0A1Q8RW80.1
#=GS A0A673G564_9TELE/385-577    AC A0A673G564.1
#=GS A0A1X7U923_AMPQE/160-337    AC A0A1X7U923.1
#=GS A0A087Y9K4_POEFO/169-353    AC A0A087Y9K4.2
#=GS A0A2U3YJS0_LEPWE/67-182     AC A0A2U3YJS0.2
#=GS A0A4D8ZID0_SALSN/213-399    AC A0A4D8ZID0.1
#=GS A2DEC1_TRIVA/93-268         AC A2DEC1.1
#=GS E3Q886_COLGM/149-322        AC E3Q886.1
#=GS A0A1S4HAB3_ANOGA/161-345    AC A0A1S4HAB3.1
#=GS A0A0H2UHM5_RAT/165-360      AC A0A0H2UHM5.1
#=GS A8Q039_MALGO/312-514        AC A8Q039.1
#=GS A0A074W304_9PEZI/151-331    AC A0A074W304.1
#=GS A0A6L2PZU6_COPFO/157-341    AC A0A6L2PZU6.1
#=GS PDILT_RAT/177-362           AC Q5XI02.1
#=GS A0A0R4IGN3_DANRE/115-310    AC A0A0R4IGN3.1
#=GS A0A6A3CMS5_HIBSY/210-392    AC A0A6A3CMS5.1
#=GS A0A6I9JHP2_CHRAS/309-501    AC A0A6I9JHP2.1
#=GS A0A6A6L9K1_HEVBR/121-334    AC A0A6A6L9K1.1
#=GS A0A6Q2WVN8_ESOLU/170-369    AC A0A6Q2WVN8.1
#=GS A0A0N4UE22_DRAME/2-114      AC A0A0N4UE22.1
#=GS A0A3M0JWZ9_HIRRU/316-508    AC A0A3M0JWZ9.1
#=GS A0A2U3V851_TURTR/63-250     AC A0A2U3V851.2
#=GS E4X5H5_OIKDI/153-337        AC E4X5H5.1
#=GS H0ZSA9_TAEGU/546-735        AC H0ZSA9.2
#=GS A0A672L404_SINGR/136-313    AC A0A672L404.1
#=GS A0A3B6QIB6_WHEAT/184-351    AC A0A3B6QIB6.1
#=GS A0A0V1M4B6_9BILA/153-341    AC A0A0V1M4B6.1
#=GS A0A453MNU1_AEGTS/24-207     AC A0A453MNU1.1
#=GS A0A1C7NDT4_9FUNG/155-334    AC A0A1C7NDT4.1
#=GS A0A2U3UYX4_TURTR/167-350    AC A0A2U3UYX4.2
#=GS A0A2I3HP29_NOMLE/533-711    AC A0A2I3HP29.1
#=GS A0A0R3PLI1_ANGCS/1-182      AC A0A0R3PLI1.1
#=GS A0A3Q1FRL3_9TELE/307-499    AC A0A3Q1FRL3.1
#=GS H3G8N1_PHYRM/183-343        AC H3G8N1.1
#=GS A0A0E0DXE7_9ORYZ/204-388    AC A0A0E0DXE7.1
#=GS A0A3P8YM70_ESOLU/221-406    AC A0A3P8YM70.2
#=GS A0A6J3PUN5_TURTR/149-329    AC A0A6J3PUN5.1
#=GS A0A5A9PN37_9TELE/166-349    AC A0A5A9PN37.1
#=GS M7ZZF3_TRIUA/179-349        AC M7ZZF3.1
#=GS A0A6A4VA87_AMPAM/153-337    AC A0A6A4VA87.1
#=GS A0A4W4FMV1_ELEEL/166-350    AC A0A4W4FMV1.1
#=GS A0A6A3BFR4_HIBSY/169-354    AC A0A6A3BFR4.1
#=GS A0A6J0XNH5_ODOVR/158-338    AC A0A6J0XNH5.1
#=GS A0A7N8Y6H7_9TELE/117-300    AC A0A7N8Y6H7.1
#=GS A0A667X2H4_9TELE/167-350    AC A0A667X2H4.1
#=GS A0A3Q1B892_AMPOC/160-343    AC A0A3Q1B892.1
#=GS A0A4X2L770_VOMUR/134-320    AC A0A4X2L770.1
#=GS A0A0V1P9R8_9BILA/172-356    AC A0A0V1P9R8.1
#=GS A0A672QY52_SINGR/217-324    AC A0A672QY52.1
#=GS A2EYD5_TRIVA/157-313        AC A2EYD5.1
#=GS A0A423TS36_PENVA/1-149      AC A0A423TS36.1
#=GS A0A4W6DWY1_LATCA/153-347    AC A0A4W6DWY1.1
#=GS A0A232EH13_9HYME/170-372    AC A0A232EH13.1
#=GS A0A6P7IUX7_9TELE/168-352    AC A0A6P7IUX7.1
#=GS G1NDL0_MELGA/78-273         AC G1NDL0.1
#=GS A0A507CW33_9FUNG/212-392    AC A0A507CW33.1
#=GS B4NEW9_DROWI/169-355        AC B4NEW9.1
#=GS A0A4E0RPZ5_FASHE/172-357    AC A0A4E0RPZ5.1
#=GS A0A540KIQ3_MALBA/181-359    AC A0A540KIQ3.1
#=GS A0A0M8P0X7_9EURO/162-343    AC A0A0M8P0X7.1
#=GS A0A176WQY8_MARPO/271-473    AC A0A176WQY8.1
#=GS A0A395SW30_FUSSP/155-336    AC A0A395SW30.1
#=GS A0A251VMJ9_HELAN/220-405    AC A0A251VMJ9.1
#=GS F4P6P0_BATDJ/337-529        AC F4P6P0.1
#=GS A0A5E4NA12_9HEMI/150-336    AC A0A5E4NA12.1
#=GS A0A2A2LYT6_9BILA/126-300    AC A0A2A2LYT6.1
#=GS L8I350_9CETA/171-351        AC L8I350.1
#=GS A0A099ZXE8_CHAVO/95-290     AC A0A099ZXE8.1
#=GS A0A093XZ70_9PEZI/281-462    AC A0A093XZ70.1
#=GS A0A6P8ZYA1_THRPL/183-367    AC A0A6P8ZYA1.1
#=GS A0A2K6Q133_RHIRO/160-355    AC A0A2K6Q133.1
#=GS A0A161XI52_DAUCS/202-385    AC A0A161XI52.1
#=GS A0A3Q7RF06_VULVU/37-224     AC A0A3Q7RF06.1
#=GS A0A0E0CDN7_9ORYZ/212-402    AC A0A0E0CDN7.1
#=GS A0A2H5NHM2_CITUN/189-363    AC A0A2H5NHM2.1
#=GS A0A3S2LVV4_CHISP/167-353    AC A0A3S2LVV4.1
#=GS A0A3P9CT59_9CICH/121-302    AC A0A3P9CT59.1
#=GS A0A6J3Q308_TURTR/256-443    AC A0A6J3Q308.1
#=GS A0A401T382_CHIPU/77-263     AC A0A401T382.1
#=GS A0A2K6RLF5_RHIRO/307-499    AC A0A2K6RLF5.1
#=GS A2D9R2_TRIVA/148-338        AC A2D9R2.1
#=GS A0A2B4RUX0_STYPI/318-510    AC A0A2B4RUX0.1
#=GS A0A6P4EGS8_DRORH/73-232     AC A0A6P4EGS8.1
#=GS A0A0C3AZP6_PILCF/324-506    AC A0A0C3AZP6.1
#=GS A0A6P4ELB9_DRORH/66-232     AC A0A6P4ELB9.1
#=GS G0V556_NAUCC/173-367        AC G0V556.1
#=GS L1LC14_THEEQ/190-325        AC L1LC14.1
#=GS M2VX75_GALSU/202-376        AC M2VX75.1
#=GS A0A093G616_DRYPU/281-473    AC A0A093G616.1
#=GS A0A452IXE9_9SAUR/189-375    AC A0A452IXE9.1
#=GS A0A3Q0JEP6_DIACI/146-292    AC A0A3Q0JEP6.1
#=GS A0A7N5JSL3_AILME/151-346    AC A0A7N5JSL3.1
#=GS F6WY40_HORSE/167-350        AC F6WY40.2
#=GS C3Z9Y6_BRAFL/260-447        AC C3Z9Y6.1
#=GS A0A6I8U2R8_AEDAE/530-688    AC A0A6I8U2R8.1
#=GS A0A0H2RUI4_9AGAM/156-340    AC A0A0H2RUI4.1
#=GS A0A6D2HGE5_9BRAS/166-351    AC A0A6D2HGE5.1
#=GS A0A4D9B832_SALSN/219-404    AC A0A4D9B832.1
#=GS A0A0C2FFB5_9BILA/224-421    AC A0A0C2FFB5.1
#=GS A0A158QTS3_9CEST/412-596    AC A0A158QTS3.1
#=GS Q3YMU0_DROME/158-343        AC Q3YMU0.1
#=GS A0A2G9GWP4_9LAMI/223-403    AC A0A2G9GWP4.1
#=GS Q7Q5G3_ANOGA/1491-1653      AC Q7Q5G3.2
#=GS A0A6P8V795_GYMAC/572-765    AC A0A6P8V795.1
#=GS T1KLP2_TETUR/164-360        AC T1KLP2.1
#=GS A0A4X2LPV5_VOMUR/540-729    AC A0A4X2LPV5.1
#=GS A0A6Q2ZQM5_ESOLU/162-345    AC A0A6Q2ZQM5.1
#=GS G0WDA5_NAUDC/199-394        AC G0WDA5.1
#=GS A0A132A8A8_SARSC/176-375    AC A0A132A8A8.1
#=GS A0A1U8I073_GOSHI/170-339    AC A0A1U8I073.1
#=GS V4VB79_CITCL/42-230         AC V4VB79.1
#=GS A0A425BQF5_9PEZI/32-213     AC A0A425BQF5.1
#=GS A0A1Y2D1Q4_9FUNG/94-187     AC A0A1Y2D1Q4.1
#=GS A0A2I0B6T7_9ASPA/202-386    AC A0A2I0B6T7.1
#=GS U6MTB4_9EIME/171-329        AC U6MTB4.1
#=GS A0CCR5_PARTE/157-321        AC A0CCR5.1
#=GS A0A7M7QTK5_NASVI/919-1082   AC A0A7M7QTK5.1
#=GS A0A059BTL5_EUCGR/181-366    AC A0A059BTL5.1
#=GS A0A6J3FMU3_SAPAP/534-678    AC A0A6J3FMU3.1
#=GS A0A1B9GMU8_9TREE/320-484    AC A0A1B9GMU8.1
#=GS F4S6L6_MELLP/1-74           AC F4S6L6.1
#=GS A0A2K6SVS6_SAIBB/69-252     AC A0A2K6SVS6.1
#=GS A0A662X2L2_9STRA/557-723    AC A0A662X2L2.1
#=GS A0A667XTR6_9TELE/159-342    AC A0A667XTR6.1
#=GS A0A1R2CPE2_9CILI/155-334    AC A0A1R2CPE2.1
#=GS A0A5D2ZBU8_GOSMU/169-354    AC A0A5D2ZBU8.1
#=GS A0A4W2DS56_BOBOX/158-338    AC A0A4W2DS56.1
#=GS A0A267FFV0_9PLAT/162-342    AC A0A267FFV0.1
#=GS G1MRI5_MELGA/279-470        AC G1MRI5.2
#=GS A0A1Y2WZS2_9PEZI/158-338    AC A0A1Y2WZS2.1
#=GS A0A6J1UGZ9_9SAUR/158-339    AC A0A6J1UGZ9.1
#=GS A0A4U6WC70_SETVI/245-418    AC A0A4U6WC70.1
#=GS A0A3P7DMR0_WUCBA/162-349    AC A0A3P7DMR0.1
#=GS A0A446R4Y4_TRITD/157-342    AC A0A446R4Y4.1
#=GS A0A674NFD3_TAKRU/482-629    AC A0A674NFD3.1
#=GS A0A087XAG3_POEFO/202-388    AC A0A087XAG3.2
#=GS A0A0K0ERV7_STRER/155-337    AC A0A0K0ERV7.1
#=GS A0A2L2THY4_9HYPO/448-555    AC A0A2L2THY4.1
#=GS A0A485KJB6_9STRA/164-347    AC A0A485KJB6.1
#=GS A0A1D2NJF2_ORCCI/157-346    AC A0A1D2NJF2.1
#=GS A0A1S3FD89_DIPOR/161-341    AC A0A1S3FD89.1
#=GS A0A671XV00_SPAAU/149-339    AC A0A671XV00.1
#=GS A0A060WSB6_ONCMY/149-343    AC A0A060WSB6.1
#=GS A0A0V1P0C0_9BILA/153-341    AC A0A0V1P0C0.1
#=GS A0A7C8IVQ5_9PEZI/79-252     AC A0A7C8IVQ5.1
#=GS A0A6G0YZJ8_APHCR/166-350    AC A0A6G0YZJ8.1
#=GS D6X1N7_TRICA/169-355        AC D6X1N7.1
#=GS G2RBR9_THETT/1-87           AC G2RBR9.1
#=GS A0A6P3WGJ2_CLUHA/149-344    AC A0A6P3WGJ2.1
#=GS A0A1E3PQF1_9ASCO/147-328    AC A0A1E3PQF1.1
#=GS B4N406_DROWI/153-350        AC B4N406.1
#=GS A0A0V0XLT3_TRIPS/627-817    AC A0A0V0XLT3.1
#=GS T1G929_HELRO/297-491        AC T1G929.1
#=GS G3H0U6_CRIGR/81-276         AC G3H0U6.1
#=GS A0A2K6LRP1_RHIBE/119-303    AC A0A2K6LRP1.1
#=GS A0A6G0HHB6_LARCR/1248-1375  AC A0A6G0HHB6.1
#=GS A0A093GI49_DRYPU/511-700    AC A0A093GI49.1
#=GS A0A0V0V2N8_9BILA/617-807    AC A0A0V0V2N8.1
#=GS A0A364LBS9_9EURO/164-327    AC A0A364LBS9.1
#=GS A0A1V4J8F1_PATFA/167-350    AC A0A1V4J8F1.1
#=GS A0A2K6BKI4_MACNE/59-175     AC A0A2K6BKI4.1
#=GS A0A3Q3XBN6_MOLML/157-351    AC A0A3Q3XBN6.1
#=GS A0A6J2VY91_CHACN/536-728    AC A0A6J2VY91.1
#=GS F7BBX8_HORSE/512-701        AC F7BBX8.2
#=GS A0A1S3PY95_SALSA/105-299    AC A0A1S3PY95.1
#=GS A0A0S4KL52_BODSA/157-330    AC A0A0S4KL52.1
#=GS A0A0V1L2J7_9BILA/624-813    AC A0A0V1L2J7.1
#=GS A0A673AA83_9TELE/210-404    AC A0A673AA83.1
#=GS A0A1Y1JLV2_PLAGO/161-340    AC A0A1Y1JLV2.1
#=GS A0A2K5C3N7_AOTNA/180-367    AC A0A2K5C3N7.1
#=GS R0GXB2_9BRAS/179-347        AC R0GXB2.1
#=GS A0A673KET9_9TELE/193-380    AC A0A673KET9.1
#=GS M7CAR5_CHEMY/241-358        AC M7CAR5.1
#=GS B0KWG0_CALJA/160-355        AC B0KWG0.1
#=GS A0A4W5Q8F9_9TELE/90-260     AC A0A4W5Q8F9.1
#=GS A0A2V1CS28_9HELO/147-328    AC A0A2V1CS28.1
#=GS A0A1Y1WDP3_9FUNG/164-327    AC A0A1Y1WDP3.1
#=GS A0A6P8GNH9_CLUHA/530-722    AC A0A6P8GNH9.1
#=GS A0A7N5JT60_AILME/155-346    AC A0A7N5JT60.1
#=GS A0A484B1F0_DRONA/162-341    AC A0A484B1F0.1
#=GS A0A1U7WEI8_NICSY/181-364    AC A0A1U7WEI8.1
#=GS A0A2U3WQQ9_ODORO/160-355    AC A0A2U3WQQ9.1
#=GS A0A196SLR9_BLAHN/156-335    AC A0A196SLR9.1
#=GS A0A2P8XW08_BLAGE/281-434    AC A0A2P8XW08.1
#=GS A0A6G0V4L5_9BILA/272-468    AC A0A6G0V4L5.1
#=GS A0A1I8IWA7_9PLAT/193-374    AC A0A1I8IWA7.1
#=GS A0A195DJB1_9HYME/170-372    AC A0A195DJB1.1
#=GS A0A091PNH5_LEPDC/278-470    AC A0A091PNH5.1
#=GS T1G058_HELRO/156-340        AC T1G058.1
#=GS A0A2I0US47_LIMLA/212-348    AC A0A2I0US47.1
#=GS A0A3S2LPX6_ORYJA/189-370    AC A0A3S2LPX6.1
#=GS A0A3Q3L9M9_9LABR/167-251    AC A0A3Q3L9M9.1
#=GS K2RC15_MACPH/153-334        AC K2RC15.1
#=GS A0A669EPS0_ORENI/155-335    AC A0A669EPS0.1
#=GS A0A4S2LWQ4_OPIFE/89-267     AC A0A4S2LWQ4.1
#=GS A0A0V1CJ62_TRIBR/188-377    AC A0A0V1CJ62.1
#=GS A0A2G9TUG1_TELCI/7-133      AC A0A2G9TUG1.1
#=GS A0A673ACJ1_9TELE/210-405    AC A0A673ACJ1.1
#=GS A0A6J2VXM2_CHACN/156-350    AC A0A6J2VXM2.1
#=GS A0A1Y2EXP3_PROLT/148-328    AC A0A1Y2EXP3.1
#=GS A0A093ZSB5_9PEZI/1-62       AC A0A093ZSB5.1
#=GS A0A0P7X5A6_SCLFO/222-381    AC A0A0P7X5A6.1
#=GS A0A4W3IT15_CALMI/257-323    AC A0A4W3IT15.1
#=GS A0A183AV33_9TREM/187-303    AC A0A183AV33.1
#=GS A0A673L9T3_9TELE/133-308    AC A0A673L9T3.1
#=GS F7H0S1_CALJA/233-335        AC F7H0S1.2
#=GS A0A1X7VSB8_AMPQE/156-344    AC A0A1X7VSB8.1
#=GS A0A0R3WJ49_HYDTA/133-324    AC A0A0R3WJ49.1
#=GS A0A251UZ42_HELAN/166-345    AC A0A251UZ42.1
#=GS W9Z1X1_9EURO/153-333        AC W9Z1X1.1
#=GS A0A0K9RHA0_SPIOL/178-354    AC A0A0K9RHA0.1
#=GS A0A026WDR3_OOCBI/170-218    AC A0A026WDR3.1
#=GS A0A6P9ASP1_PANGU/64-251     AC A0A6P9ASP1.1
#=GS A0A1S3CRY3_CUCME/169-366    AC A0A1S3CRY3.1
#=GS A0A177ECH6_9MICR/254-431    AC A0A177ECH6.1
#=GS A0A0K0DFV0_ANGCA/169-276    AC A0A0K0DFV0.2
#=GS A0A6G1B1N7_CROCR/1-108      AC A0A6G1B1N7.1
#=GS W2T4V0_NECAM/151-339        AC W2T4V0.1
#=GS G3PM02_GASAC/524-723        AC G3PM02.1
#=GS A0A5D2ZEY1_GOSMU/169-354    AC A0A5D2ZEY1.1
#=GS A0A197K4K3_9FUNG/155-331    AC A0A197K4K3.1
#=GS A0A672SIP5_SINGR/132-315    AC A0A672SIP5.1
#=GS A0A7M7H488_NASVI/563-719    AC A0A7M7H488.1
#=GS J9FDI0_9SPIT/179-347        AC J9FDI0.1
#=GS A0A3Q4HPW5_NEOBR/144-328    AC A0A3Q4HPW5.1
#=GS A0A674AD89_SALTR/152-320    AC A0A674AD89.1
#=GS A0A445DJ13_ARAHY/246-408    AC A0A445DJ13.1
#=GS A0A0N5D4F1_THECL/158-338    AC A0A0N5D4F1.1
#=GS D7SRI7_VITVI/177-355        AC D7SRI7.1
#=GS A0A2P8YT03_BLAGE/156-342    AC A0A2P8YT03.1
#=GS A0A318ZJG8_9EURO/157-338    AC A0A318ZJG8.1
#=GS F0VJ43_NEOCL/518-624        AC F0VJ43.1
#=GS A0A674E536_SALTR/168-351    AC A0A674E536.1
#=GS H2NN23_PONAB/198-316        AC H2NN23.1
#=GS A0A6P3PXE2_PTEVA/160-355    AC A0A6P3PXE2.1
#=GS A0A498NIU6_LABRO/163-357    AC A0A498NIU6.1
#=GS M7NMG4_PNEMU/157-337        AC M7NMG4.1
#=GS A0A2K5WUC2_MACFA/215-398    AC A0A2K5WUC2.2
#=GS A0A0L0VTI0_9BASI/2-122      AC A0A0L0VTI0.1
#=GS A0A653CPB6_CALMS/127-313    AC A0A653CPB6.1
#=GS G4TCM4_SERID/154-340        AC G4TCM4.1
#=GS A0A1Y1NG91_PHOPY/151-345    AC A0A1Y1NG91.1
#=GS A0A0L6VR06_9BASI/190-372    AC A0A0L6VR06.1
#=GS A0A2U9BQG2_SCOMX/159-342    AC A0A2U9BQG2.1
#=GS A0A131ZTN0_SARSC/218-404    AC A0A131ZTN0.1
#=GS A0A4Y7ILN9_PAPSO/180-367    AC A0A4Y7ILN9.1
#=GS A0A341ADN2_NEOAA/63-250     AC A0A341ADN2.1
#=GS A0A1A6GFK9_NEOLE/286-478    AC A0A1A6GFK9.1
#=GS F1QP99_DANRE/152-346        AC F1QP99.1
#=GS A0A5N5JER1_PANHP/159-353    AC A0A5N5JER1.1
#=GS A0A0A1U6P2_ENTIV/146-322    AC A0A0A1U6P2.1
#=GS A0A3P8VFP3_CYNSE/48-235     AC A0A3P8VFP3.1
#=GS A0A2K6H0T2_PROCO/180-367    AC A0A2K6H0T2.1
#=GS T1L2F7_TETUR/159-343        AC T1L2F7.1
#=GS A0A444U698_ACIRT/89-211     AC A0A444U698.1
#=GS A0A4Q4W4U6_9PEZI/138-317    AC A0A4Q4W4U6.1
#=GS A0A195BY72_9HYME/125-319    AC A0A195BY72.1
#=GS A0A494BB11_MOUSE/161-341    AC A0A494BB11.1
#=GS A0A653CI05_CALMS/162-341    AC A0A653CI05.1
#=GS A0A0L0T3K6_ALLM3/158-338    AC A0A0L0T3K6.1
#=GS A0A672UA01_STRHB/1-130      AC A0A672UA01.1
#=GS A0A670IKI8_PODMU/274-454    AC A0A670IKI8.1
#=GS A0A5N6RBH3_9ROSI/176-356    AC A0A5N6RBH3.1
#=GS A0A3Q2X4J0_HAPBU/306-497    AC A0A3Q2X4J0.1
#=GS A0A6I8VRC2_DROPS/200-357    AC A0A6I8VRC2.1
#=GS A0A3P8YKA2_ESOLU/177-361    AC A0A3P8YKA2.1
#=GS A0A093PN97_PHACA/148-331    AC A0A093PN97.1
#=GS M0RN88_MUSAM/117-297        AC M0RN88.1
#=GS A0A2Y9ETM1_PHYMC/63-250     AC A0A2Y9ETM1.1
#=GS A0A6I9L6J7_PERMB/127-318    AC A0A6I9L6J7.1
#=GS H9GC87_ANOCA/534-724        AC H9GC87.2
#=GS A0A0L7QZB8_9HYME/152-346    AC A0A0L7QZB8.1
#=GS G3ILJ4_CRIGR/108-293        AC G3ILJ4.1
#=GS A0A1R2D563_9CILI/166-351    AC A0A1R2D563.1
#=GS A0A0V1CAL3_TRIBR/153-341    AC A0A0V1CAL3.1
#=GS PDIA4_MOUSE/305-497         AC P08003.3
#=GS A0A6P3RL72_PTEVA/180-365    AC A0A6P3RL72.1
#=GS A0A3N0XE38_ANAGA/159-343    AC A0A3N0XE38.1
#=GS A0A6P3QKA5_PTEVA/105-288    AC A0A6P3QKA5.1
#=GS A0A177DWY3_ALTAL/150-331    AC A0A177DWY3.1
#=GS A0A7G2CFK3_9TRYP/158-331    AC A0A7G2CFK3.1
#=GS A0A6J3QQF5_TURTR/203-318    AC A0A6J3QQF5.1
#=GS A0A6P7X5K6_9AMPH/69-256     AC A0A6P7X5K6.1
#=GS A0A6P6F428_OCTDE/164-344    AC A0A6P6F428.1
#=GS A0A6J3LEB2_9HYME/605-761    AC A0A6J3LEB2.1
#=GS A0A452RQK0_URSAM/163-347    AC A0A452RQK0.1
#=GS A0A0C9N5U4_9FUNG/159-337    AC A0A0C9N5U4.1
#=GS A0A4U0XR79_9PEZI/151-335    AC A0A4U0XR79.1
#=GS H2YJI5_CIOSA/268-461        AC H2YJI5.1
#=GS A0A7N6B9H1_ANATE/149-344    AC A0A7N6B9H1.1
#=GS A0A183TSR5_SCHSO/7-123      AC A0A183TSR5.1
#=GS A0A673ZTM4_SALTR/159-342    AC A0A673ZTM4.1
#=GS A0A2C6A783_9HYPO/156-337    AC A0A2C6A783.1
#=GS A0A507CXQ9_9FUNG/184-373    AC A0A507CXQ9.1
#=GS A0A4W2EW39_BOBOX/167-350    AC A0A4W2EW39.1
#=GS A0A7P0T9U6_HUMAN/161-345    AC A0A7P0T9U6.1
#=GS A0A653CF78_CALMS/149-342    AC A0A653CF78.1
#=GS A0A6J2UX94_CHACN/153-333    AC A0A6J2UX94.1
#=GS A0A5H1ZRH3_BOVIN/92-279     AC A0A5H1ZRH3.1
#=GS A0A445IDE9_GLYSO/214-394    AC A0A445IDE9.1
#=GS A0A4U1FGP9_MONMO/138-323    AC A0A4U1FGP9.1
#=GS A0A165DNW0_EXIGL/132-306    AC A0A165DNW0.1
#=GS A0A1L8EY55_XENLA/195-380    AC A0A1L8EY55.1
#=GS G3X3Q0_SARHA/196-381        AC G3X3Q0.2
#=GS A0A094L901_PODCR/78-273     AC A0A094L901.1
#=GS A0A395MUL9_9HYPO/155-336    AC A0A395MUL9.1
#=GS A0A7E5WEC3_TRINI/150-346    AC A0A7E5WEC3.1
#=GS A0A5N5N5I6_PANHP/542-733    AC A0A5N5N5I6.1
#=GS A0A3Q2EKD7_CYPVA/159-352    AC A0A3Q2EKD7.1
#=GS A0A024WH65_PLAFA/207-381    AC A0A024WH65.1
#=GS A0A2K0WDQ4_GIBNY/145-319    AC A0A2K0WDQ4.1
#=GS A0A093FNV0_TYTAL/124-304    AC A0A093FNV0.1
#=GS A0A0E0G855_ORYNI/165-351    AC A0A0E0G855.1
#=GS M0ZRX8_SOLTU/214-399        AC M0ZRX8.1
#=GS A0A087GXZ3_ARAAL/239-419    AC A0A087GXZ3.1
#=GS A0A2K6EXS4_PROCO/264-424    AC A0A2K6EXS4.1
#=GS A0A3Q0GQW9_ALLSI/56-243     AC A0A3Q0GQW9.1
#=GS A0A067GYX9_CITSI/60-240     AC A0A067GYX9.1
#=GS A0A212FP73_DANPL/159-344    AC A0A212FP73.1
#=GS A0A3Q3VYL6_MOLML/141-324    AC A0A3Q3VYL6.1
#=GS A0A667WVL2_9TELE/153-336    AC A0A667WVL2.1
#=GS A0A0E0KQW3_ORYPU/170-354    AC A0A0E0KQW3.1
#=GS A0A6J2N925_9CHIR/64-251     AC A0A6J2N925.2
#=GS A0A7H8QLC6_9EURO/210-356    AC A0A7H8QLC6.1
#=GS F0VAI6_NEOCL/160-329        AC F0VAI6.1
#=GS A0A1R3R8E3_ASPC5/157-338    AC A0A1R3R8E3.1
#=GS A0A6P5CF61_BOSIN/531-720    AC A0A6P5CF61.1
#=GS A0A6J0XPZ4_ODOVR/140-320    AC A0A6J0XPZ4.1
#=GS A0A6A5PD65_LUPAL/218-332    AC A0A6A5PD65.1
#=GS A0A4W4GBN5_ELEEL/129-295    AC A0A4W4GBN5.1
#=GS A0A5C7GXR8_9ROSI/1070-1220  AC A0A5C7GXR8.1
#=GS A0A0B0NUY4_GOSAR/169-354    AC A0A0B0NUY4.1
#=GS A0A1S2ZJW4_ERIEU/241-427    AC A0A1S2ZJW4.1
#=GS A0A0D2JAH8_9EURO/154-333    AC A0A0D2JAH8.1
#=GS A0A6P4EF23_DRORH/170-356    AC A0A6P4EF23.1
#=GS A0A6J2KNQ0_BOMMA/520-676    AC A0A6J2KNQ0.1
#=GS A0A3B3HTP8_ORYLA/113-307    AC A0A3B3HTP8.1
#=GS A0A6G1QX57_9TELE/157-349    AC A0A6G1QX57.1
#=GS V7AXU4_PHAVU/171-356        AC V7AXU4.1
#=GS A0A3P6RBE1_CYLGO/50-232     AC A0A3P6RBE1.1
#=GS A0A3S0ZRR1_ELYCH/253-446    AC A0A3S0ZRR1.1
#=GS A0A6J1VIJ2_9SAUR/155-346    AC A0A6J1VIJ2.1
#=GS Q93XQ7_WHEAT/176-361        AC Q93XQ7.1
#=GS M5EC98_MALS4/158-341        AC M5EC98.1
#=GS V4LYR0_EUTSA/178-348        AC V4LYR0.1
#=GS A0A2T7CV16_9POAL/181-358    AC A0A2T7CV16.1
#=GS A0A556TXH9_BAGYA/2125-2316  AC A0A556TXH9.1
#=GS A0A4W4EIU8_ELEEL/173-350    AC A0A4W4EIU8.1
#=GS A0A6J1QP78_9HYME/160-344    AC A0A6J1QP78.1
#=GS A0A401KEZ5_ASPAW/157-338    AC A0A401KEZ5.1
#=GS A0A671XUX4_SPAAU/158-344    AC A0A671XUX4.1
#=GS W2SJU3_NECAM/157-333        AC W2SJU3.1
#=GS A0A671FK58_RHIFE/64-251     AC A0A671FK58.1
#=GS A0A2K6AFY1_MANLE/310-502    AC A0A2K6AFY1.1
#=GS Q5EUE1_MAIZE/172-357        AC Q5EUE1.1
#=GS A0A164RX66_9AGAM/366-531    AC A0A164RX66.1
#=GS A0A6P7NRD4_BETSP/159-353    AC A0A6P7NRD4.1
#=GS A0A4Q4UVF8_9PEZI/139-318    AC A0A4Q4UVF8.1
#=GS Q8SWX6_DROME/61-232         AC Q8SWX6.1
#=GS A0A1E3IAG9_9TREE/311-483    AC A0A1E3IAG9.1
#=GS A0A672NER5_SINGR/133-310    AC A0A672NER5.1
#=GS A2G5I8_TRIVA/151-346        AC A2G5I8.1
#=GS U6KLI4_EIMTE/198-378        AC U6KLI4.1
#=GS A0A6D2K7W2_9BRAS/168-352    AC A0A6D2K7W2.1
#=GS A0A194QEL2_PAPXU/251-412    AC A0A194QEL2.1
#=GS A0A384D0F8_URSMA/135-330    AC A0A384D0F8.1
#=GS A0A4Z2DY83_SCHJA/33-219     AC A0A4Z2DY83.1
#=GS A0A340X052_LIPVE/63-250     AC A0A340X052.1
#=GS A0A0N1IT20_9HYME/159-344    AC A0A0N1IT20.1
#=GS A0A2B7ZCF5_9EURO/161-342    AC A0A2B7ZCF5.1
#=GS A0A2Y9K7R9_ENHLU/131-311    AC A0A2Y9K7R9.1
#=GS E2BCN6_HARSA/155-349        AC E2BCN6.1
#=GS A0A3N6QGD1_BRACR/167-330    AC A0A3N6QGD1.1
#=GS G1RCW8_NOMLE/158-338        AC G1RCW8.1
#=GS G1PET3_MYOLU/179-366        AC G1PET3.1
#=GS A0A183E4I9_9BILA/2-115      AC A0A183E4I9.1
#=GS A0A3B6IQT3_WHEAT/152-337    AC A0A3B6IQT3.1
#=GS A0A482VN82_9CUCU/268-444    AC A0A482VN82.1
#=GS A0A1V9X514_9ACAR/141-322    AC A0A1V9X514.1
#=GS G3WL18_SARHA/162-346        AC G3WL18.2
#=GS A0A0M3J6B4_ANISI/48-150     AC A0A0M3J6B4.1
#=GS A0A7C8I2I6_9PLEO/150-331    AC A0A7C8I2I6.1
#=GS R0JGK3_ANAPL/494-683        AC R0JGK3.1
#=GS A0A0Q3MQN7_AMAAE/186-372    AC A0A0Q3MQN7.1
#=GS A0A439CS28_9PEZI/157-338    AC A0A439CS28.1
#=GS V5BHP7_TRYCR/81-258         AC V5BHP7.1
#=GS A0A672M2C4_SINGR/147-328    AC A0A672M2C4.1
#=GS G4N012_MAGO7/413-551        AC G4N012.1
#=GS B4HI55_DROSE/161-345        AC B4HI55.1
#=GS A0A3R7FG54_CLOSI/158-342    AC A0A3R7FG54.1
#=GS Q1M2W3_CAEBR/157-341        AC Q1M2W3.1
#=GS A0A151NEW4_ALLMI/155-335    AC A0A151NEW4.1
#=GS A0A395HI20_ASPHC/161-342    AC A0A395HI20.1
#=GS W6Q4U7_PENRF/162-343        AC W6Q4U7.1
#=GS L8FTE5_PSED2/382-534        AC L8FTE5.1
#=GS A0A3Q7RNY3_CALUR/158-338    AC A0A3Q7RNY3.1
#=GS A0A3P8UCL2_AMPPE/307-499    AC A0A3P8UCL2.1
#=GS A0A0K0DFV2_ANGCA/124-213    AC A0A0K0DFV2.1
#=GS A0A2I3T0C5_PANTR/124-313    AC A0A2I3T0C5.1
#=GS A0A5J5DN51_9PERO/137-321    AC A0A5J5DN51.1
#=GS A0A7M7MKD3_APIME/1549-1711  AC A0A7M7MKD3.1
#=GS A0A6I9ZLT3_ACIJB/246-429    AC A0A6I9ZLT3.1
#=GS A0A195CIJ3_9HYME/1458-1620  AC A0A195CIJ3.1
#=GS A0A3Q7HIP9_SOLLC/998-1181   AC A0A3Q7HIP9.1
#=GS A0A034WXY3_BACDO/156-341    AC A0A034WXY3.1
#=GS A0A1Y2V7H2_9PEZI/154-335    AC A0A1Y2V7H2.1
#=GS A0A044UYX9_ONCVO/319-437    AC A0A044UYX9.1
#=GS A0A1I7W169_LOALO/132-312    AC A0A1I7W169.1
#=GS A0A7M7HAD9_NASVI/152-347    AC A0A7M7HAD9.1
#=GS A0A3L6PU19_PANMI/173-357    AC A0A3L6PU19.1
#=GS A0A6P3WQM3_DINQU/568-726    AC A0A6P3WQM3.1
#=GS A0A0R3TAR7_RODNA/414-599    AC A0A0R3TAR7.1
#=GS A0A093R9P0_PYGAD/148-331    AC A0A093R9P0.1
#=GS A0A6J0SCE2_9SAUR/178-363    AC A0A6J0SCE2.1
#=GS B4N522_DROWI/159-343        AC B4N522.1
#=GS A0A3Q0GSK8_ALLSI/133-318    AC A0A3Q0GSK8.1
#=GS A0A0R0KCB6_SOYBN/1-83       AC A0A0R0KCB6.1
#=GS A0A665UY19_ECHNA/159-343    AC A0A665UY19.1
#=GS A0A093GSQ2_STRCA/511-698    AC A0A093GSQ2.1
#=GS A0A5C7H7K4_9ROSI/167-352    AC A0A5C7H7K4.1
#=GS A0A6P8I095_ACTTE/157-346    AC A0A6P8I095.1
#=GS A0A024X6A7_PLAFC/59-238     AC A0A024X6A7.1
#=GS A0A091JW53_COLST/1-186      AC A0A091JW53.1
#=GS M4F015_BRARP/178-348        AC M4F015.1
#=GS A0A5N5T9B1_9CRUS/136-319    AC A0A5N5T9B1.1
#=GS A0A059CSG7_EUCGR/63-240     AC A0A059CSG7.1
#=GS A0A2P6TWV1_CHLSO/164-376    AC A0A2P6TWV1.1
#=GS A0A1Y1UK05_9TREE/151-337    AC A0A1Y1UK05.1
#=GS A0A4W3KC14_CALMI/236-419    AC A0A4W3KC14.1
#=GS A0A091V7A8_OPIHO/44-228     AC A0A091V7A8.1
#=GS A0A6Q2YZ97_ESOLU/221-385    AC A0A6Q2YZ97.1
#=GS A0A4W4EIV5_ELEEL/161-338    AC A0A4W4EIV5.1
#=GS A0A4W6CLW6_LATCA/129-221    AC A0A4W6CLW6.1
#=GS A0A5A7QVS4_STRAF/172-337    AC A0A5A7QVS4.1
#=GS A0A0W8CE85_PHYNI/178-346    AC A0A0W8CE85.1
#=GS R1EC46_BOTPV/153-334        AC R1EC46.1
#=GS N4V1F0_COLOR/148-324        AC N4V1F0.1
#=GS A0A7N6AX53_ANATE/309-500    AC A0A7N6AX53.1
#=GS A0A0N4WGR2_HAEPC/154-342    AC A0A0N4WGR2.1
#=GS A0A137P2B2_CONC2/488-669    AC A0A137P2B2.1
#=GS B7P367_IXOSC/53-234         AC B7P367.1
#=GS A0A2H2HXY2_CAEJA/157-341    AC A0A2H2HXY2.1
#=GS X0CEG5_FUSOX/457-569        AC X0CEG5.1
#=GS A0A166G4H8_DAUCS/321-450    AC A0A166G4H8.1
#=GS A0A6J1JYN0_CUCMA/169-366    AC A0A6J1JYN0.1
#=GS D2GW48_AILME/160-355        AC D2GW48.1
#=GS E3MI90_CAERE/111-294        AC E3MI90.1
#=GS A0A3Q3EEE3_9LABR/213-315    AC A0A3Q3EEE3.1
#=GS A0A3B0JHX0_DROGU/161-344    AC A0A3B0JHX0.1
#=GS B9SUB3_RICCO/215-399        AC B9SUB3.1
#=GS A0A4W3I1X2_CALMI/151-337    AC A0A4W3I1X2.1
#=GS A0A6P7YTA9_9AMPH/223-409    AC A0A6P7YTA9.1
#=GS A0A4S4EEG4_CAMSI/215-316    AC A0A4S4EEG4.1
#=GS A0A668SW73_OREAU/159-343    AC A0A668SW73.1
#=GS K7M6X1_SOYBN/170-355        AC K7M6X1.1
#=GS A0A6I9UEM7_SESIN/170-353    AC A0A6I9UEM7.1
#=GS A0A665WBL4_ECHNA/306-497    AC A0A665WBL4.1
#=GS E2A9W2_CAMFO/159-345        AC E2A9W2.1
#=GS V4SHY0_CITCL/221-406        AC V4SHY0.1
#=GS A0A672NF19_SINGR/158-352    AC A0A672NF19.1
#=GS A0A3B5QL02_XIPMA/159-342    AC A0A3B5QL02.1
#=GS A0A6P7KKV7_9TELE/306-498    AC A0A6P7KKV7.1
#=GS M7BQL1_CHEMY/291-482        AC M7BQL1.1
#=GS A0A0N8PZC9_RHOGW/150-335    AC A0A0N8PZC9.1
#=GS A0A6J1NNA3_BICAN/151-337    AC A0A6J1NNA3.1
#=GS A0A0L1KR16_9EUGL/152-328    AC A0A0L1KR16.1
#=GS A0A7P0TA35_HUMAN/195-379    AC A0A7P0TA35.1
#=GS S7NLU4_MYOBR/164-249        AC S7NLU4.1
#=GS A0A7N9IEA5_MACFA/167-350    AC A0A7N9IEA5.1
#=GS A0A394DHI2_LUPAN/181-359    AC A0A394DHI2.1
#=GS A0A166G4H8_DAUCS/173-328    AC A0A166G4H8.1
#=GS A0A068V9A4_COFCA/151-346    AC A0A068V9A4.1
#=GS A0A0L9UP97_PHAAN/199-384    AC A0A0L9UP97.1
#=GS K6ULM9_PLACD/1-159          AC K6ULM9.1
#=GS A0A5J9V1J8_9POAL/363-539    AC A0A5J9V1J8.1
#=GS PDI1_SCHPO/154-335          AC Q10057.1
#=GS A0A2J7R3Z5_9NEOP/154-341    AC A0A2J7R3Z5.1
#=GS W5N2D8_LEPOC/537-728        AC W5N2D8.1
#=GS A0A367JTK5_RHIAZ/156-337    AC A0A367JTK5.1
#=GS A0A493U129_ANAPP/288-479    AC A0A493U129.1
#=GS A0A0L8FQM5_OCTBM/165-290    AC A0A0L8FQM5.1
#=GS A0A6J1WL33_GALME/711-888    AC A0A6J1WL33.1
#=GS A0A672FQF0_SALFA/137-303    AC A0A672FQF0.1
#=GS A0A674E503_SALTR/156-339    AC A0A674E503.1
#=GS A0A484BES5_DRONA/158-343    AC A0A484BES5.1
#=GS A0A1A8VSI5_9APIC/106-273    AC A0A1A8VSI5.1
#=GS B4JJY6_DROGR/171-357        AC B4JJY6.1
#=GS A0A669C2C1_ORENI/103-271    AC A0A669C2C1.1
#=GS A0A6P7SC29_OCTVU/53-241     AC A0A6P7SC29.1
#=GS A0A6J0K8F6_RAPSA/246-368    AC A0A6J0K8F6.1
#=GS A0A226PJS9_COLVI/187-370    AC A0A226PJS9.1
#=GS A0A6P8SHN9_GEOSA/210-396    AC A0A6P8SHN9.1
#=GS A0A6P6J8P5_CARAU/309-501    AC A0A6P6J8P5.1
#=GS A0A437CGG0_ORYJA/153-335    AC A0A437CGG0.1
#=GS A0A6A4PQX4_LUPAL/164-349    AC A0A6A4PQX4.1
#=GS A0A1B9GP93_9TREE/155-340    AC A0A1B9GP93.1
#=GS A2FDI3_TRIVA/160-350        AC A2FDI3.1
#=GS A0A0B2V4Q3_TOXCA/192-372    AC A0A0B2V4Q3.1
#=GS A0A2K6FLW3_PROCO/4-150      AC A0A2K6FLW3.1
#=GS A0A0L0N863_TOLOC/219-398    AC A0A0L0N863.1
#=GS A0A2G2YHV6_CAPAN/230-410    AC A0A2G2YHV6.1
#=GS A0A672JB19_SALFA/97-197     AC A0A672JB19.1
#=GS G8BKY1_CANPC/171-361        AC G8BKY1.1
#=GS G3PX36_GASAC/175-359        AC G3PX36.1
#=GS PDI15_ARATH/211-396         AC A3KPF5.1
#=GS A0A553RGP0_9TELE/1516-1710  AC A0A553RGP0.1
#=GS G0ME04_CAEBE/359-529        AC G0ME04.1
#=GS A0A0K0G3N7_STRVS/389-567    AC A0A0K0G3N7.1
#=GS A0A0R0GWE6_SOYBN/106-291    AC A0A0R0GWE6.1
#=GS J9ICK0_9SPIT/163-334        AC J9ICK0.1
#=GS A0A4S8MYX0_DENBC/152-340    AC A0A4S8MYX0.1
#=GS A0A6J0M8L0_RAPSA/168-353    AC A0A6J0M8L0.1
#=GS A0A093F911_GAVST/148-331    AC A0A093F911.1
#=GS G2XBV9_VERDV/158-333        AC G2XBV9.1
#=GS A0A162I717_9HYPO/156-337    AC A0A162I717.1
#=GS PDI_MAIZE/172-361           AC P52588.1
#=GS S9XFM9_CAMFR/180-365        AC S9XFM9.1
#=GS A0A0N4SXF4_BRUPA/162-351    AC A0A0N4SXF4.1
#=GS A0A061GY45_THECC/234-414    AC A0A061GY45.1
#=GS A0A010QEY5_9PEZI/49-173     AC A0A010QEY5.1
#=GS A0A663E119_AQUCH/317-508    AC A0A663E119.1
#=GS H2VIJ2_CAEJA/121-318        AC H2VIJ2.2
#=GS A0A6J0LL21_RAPSA/240-418    AC A0A6J0LL21.1
#=GS A0A2K5S945_CEBIM/163-347    AC A0A2K5S945.1
#=GS PDIA1_CHICK/166-350         AC P09102.3
#=GS S3C5C3_OPHP1/147-312        AC S3C5C3.1
#=GS A0A446Y2J9_TRITD/148-331    AC A0A446Y2J9.1
#=GS G3SN29_LOXAF/176-361        AC G3SN29.1
#=GS W5NA83_LEPOC/160-355        AC W5NA83.1
#=GS F1SMY1_PIG/144-325          AC F1SMY1.3
#=GS A0A673ADC4_9TELE/151-332    AC A0A673ADC4.1
#=GS A0A669BDC8_ORENI/143-329    AC A0A669BDC8.1
#=GS B3MIN9_DROAN/533-690        AC B3MIN9.2
#=GS A0A2T4H5X8_FUSCU/155-336    AC A0A2T4H5X8.1
#=GS H2USA8_TAKRU/152-347        AC H2USA8.3
#=GS A0A6P3F2A6_OCTDE/182-369    AC A0A6P3F2A6.1
#=GS A0A6G1AWS4_CROCR/160-355    AC A0A6G1AWS4.1
#=GS A0A4U6UW70_SETVI/206-391    AC A0A4U6UW70.1
#=GS W9R8B0_9ROSA/176-352        AC W9R8B0.1
#=GS A0A4S8J0M0_MUSBA/237-416    AC A0A4S8J0M0.1
#=GS J9IJ09_9SPIT/244-441        AC J9IJ09.1
#=GS A0A0E0A5R7_9ORYZ/178-363    AC A0A0E0A5R7.1
#=GS A0A6J1NTD1_BICAN/51-255     AC A0A6J1NTD1.1
#=GS A0A3Q4HMW1_NEOBR/29-216     AC A0A3Q4HMW1.1
#=GS A0A446RWP9_TRITD/148-333    AC A0A446RWP9.1
#=GS A0A195FK72_9HYME/160-344    AC A0A195FK72.1
#=GS B7Q9F1_IXOSC/159-343        AC B7Q9F1.1
#=GS S7MN58_MYOBR/364-556        AC S7MN58.1
#=GS A0A1U8GVQ2_CAPAN/168-355    AC A0A1U8GVQ2.1
#=GS A0A0J7KRU1_LASNI/68-261     AC A0A0J7KRU1.1
#=GS A0A059EKG3_9MICR/307-444    AC A0A059EKG3.1
#=GS A0A444TKP8_ARMVU/159-343    AC A0A444TKP8.1
#=GS A0A0L7KYH3_9NEOP/127-293    AC A0A0L7KYH3.1
#=GS A0A6P7TYN8_OCTVU/183-366    AC A0A6P7TYN8.1
#=GS A0A0C9MI30_9FUNG/262-440    AC A0A0C9MI30.1
#=GS A0A154PCH6_DUFNO/152-346    AC A0A154PCH6.1
#=GS A0A6P3X351_DINQU/170-372    AC A0A6P3X351.1
#=GS A0A6J3F606_SAPAP/289-481    AC A0A6J3F606.1
#=GS A0A1U8JK08_GOSHI/228-412    AC A0A1U8JK08.1
#=GS A0A060WQP1_ONCMY/159-342    AC A0A060WQP1.1
#=GS A0A151PDR1_ALLMI/522-711    AC A0A151PDR1.1
#=GS A0A093BGI6_CHAPE/148-331    AC A0A093BGI6.1
#=GS A0A668SYM4_OREAU/140-323    AC A0A668SYM4.1
#=GS A0A2K5J4I9_COLAP/313-505    AC A0A2K5J4I9.1
#=GS A0A672L6I6_SINGR/135-318    AC A0A672L6I6.1
#=GS A0A448YYP2_9STRA/154-289    AC A0A448YYP2.1
#=GS A0A1Q3BVQ9_CEPFO/225-410    AC A0A1Q3BVQ9.1
#=GS A0A167XIA5_CORFA/156-338    AC A0A167XIA5.1
#=GS A0A6J3FV15_SAPAP/64-251     AC A0A6J3FV15.1
#=GS A0A0V1P9Z6_9BILA/172-356    AC A0A0V1P9Z6.1
#=GS A0A672QXI4_SINGR/162-346    AC A0A672QXI4.1
#=GS A0A5E4CQP2_MARMO/13-146     AC A0A5E4CQP2.1
#=GS A0A4P1R6S0_LUPAN/210-395    AC A0A4P1R6S0.1
#=GS A0A1U8HTD0_GOSHI/173-341    AC A0A1U8HTD0.1
#=GS A0A091FRM5_9AVES/1-186      AC A0A091FRM5.1
#=GS A0A2G9ULE4_TELCI/1-173      AC A0A2G9ULE4.1
#=GS W5N710_LEPOC/311-503        AC W5N710.1
#=GS A0A5E4QC78_9NEOP/157-313    AC A0A5E4QC78.1
#=GS H0YZ62_TAEGU/165-349        AC H0YZ62.2
#=GS A0A2K5JD59_COLAP/165-280    AC A0A2K5JD59.1
#=GS A0A665X5M0_ECHNA/149-338    AC A0A665X5M0.1
#=GS A0A671FVG8_RHIFE/158-338    AC A0A671FVG8.1
#=GS A0A4Q4V3H8_9PEZI/157-338    AC A0A4Q4V3H8.1
#=GS A0A3N0XMM4_ANAGA/159-339    AC A0A3N0XMM4.1
#=GS A0A2J6PVB0_9HELO/152-333    AC A0A2J6PVB0.1
#=GS A0A6J0V3K0_9SAUR/303-495    AC A0A6J0V3K0.1
#=GS A0A1S3B2H9_CUCME/140-322    AC A0A1S3B2H9.1
#=GS A0A1Q5T6K9_9EURO/163-344    AC A0A1Q5T6K9.1
#=GS A0A6G0XD71_9STRA/231-420    AC A0A6G0XD71.1
#=GS R7YTN6_CONA1/151-332        AC R7YTN6.1
#=GS A0A4Z0YWD0_9PEZI/80-252     AC A0A4Z0YWD0.1
#=GS B6JV82_SCHJY/155-334        AC B6JV82.1
#=GS A0A3M7N6Q1_9EURO/157-337    AC A0A3M7N6Q1.1
#=GS A0A0L8H6F8_OCTBM/545-735    AC A0A0L8H6F8.1
#=GS A0A151WTY0_9HYME/571-727    AC A0A151WTY0.1
#=GS A0A0V0TIZ5_9BILA/618-807    AC A0A0V0TIZ5.1
#=GS A0A553MT40_9TELE/178-379    AC A0A553MT40.1
#=GS A0A6I8U7J5_AEDAE/518-676    AC A0A6I8U7J5.1
#=GS A0A2G8STN9_9APHY/155-342    AC A0A2G8STN9.1
#=GS A0A1V9YXV6_9STRA/228-425    AC A0A1V9YXV6.1
#=GS A0A5K1U1B6_CALJA/311-504    AC A0A5K1U1B6.1
#=GS A0A671Q2A9_9TELE/159-345    AC A0A671Q2A9.1
#=GS H2NGQ1_PONAB/64-251         AC H2NGQ1.1
#=GS A0A0N8K0H1_SCLFO/153-237    AC A0A0N8K0H1.1
#=GS E3MG39_CAERE/172-356        AC E3MG39.1
#=GS G4MP26_MAGO7/159-343        AC G4MP26.1
#=GS A0A067NEA9_PLEOS/76-221     AC A0A067NEA9.1
#=GS A0A195B1Q4_9HYME/1672-1834  AC A0A195B1Q4.1
#=GS A0A093IGH8_DRYPU/1-185      AC A0A093IGH8.1
#=GS A0A3L6RUN9_PANMI/185-359    AC A0A3L6RUN9.1
#=GS A0A674GI90_TAEGU/167-350    AC A0A674GI90.1
#=GS A0A446X382_TRITD/150-333    AC A0A446X382.1
#=GS A0A6Q2Y3T2_ESOLU/154-349    AC A0A6Q2Y3T2.1
#=GS A0A6J2WZ55_CHACN/149-344    AC A0A6J2WZ55.1
#=GS A0A409W233_9AGAR/529-714    AC A0A409W233.1
#=GS A0A0B1P5Z4_UNCNE/416-552    AC A0A0B1P5Z4.1
#=GS A0A1S3K0F5_LINUN/186-370    AC A0A1S3K0F5.1
#=GS A0A199W2X7_ANACO/174-359    AC A0A199W2X7.1
#=GS A0A091IQQ7_EGRGA/112-296    AC A0A091IQQ7.1
#=GS G5BXX5_HETGA/183-370        AC G5BXX5.1
#=GS A6R1X2_AJECN/169-350        AC A6R1X2.1
#=GS A0A5J5F144_9PEZI/162-340    AC A0A5J5F144.1
#=GS A0A1L9TEJ3_9EURO/267-363    AC A0A1L9TEJ3.1
#=GS A0A6J3L2G9_9HYME/170-356    AC A0A6J3L2G9.1
#=GS A0A3Q7THZ2_URSAR/160-355    AC A0A3Q7THZ2.1
#=GS G7E347_MIXOS/147-327        AC G7E347.1
#=GS A0A2D3V1W4_9PEZI/150-334    AC A0A2D3V1W4.1
#=GS A0A540K5P9_MALBA/169-354    AC A0A540K5P9.1
#=GS A0A665WIJ0_ECHNA/159-342    AC A0A665WIJ0.1
#=GS E4XGC3_OIKDI/154-272        AC E4XGC3.1
#=GS B4K2L9_DROGR/72-261         AC B4K2L9.1
#=GS I3NCT3_ICTTR/309-501        AC I3NCT3.1
#=GS W6U744_ECHGR/157-341        AC W6U744.1
#=GS A0A0B2UJM4_TOXCA/158-341    AC A0A0B2UJM4.1
#=GS A0A6P3VQN2_CLUHA/243-437    AC A0A6P3VQN2.1
#=GS T1GU42_MEGSC/109-296        AC T1GU42.1
#=GS B9T6K9_RICCO/181-352        AC B9T6K9.1
#=GS A0A061FKQ2_THECC/169-350    AC A0A061FKQ2.1
#=GS A0A672RR62_SINGR/152-346    AC A0A672RR62.1
#=GS A0A2P5AC12_PARAD/218-404    AC A0A2P5AC12.1
#=GS A0A671YHN1_SPAAU/46-234     AC A0A671YHN1.1
#=GS A0A0M3QTN5_DROBS/66-255     AC A0A0M3QTN5.1
#=GS A0A5F4CCV5_CANLF/121-303    AC A0A5F4CCV5.1
#=GS A0A4W3JH19_CALMI/142-325    AC A0A4W3JH19.1
#=GS A0A2I0XEN1_9ASPA/199-354    AC A0A2I0XEN1.1
#=GS A0A4U1FAR8_MONMO/197-392    AC A0A4U1FAR8.1
#=GS A0A2U3VCU6_ODORO/167-350    AC A0A2U3VCU6.1
#=GS A0A485MIT8_LYNPA/534-723    AC A0A485MIT8.1
#=GS A0A6P7L1Q3_BETSP/126-306    AC A0A6P7L1Q3.1
#=GS A0A556TTK0_BAGYA/23-234     AC A0A556TTK0.1
#=GS A0A6P7LV38_BETSP/554-753    AC A0A6P7LV38.1
#=GS G3PX42_GASAC/146-332        AC G3PX42.1
#=GS A0A6J1W0S0_9SAUR/63-250     AC A0A6J1W0S0.1
#=GS A0A1D5PV06_CHICK/166-350    AC A0A1D5PV06.2
#=GS A0A167VPJ0_9PEZI/182-324    AC A0A167VPJ0.1
#=GS A0A6Q2XSR2_ESOLU/154-349    AC A0A6Q2XSR2.1
#=GS W3XQH5_PESFW/151-332        AC W3XQH5.1
#=GS A0A2U1KR00_ARTAN/168-355    AC A0A2U1KR00.1
#=GS A0A6J1QKD7_9HYME/1555-1718  AC A0A6J1QKD7.1
#=GS A0A2K6DE20_MACNE/539-728    AC A0A2K6DE20.1
#=GS G3Q2E1_GASAC/159-343        AC G3Q2E1.1
#=GS A0A3B6PMX5_WHEAT/125-299    AC A0A3B6PMX5.1
#=GS A0A090LUW7_STRRB/141-320    AC A0A090LUW7.1
#=GS A0A1S8VK04_9FUNG/343-535    AC A0A1S8VK04.1
#=GS B7P3N0_IXOSC/298-491        AC B7P3N0.1
#=GS A5E6G6_LODEL/172-362        AC A5E6G6.1
#=GS Q54BW3_DICDI/206-361        AC Q54BW3.1
#=GS A0A3P9C1W8_9CICH/159-353    AC A0A3P9C1W8.1
#=GS A0A409Y635_9AGAR/154-338    AC A0A409Y635.1
#=GS A0A6A3T2P2_9STRA/166-343    AC A0A6A3T2P2.1
#=GS A0A672MRR4_SINGR/178-365    AC A0A672MRR4.1
#=GS A0A1W4X5C7_AGRPL/149-346    AC A0A1W4X5C7.1
#=GS A0A0J9Y1E9_BRUMA/377-546    AC A0A0J9Y1E9.1
#=GS A0A672MCD1_SINGR/158-342    AC A0A672MCD1.1
#=GS A0A6P6U8K1_COFAR/248-426    AC A0A6P6U8K1.1
#=GS A0A2J6SLS1_9HELO/154-333    AC A0A2J6SLS1.1
#=GS A0A672TV09_STRHB/167-350    AC A0A672TV09.1
#=GS A0A022Q4B3_ERYGU/189-364    AC A0A022Q4B3.1
#=GS A0A671XXE5_SPAAU/149-344    AC A0A671XXE5.1
#=GS A0A1U7Q3D8_MESAU/191-371    AC A0A1U7Q3D8.2
#=GS A0A0K0E899_STRER/163-347    AC A0A0K0E899.1
#=GS S7W9Z2_SPRLO/288-444        AC S7W9Z2.1
#=GS A0A0F7U2I0_PENBI/163-344    AC A0A0F7U2I0.1
#=GS M7BK18_CHEMY/234-369        AC M7BK18.1
#=GS A0A6J2WZL9_CHACN/151-346    AC A0A6J2WZL9.1
#=GS A0A152A206_9MYCE/174-353    AC A0A152A206.1
#=GS A0A6J3EJU7_AYTFU/60-246     AC A0A6J3EJU7.1
#=GS A0A6A2WY24_HIBSY/178-354    AC A0A6A2WY24.1
#=GS A0A6P8IJX6_ACTTE/310-502    AC A0A6P8IJX6.1
#=GS A0A2U9AW48_SCOMX/556-754    AC A0A2U9AW48.1
#=GS A0A673IXF8_9TELE/157-354    AC A0A673IXF8.1
#=GS A0A6J2N7Z9_9CHIR/181-366    AC A0A6J2N7Z9.1
#=GS A0A0B0PR82_GOSAR/169-354    AC A0A0B0PR82.1
#=GS R0MLF8_NOSB1/263-449        AC R0MLF8.1
#=GS A0A6J3C7Z9_GALME/148-344    AC A0A6J3C7Z9.1
#=GS Q5EUD9_MAIZE/221-407        AC Q5EUD9.1
#=GS A0A383WK23_TETOB/183-388    AC A0A383WK23.1
#=GS A0A0L0FW28_9EUKA/172-366    AC A0A0L0FW28.1
#=GS A0A5C6NWA5_9TELE/304-496    AC A0A5C6NWA5.1
#=GS A0A094H867_9PEZI/153-334    AC A0A094H867.1
#=GS S8ATE3_DACHA/156-336        AC S8ATE3.1
#=GS A0A0D2CLJ6_9EURO/160-259    AC A0A0D2CLJ6.1
#=GS A0A5C3F9Q1_9BASI/419-603    AC A0A5C3F9Q1.1
#=GS A0A2C6L9U8_9APIC/365-584    AC A0A2C6L9U8.1
#=GS A0A485NK35_LYNPA/313-505    AC A0A485NK35.1
#=GS M4DR15_BRARP/205-390        AC M4DR15.1
#=GS A0A2I4AXH3_9TELE/171-354    AC A0A2I4AXH3.1
#=GS A0A225WBI6_9STRA/182-343    AC A0A225WBI6.1
#=GS A0A671TLY7_SPAAU/159-343    AC A0A671TLY7.1
#=GS A0A0D2TS60_GOSRA/169-352    AC A0A0D2TS60.1
#=GS Q018Z4_OSTTA/191-372        AC Q018Z4.1
#=GS A0A7M7MKD3_APIME/550-709    AC A0A7M7MKD3.1
#=GS A0A493T013_ANAPP/150-331    AC A0A493T013.1
#=GS A0A453P568_AEGTS/25-129     AC A0A453P568.1
#=GS A0A0V1HCA0_9BILA/312-509    AC A0A0V1HCA0.1
#=GS A0A4P1RK68_LUPAN/172-350    AC A0A4P1RK68.1
#=GS C4VB33_NOSCE/284-446        AC C4VB33.1
#=GS A0A2P5WVF5_GOSBA/188-348    AC A0A2P5WVF5.1
#=GS A0A6A6LLS6_HEVBR/172-356    AC A0A6A6LLS6.1
#=GS A0A1U8JFL1_GOSHI/213-421    AC A0A1U8JFL1.1
#=GS C3XU97_BRAFL/157-342        AC C3XU97.1
#=GS A0A2P4SFI5_BAMTH/222-414    AC A0A2P4SFI5.1
#=GS A0A6I9I604_VICPA/178-365    AC A0A6I9I604.1
#=GS A0A4W6FWD0_LATCA/46-234     AC A0A4W6FWD0.1
#=GS A0A4Y7KWP5_PAPSO/241-420    AC A0A4Y7KWP5.1
#=GS A0A668UZT7_OREAU/47-234     AC A0A668UZT7.1
#=GS A0A1R2D0R6_9CILI/156-335    AC A0A1R2D0R6.1
#=GS A0A4W3IXP1_CALMI/434-595    AC A0A4W3IXP1.1
#=GS A0A7N6BAG8_ANATE/114-292    AC A0A7N6BAG8.1
#=GS C5LUR3_PERM5/502-704        AC C5LUR3.1
#=GS A0A446RWI0_TRITD/14-199     AC A0A446RWI0.1
#=GS A0A6A5DG52_SCHHA/58-238     AC A0A6A5DG52.1
#=GS J9IDP7_9SPIT/162-346        AC J9IDP7.1
#=GS G8BU90_TETPH/215-348        AC G8BU90.1
#=GS A0A7H8R268_9EURO/157-338    AC A0A7H8R268.1
#=GS L5LQX6_MYODS/179-366        AC L5LQX6.1
#=GS A0A671Y2U4_SPAAU/135-308    AC A0A671Y2U4.1
#=GS A0A3Q3BLG9_KRYMA/254-434    AC A0A3Q3BLG9.1
#=GS A0A3B6TK41_WHEAT/204-387    AC A0A3B6TK41.1
#=GS H2PSW3_PONAB/167-350        AC H2PSW3.2
#=GS A0A0V1NV69_9BILA/168-357    AC A0A0V1NV69.1
#=GS W5QC35_SHEEP/312-377        AC W5QC35.1
#=GS A0A026W556_OOCBI/140-333    AC A0A026W556.1
#=GS A0A2I0T682_LIMLA/199-385    AC A0A2I0T682.1
#=GS J8ZQ03_EDHAE/169-348        AC J8ZQ03.1
#=GS A0A7N5JEQ5_AILME/226-406    AC A0A7N5JEQ5.1
#=GS A0A139HMU8_9PEZI/159-345    AC A0A139HMU8.1
#=GS A0A1R3FUK5_9ROSI/292-427    AC A0A1R3FUK5.1
#=GS A0A6J2REV7_COTGO/550-749    AC A0A6J2REV7.1
#=GS A0A0V1LQW1_9BILA/172-356    AC A0A0V1LQW1.1
#=GS A0A6P4D0Z6_ARADU/147-351    AC A0A6P4D0Z6.1
#=GS A0A453P561_AEGTS/116-283    AC A0A453P561.1
#=GS A0A2K5WQ55_MACFA/149-332    AC A0A2K5WQ55.2
#=GS A0A668SD78_OREAU/205-391    AC A0A668SD78.1
#=GS G0RJG0_HYPJQ/107-271        AC G0RJG0.1
#=GS A0A091JJ66_EGRGA/107-292    AC A0A091JJ66.1
#=GS A0A453P5A2_AEGTS/132-289    AC A0A453P5A2.1
#=GS A0A4V0ILH1_CAEEL/166-342    AC A0A4V0ILH1.1
#=GS A0A091NI27_APAVI/189-304    AC A0A091NI27.1
#=GS A0A2U1M8F9_ARTAN/68-243     AC A0A2U1M8F9.1
#=GS A0A091ESI3_CORBR/282-473    AC A0A091ESI3.1
#=GS A0A668SWY9_OREAU/149-343    AC A0A668SWY9.1
#=GS A0A5N5HQQ2_9ROSA/179-360    AC A0A5N5HQQ2.1
#=GS A0A6J1IHS9_CUCMA/171-355    AC A0A6J1IHS9.1
#=GS S0DJV0_GIBF5/168-348        AC S0DJV0.1
#=GS A0A3S2PCE2_ORYJA/158-354    AC A0A3S2PCE2.1
#=GS A0A6P8Z637_THRPL/564-720    AC A0A6P8Z637.1
#=GS A0A6G0YEQ6_APHCR/166-352    AC A0A6G0YEQ6.1
#=GS A0A4W3GPA7_CALMI/108-303    AC A0A4W3GPA7.1
#=GS A0A4Z0AAH0_9AGAM/352-512    AC A0A4Z0AAH0.1
#=GS B4MU84_DROWI/123-309        AC B4MU84.2
#=GS A0A1U7QJK8_MESAU/239-426    AC A0A1U7QJK8.1
#=GS A0A3Q4HV56_NEOBR/149-343    AC A0A3Q4HV56.1
#=GS A0A3N4KVK4_9PEZI/158-338    AC A0A3N4KVK4.1
#=GS A0A165N747_9AGAM/157-341    AC A0A165N747.1
#=GS G1LAJ6_AILME/187-304        AC G1LAJ6.2
#=GS A0A091R639_9GRUI/282-474    AC A0A091R639.1
#=GS A0A397YYD8_BRACM/166-350    AC A0A397YYD8.1
#=GS A0A5K1TUM5_MACMU/130-313    AC A0A5K1TUM5.1
#=GS A0A314KM85_NICAT/162-345    AC A0A314KM85.1
#=GS A0A238BTU0_9BILA/160-347    AC A0A238BTU0.1
#=GS A0A7F8RWY8_LEPWE/49-234     AC A0A7F8RWY8.1
#=GS A8WRE6_CAEBR/128-308        AC A8WRE6.2
#=GS A0A2G9TFE7_TELCI/166-344    AC A0A2G9TFE7.1
#=GS A0A453DG03_AEGTS/6-184      AC A0A453DG03.1
#=GS U3EQL0_CALJA/163-347        AC U3EQL0.1
#=GS A0A067G108_CITSI/1-138      AC A0A067G108.1
#=GS A0A6P8Z5K5_THRPL/351-512    AC A0A6P8Z5K5.1
#=GS A0A6D2K7K9_9BRAS/213-394    AC A0A6D2K7K9.1
#=GS A0A1V9XEJ2_9ACAR/350-549    AC A0A1V9XEJ2.1
#=GS A0A672KLG4_SINGR/152-346    AC A0A672KLG4.1
#=GS E2BG03_HARSA/160-344        AC E2BG03.1
#=GS A0A6P5XSJ7_DURZI/235-415    AC A0A6P5XSJ7.1
#=GS A0A287TG45_HORVV/36-144     AC A0A287TG45.1
#=GS A0A6J2XP52_SITOR/523-668    AC A0A6J2XP52.1
#=GS A0A2K5DYK7_AOTNA/64-251     AC A0A2K5DYK7.1
#=GS A0A0U5G111_9EURO/251-315    AC A0A0U5G111.1
#=GS A0A5E4R003_9NEOP/159-344    AC A0A5E4R003.1
#=GS A0A251UQ76_HELAN/186-370    AC A0A251UQ76.1
#=GS A0A6P5DDG9_BOSIN/222-337    AC A0A6P5DDG9.1
#=GS A0A672NW23_SINGR/289-481    AC A0A672NW23.1
#=GS A0A6J3PV54_TURTR/17-197     AC A0A6J3PV54.1
#=GS A0A673VK16_SURSU/180-365    AC A0A673VK16.1
#=GS K1Q7T5_CRAGI/152-342        AC K1Q7T5.1
#=GS A0A091MMC1_9PASS/107-292    AC A0A091MMC1.1
#=GS H2ZN96_CIOSA/163-348        AC H2ZN96.1
#=GS A0A2Y9F3F0_PHYMC/160-355    AC A0A2Y9F3F0.1
#=GS A0A093FUS4_TYTAL/78-273     AC A0A093FUS4.1
#=GS C5L782_PERM5/6-155          AC C5L782.1
#=GS G1KPJ9_ANOCA/308-500        AC G1KPJ9.2
#=GS A0A3Q7RUU5_CALUR/250-433    AC A0A3Q7RUU5.1
#=GS A0A671Q8H8_9TELE/145-324    AC A0A671Q8H8.1
#=GS A0A1R1XI12_9FUNG/559-749    AC A0A1R1XI12.1
#=GS A0A6J3AMA4_VICPA/534-723    AC A0A6J3AMA4.1
#=GS A0A0D2QKI8_GOSRA/238-418    AC A0A0D2QKI8.1
#=GS A0A3Q7TGU6_VULVU/160-355    AC A0A3Q7TGU6.1
#=GS E1BAG3_BOVIN/531-720        AC E1BAG3.2
#=GS A0A7N6BQF9_ANATE/159-336    AC A0A7N6BQF9.1
#=GS G0W5H7_NAUDC/169-341        AC G0W5H7.1
#=GS A0A4W6DWK1_LATCA/163-356    AC A0A4W6DWK1.1
#=GS A0A7N4NQZ7_SARHA/18-175     AC A0A7N4NQZ7.1
#=GS A0A369RSF4_9METZ/308-501    AC A0A369RSF4.1
#=GS A0A2K6BKI9_MACNE/111-296    AC A0A2K6BKI9.1
#=GS A0A6P3WRD0_DINQU/567-726    AC A0A6P3WRD0.1
#=GS A0A060XSC8_ONCMY/303-414    AC A0A060XSC8.1
#=GS A0A662YE85_9STRA/524-690    AC A0A662YE85.1
#=GS A0A444Y916_ARAHY/217-402    AC A0A444Y916.1
#=GS A0A665W7E3_ECHNA/201-363    AC A0A665W7E3.1
#=GS A0A384B8P6_BALAS/160-355    AC A0A384B8P6.1
#=GS A0A6J2W3H9_CHACN/167-350    AC A0A6J2W3H9.1
#=GS A0A673JYI0_9TELE/161-345    AC A0A673JYI0.1
#=GS G4MPX2_MAGO7/157-338        AC G4MPX2.1
#=GS A0A674DSP8_SALTR/159-342    AC A0A674DSP8.1
#=GS A0A166EIS8_9AGAM/157-335    AC A0A166EIS8.1
#=GS A0A0E0CLS9_9ORYZ/191-367    AC A0A0E0CLS9.1
#=GS A0A103YHU0_CYNCS/244-437    AC A0A103YHU0.1
#=GS A0A1Y1VSB5_9FUNG/153-333    AC A0A1Y1VSB5.1
#=GS A0A2G2WP56_CAPBA/205-390    AC A0A2G2WP56.1
#=GS K3ZI40_SETIT/171-356        AC K3ZI40.1
#=GS A0A485P6B6_LYNPA/1-174      AC A0A485P6B6.1
#=GS A0A2T4AL10_TRIHA/154-335    AC A0A2T4AL10.1
#=GS A0A1R2BS96_9CILI/157-333    AC A0A1R2BS96.1
#=GS G3IAN8_CRIGR/283-472        AC G3IAN8.1
#=GS A0A078F495_BRANA/166-350    AC A0A078F495.1
#=GS A0A060XVD8_ONCMY/306-498    AC A0A060XVD8.1
#=GS PDIA1_RAT/163-347           AC P04785.2
#=GS A0A0N8K0H1_SCLFO/247-353    AC A0A0N8K0H1.1
#=GS A0A672PG90_SINGR/158-353    AC A0A672PG90.1
#=GS A0A3P8WHM5_CYNSE/159-342    AC A0A3P8WHM5.1
#=GS A0A6D2HML9_9BRAS/178-363    AC A0A6D2HML9.1
#=GS A0A2Y9NYN0_DELLE/158-338    AC A0A2Y9NYN0.1
#=GS A0A1A6GHQ2_NEOLE/32-145     AC A0A1A6GHQ2.1
#=GS A0A665WCE8_ECHNA/295-486    AC A0A665WCE8.1
#=GS H0YU55_TAEGU/283-474        AC H0YU55.2
#=GS A0A401NWB0_SCYTO/185-317    AC A0A401NWB0.1
#=GS M3YX59_MUSPF/287-393        AC M3YX59.1
#=GS A0A401G9Z2_9APHY/328-509    AC A0A401G9Z2.1
#=GS A0A6A4WSB4_AMPAM/165-346    AC A0A6A4WSB4.1
#=GS A0A2K5DRX8_AOTNA/119-292    AC A0A2K5DRX8.1
#=GS B8AU14_ORYSI/170-333        AC B8AU14.1
#=GS A0A0L7KD01_PLAFX/165-332    AC A0A0L7KD01.1
#=GS A0A665W6Z8_ECHNA/201-342    AC A0A665W6Z8.1
#=GS I7FST9_SOYBN/182-368        AC I7FST9.1
#=GS A0A1V4K2C7_PATFA/213-328    AC A0A1V4K2C7.1
#=GS A0A2N6NH60_BEABA/156-338    AC A0A2N6NH60.1
#=GS A0A2G4SHT6_RHIZD/348-527    AC A0A2G4SHT6.1
#=GS A0A314Z1N1_PRUYE/111-288    AC A0A314Z1N1.1
#=GS T1HGS9_RHOPR/149-336        AC T1HGS9.1
#=GS G1LCE1_AILME/250-433        AC G1LCE1.2
#=GS A0A446WFA3_TRITD/7-129      AC A0A446WFA3.1
#=GS F4WXX7_ACREC/1563-1726      AC F4WXX7.1
#=GS B4IF48_DROSE/171-357        AC B4IF48.1
#=GS A0A0C7MWB9_9SACH/171-352    AC A0A0C7MWB9.1
#=GS A0A672P9V7_SINGR/102-297    AC A0A672P9V7.1
#=GS A0A7P0T9K9_HUMAN/92-276     AC A0A7P0T9K9.1
#=GS A0A3B0JQP5_DROGU/143-326    AC A0A3B0JQP5.1
#=GS A0A183K161_9TREM/157-340    AC A0A183K161.1
#=GS A0A165IK65_9APHY/328-501    AC A0A165IK65.1
#=GS K6UCM6_PLACD/106-273        AC K6UCM6.1
#=GS A0A1X2GCX5_9FUNG/262-421    AC A0A1X2GCX5.1
#=GS T0LLI4_COLGC/145-317        AC T0LLI4.1
#=GS V5HWC0_BYSSN/3-169          AC V5HWC0.1
#=GS A0A2Y9QVA9_TRIMA/119-302    AC A0A2Y9QVA9.1
#=GS A0A4W5PDC8_9TELE/47-235     AC A0A4W5PDC8.1
#=GS A0A6P3WBG5_CLUHA/52-239     AC A0A6P3WBG5.1
#=GS F5GYS6_HUMAN/9-150          AC F5GYS6.1
#=GS A0A341CL13_NEOAA/183-370    AC A0A341CL13.1
#=GS A0A2G5DVJ2_AQUCA/171-355    AC A0A2G5DVJ2.1
#=GS W5MDQ3_LEPOC/167-350        AC W5MDQ3.1
#=GS J3MBJ8_ORYBR/201-385        AC J3MBJ8.1
#=GS A0A6A4V237_AMPAM/151-337    AC A0A6A4V237.1
#=GS A0A6J2UW79_CHACN/159-339    AC A0A6J2UW79.1
#=GS F1N602_BOVIN/324-511        AC F1N602.3
#=GS A0A6I9XSG4_9SAUR/29-168     AC A0A6I9XSG4.1
#=GS A0A671EH07_RHIFE/308-500    AC A0A671EH07.1
#=GS F9F193_FUSOF/155-336        AC F9F193.1
#=GS A0A091G6F7_9AVES/124-304    AC A0A091G6F7.1
#=GS A0A1J5WIQ2_9MICR/162-329    AC A0A1J5WIQ2.1
#=GS A0A1S3TX80_VIGRR/214-395    AC A0A1S3TX80.1
#=GS F4HZN9_ARATH/168-353        AC F4HZN9.1
#=GS O44508_CAEEL/190-366        AC O44508.3
#=GS PDI11_ORYSJ/178-363         AC Q53LQ0.1
#=GS A0A5B6UC24_9ROSI/179-377    AC A0A5B6UC24.1
#=GS A0A6P7KDU0_9TELE/149-344    AC A0A6P7KDU0.1
#=GS B4L127_DROMO/157-341        AC B4L127.1
#=GS A0A0V1DFB5_TRIBR/156-340    AC A0A0V1DFB5.1
#=GS A0A673VJN2_SURSU/160-355    AC A0A673VJN2.1
#=GS A0A6P5DEC4_BOSIN/163-347    AC A0A6P5DEC4.1
#=GS F6Y8X8_MACMU/178-365        AC F6Y8X8.3
#=GS A0A1S4FE21_AEDAE/155-352    AC A0A1S4FE21.1
#=GS A0A6P3RAZ0_PTEVA/64-251     AC A0A6P3RAZ0.1
#=GS A0A5E4BMA6_MARMO/160-355    AC A0A5E4BMA6.1
#=GS A0A3S1B8L4_ELYCH/592-768    AC A0A3S1B8L4.1
#=GS A0A2U3W7G4_ODORO/311-428    AC A0A2U3W7G4.1
#=GS NXN_BOVIN/309-424           AC A6QLU8.1
#=GS A0A665UWS1_ECHNA/162-346    AC A0A665UWS1.1
#=GS K7VRQ5_MAIZE/199-384        AC K7VRQ5.1
#=GS A0A6J2SYD5_DROLE/396-522    AC A0A6J2SYD5.1
#=GS A0A397J2S2_9GLOM/306-494    AC A0A397J2S2.1
#=GS A0A5N3XQ97_MUNRE/324-516    AC A0A5N3XQ97.1
#=GS A0A4U5R218_POPAL/222-413    AC A0A4U5R218.1
#=GS A0A3Q1BEB1_AMPOC/127-322    AC A0A3Q1BEB1.1
#=GS A0A151ZI30_9MYCE/274-383    AC A0A151ZI30.1
#=GS A0A7I4B7D4_PHYPA/163-352    AC A0A7I4B7D4.1
#=GS A0A0N4VBV2_ENTVE/158-342    AC A0A0N4VBV2.1
#=GS R7VC32_CAPTE/155-281        AC R7VC32.1
#=GS A0A3G2S1I0_9BASI/308-507    AC A0A3G2S1I0.1
#=GS A0A671Y1J8_SPAAU/153-348    AC A0A671Y1J8.1
#=GS A0A6I9RQJ1_ELAGV/178-359    AC A0A6I9RQJ1.1
#=GS A0A3P9NGK7_POERE/71-263     AC A0A3P9NGK7.1
#=GS A0A6J2TVJ8_DROLE/166-352    AC A0A6J2TVJ8.1
#=GS A0A016X246_9BILA/152-340    AC A0A016X246.1
#=GS A9PH73_POPTR/212-414        AC A9PH73.1
#=GS G1QV50_NOMLE/9-150          AC G1QV50.2
#=GS A0A673KZZ7_9TELE/135-300    AC A0A673KZZ7.1
#=GS A0A2G4T7M9_RHIZD/156-337    AC A0A2G4T7M9.1
#=GS A0A2H5PS51_CITUN/2-177      AC A0A2H5PS51.1
#=GS C7Z744_FUSV7/456-563        AC C7Z744.1
#=GS A0A423U5I3_PENVA/192-376    AC A0A423U5I3.1
#=GS A0A060YT94_ONCMY/47-235     AC A0A060YT94.1
#=GS A0A4S2L712_9HYME/170-356    AC A0A4S2L712.1
#=GS A0A5N5X6H9_9EURO/161-342    AC A0A5N5X6H9.1
#=GS A0A1M2W184_TRAPU/324-493    AC A0A1M2W184.1
#=GS A0A0F4ZAL0_9PEZI/155-335    AC A0A0F4ZAL0.1
#=GS A0A226N965_CALSU/554-662    AC A0A226N965.1
#=GS T1JE30_STRMM/156-344        AC T1JE30.1
#=GS A0A6P7JZN8_9TELE/168-351    AC A0A6P7JZN8.1
#=GS A0A6P8Z5J4_THRPL/552-708    AC A0A6P8Z5J4.1
#=GS A0A2S4UEP1_9BASI/177-347    AC A0A2S4UEP1.1
#=GS A0A2K5M4X0_CERAT/64-251     AC A0A2K5M4X0.1
#=GS A0A2G8KWZ0_STIJA/152-340    AC A0A2G8KWZ0.1
#=GS A0A0D2WQQ9_CAPO3/244-427    AC A0A0D2WQQ9.1
#=GS A0A6J2SWH6_DROLE/531-687    AC A0A6J2SWH6.1
#=GS PDI2_CAEEL/157-341          AC Q17770.1
#=GS A0A7I4KQT9_BRUMA/169-351    AC A0A7I4KQT9.1
#=GS A0A3Q7P684_CALUR/533-722    AC A0A3Q7P684.1
#=GS A0A6J2JK22_BOMMA/157-343    AC A0A6J2JK22.1
#=GS A0A6I9XEJ6_9SAUR/298-488    AC A0A6I9XEJ6.1
#=GS A0A0P7YVR2_SCLFO/167-353    AC A0A0P7YVR2.1
#=GS A0A0V1AGS0_9BILA/105-270    AC A0A0V1AGS0.1
#=GS A0A195CIJ3_9HYME/656-832    AC A0A195CIJ3.1
#=GS A0A1R3IWV7_COCAP/926-1103   AC A0A1R3IWV7.1
#=GS S8CL51_9LAMI/151-271        AC S8CL51.1
#=GS A0A6P3H851_BISBI/180-365    AC A0A6P3H851.1
#=GS A0A0S3SNG4_PHAAN/168-348    AC A0A0S3SNG4.1
#=GS A0A3B0JY74_DROGU/163-360    AC A0A3B0JY74.1
#=GS M5GBZ6_DACPD/299-487        AC M5GBZ6.1
#=GS C5LFW6_PERM5/115-283        AC C5LFW6.1
#=GS A0A2K3NQ25_TRIPR/215-395    AC A0A2K3NQ25.1
#=GS A0A2B7XRG4_9EURO/161-341    AC A0A2B7XRG4.1
#=GS A0A671Q3L1_9TELE/162-346    AC A0A671Q3L1.1
#=GS A0A238BTN5_9BILA/378-558    AC A0A238BTN5.1
#=GS A0A0V0VIL4_9BILA/197-372    AC A0A0V0VIL4.1
#=GS A0A0A0AKX6_CHAVO/107-292    AC A0A0A0AKX6.1
#=GS A0A4Y7JRU4_PAPSO/182-358    AC A0A4Y7JRU4.1
#=GS A0A3Q1HPF2_ANATE/156-323    AC A0A3Q1HPF2.2
#=GS A0A024W7Y1_PLAFA/165-332    AC A0A024W7Y1.1
#=GS G5BVK0_HETGA/188-375        AC G5BVK0.1
#=GS A0A4W6DAU8_LATCA/159-342    AC A0A4W6DAU8.1
#=GS A0A6S7N7A0_LACSI/171-367    AC A0A6S7N7A0.1
#=GS A0A668USR6_OREAU/154-335    AC A0A668USR6.1
#=GS A0A0V1A336_9BILA/156-340    AC A0A0V1A336.1
#=GS A0A4W5P7N4_9TELE/164-347    AC A0A4W5P7N4.1
#=GS G3QXJ3_GORGO/142-325        AC G3QXJ3.2
#=GS A0A672NBF7_SINGR/158-352    AC A0A672NBF7.1
#=GS A0A6A5DCG6_SCHHA/316-510    AC A0A6A5DCG6.1
#=GS A0A672QXK0_SINGR/159-345    AC A0A672QXK0.1
#=GS A0A3P9CVI9_9CICH/153-333    AC A0A3P9CVI9.1
#=GS A0A162NJ46_PHYB8/162-351    AC A0A162NJ46.1
#=GS A0A097IYF9_ANISI/158-341    AC A0A097IYF9.1
#=GS A0A0Q3MB78_AMAAE/314-506    AC A0A0Q3MB78.1
#=GS C5Z4V3_SORBI/202-387        AC C5Z4V3.2
#=GS M7SC23_EUTLA/157-338        AC M7SC23.1
#=GS A0A2K5WU17_MACFA/59-175     AC A0A2K5WU17.1
#=GS A0A674CZX7_SALTR/161-355    AC A0A674CZX7.1
#=GS A0A3B1KBA9_ASTMX/170-354    AC A0A3B1KBA9.1
#=GS A0A2G9QEJ0_LITCT/8-202      AC A0A2G9QEJ0.1
#=GS A0A0N4TB41_BRUPA/13-137     AC A0A0N4TB41.1
#=GS A0A485MX29_LYNPA/246-429    AC A0A485MX29.1
#=GS PDI2_DICDI/174-355          AC Q54EN4.1
#=GS A0A4P1QZ04_LUPAN/167-352    AC A0A4P1QZ04.1
#=GS A0A091VGG9_PHORB/107-292    AC A0A091VGG9.1
#=GS A0A553HZ17_9PEZI/244-425    AC A0A553HZ17.1
#=GS A0A384CCV6_URSMA/146-330    AC A0A384CCV6.1
#=GS A0A673A5V0_9TELE/135-321    AC A0A673A5V0.1
#=GS A0A1X7R3S8_9SACH/168-335    AC A0A1X7R3S8.1
#=GS I2FPD3_USTH4/444-616        AC I2FPD3.1
#=GS A0A1Y3MU45_PIRSE/144-317    AC A0A1Y3MU45.1
#=GS A0A2P5WAL5_GOSBA/213-397    AC A0A2P5WAL5.1
#=GS A0A0L0G530_9EUKA/159-340    AC A0A0L0G530.1
#=GS A0A3N0XRQ4_ANAGA/43-201     AC A0A3N0XRQ4.1
#=GS A0A420I4B4_9PEZI/86-267     AC A0A420I4B4.1
#=GS A0A0D3FW33_9ORYZ/170-365    AC A0A0D3FW33.1
#=GS A0A084WIX0_ANOSI/161-345    AC A0A084WIX0.1
#=GS A0A1U7ZFL2_NELNU/174-353    AC A0A1U7ZFL2.1
#=GS A0A1U8ARJ5_NELNU/173-358    AC A0A1U8ARJ5.1
#=GS A0A672TU81_STRHB/382-571    AC A0A672TU81.1
#=GS A0A0L0FPR1_9EUKA/45-229     AC A0A0L0FPR1.1
#=GS V9L5L2_CALMI/82-269         AC V9L5L2.1
#=GS A0A5E4ED32_PRUDU/168-353    AC A0A5E4ED32.1
#=GS B0X3M7_CULQU/160-344        AC B0X3M7.1
#=GS A0A540MPD0_MALBA/227-407    AC A0A540MPD0.1
#=GS A0A068URI5_COFCA/175-360    AC A0A068URI5.1
#=GS A0A0L7LVW6_PLAF4/165-332    AC A0A0L7LVW6.1
#=GS A0A3Q4HHT3_NEOBR/129-313    AC A0A3Q4HHT3.1
#=GS W9WT27_9EURO/148-328        AC W9WT27.1
#=GS I1LD87_SOYBN/170-349        AC I1LD87.1
#=GS PDI14_ARATH/241-420         AC Q9FF55.1
#=GS A0A1Y1V0A8_9FUNG/152-333    AC A0A1Y1V0A8.1
#=GS G3UP12_MELGA/28-212         AC G3UP12.1
#=GS A0A2Y9KUM9_ENHLU/160-355    AC A0A2Y9KUM9.1
#=GS A0A672P9T9_SINGR/107-302    AC A0A672P9T9.1
#=GS A0A453C0T2_AEGTS/173-357    AC A0A453C0T2.1
#=GS V4LMG0_EUTSA/228-408        AC V4LMG0.1
#=GS R7S510_PUNST/297-496        AC R7S510.1
#=GS A0A672N6U1_SINGR/145-339    AC A0A672N6U1.1
#=GS W5JMI0_ANODA/164-350        AC W5JMI0.1
#=GS A0A453QTT2_AEGTS/204-387    AC A0A453QTT2.1
#=GS A0A6J3KUL0_9HYME/155-349    AC A0A6J3KUL0.1
#=GS A0A6A1QBI3_BALPH/175-360    AC A0A6A1QBI3.1
#=GS A0A5J9TLY1_9POAL/201-387    AC A0A5J9TLY1.1
#=GS A0A6P6HBL5_PUMCO/180-365    AC A0A6P6HBL5.1
#=GS A0A0Q3Q8T8_AMAAE/13-208     AC A0A0Q3Q8T8.1
#=GS L0PFM8_PNEJ8/20-196         AC L0PFM8.1
#=GS H2NV27_PONAB/161-345        AC H2NV27.1
#=GS A0A3N6R1K7_BRACR/197-382    AC A0A3N6R1K7.1
#=GS A0A6J1X7G6_GALME/159-344    AC A0A6J1X7G6.1
#=GS A0A6P6MPZ2_CARAU/529-721    AC A0A6P6MPZ2.1
#=GS A0A081CEH0_PSEA2/170-341    AC A0A081CEH0.1
#=GS A0A6J3F5Y9_SAPAP/312-504    AC A0A6J3F5Y9.1
#=GS A0A5D2UU31_GOSMU/213-397    AC A0A5D2UU31.1
#=GS A0A397XTD5_BRACM/240-418    AC A0A397XTD5.1
#=GS F7EEV3_XENTR/178-362        AC F7EEV3.3
#=GS A0A452FD52_CAPHI/312-503    AC A0A452FD52.1
#=GS A0A498MDR7_LABRO/150-345    AC A0A498MDR7.1
#=GS A0A5N4CD92_CAMDR/90-262     AC A0A5N4CD92.1
#=GS A0A158NZ91_ATTCE/571-727    AC A0A158NZ91.1
#=GS A0A673JUN7_9TELE/169-352    AC A0A673JUN7.1
#=GS A0A369H014_9HYPO/156-337    AC A0A369H014.1
#=GS A0A7N6BDP2_ANATE/149-330    AC A0A7N6BDP2.1
#=GS D7LUZ4_ARALL/234-414        AC D7LUZ4.1
#=GS A0A507R286_MONPU/161-342    AC A0A507R286.1
#=GS A0A665W7E2_ECHNA/201-389    AC A0A665W7E2.1
#=GS A0A226MTY9_CALSU/134-243    AC A0A226MTY9.1
#=GS A0A3P7EHH1_WUCBA/28-194     AC A0A3P7EHH1.1
#=GS E3LVG0_CAERE/181-370        AC E3LVG0.1
#=GS A0A2R9A116_PANPA/158-338    AC A0A2R9A116.1
#=GS A0A663MTQ2_ATHCN/1-130      AC A0A663MTQ2.1
#=GS A0A670IGA4_PODMU/315-507    AC A0A670IGA4.1
#=GS B8LT84_TALSN/157-338        AC B8LT84.1
#=GS A0A0E0K0Y6_ORYPU/193-368    AC A0A0E0K0Y6.1
#=GS A0A2K6MD51_RHIBE/303-495    AC A0A2K6MD51.1
#=GS M7B1H5_CHEMY/217-313        AC M7B1H5.1
#=GS A0A6A6KR07_HEVBR/208-393    AC A0A6A6KR07.1
#=GS A0A2K5JLM3_COLAP/69-252     AC A0A2K5JLM3.1
#=GS A0A6P3X3C0_DINQU/170-364    AC A0A6P3X3C0.1
#=GS A0A3Q1AKI3_AMPOC/33-227     AC A0A3Q1AKI3.1
#=GS A0A7H9HN12_9SACH/166-341    AC A0A7H9HN12.1
#=GS A0A1B9I6G7_9TREE/307-482    AC A0A1B9I6G7.1
#=GS A0A2U9BMT2_SCOMX/170-354    AC A0A2U9BMT2.1
#=GS A0A446UZN4_TRITD/120-299    AC A0A446UZN4.1
#=GS A0A5E4B6T7_MARMO/238-418    AC A0A5E4B6T7.1
#=GS NXN_MOUSE/233-424           AC P97346.1
#=GS A0A5N5QWL2_9AGAM/152-336    AC A0A5N5QWL2.1
#=GS A0A6P4I702_DROKI/203-360    AC A0A6P4I702.1
#=GS A0A674E9R3_SALTR/2-170      AC A0A674E9R3.1
#=GS A0A044UZW8_ONCVO/198-347    AC A0A044UZW8.1
#=GS A0A315WA60_GAMAF/19-240     AC A0A315WA60.1
#=GS A0A553RGR3_9TELE/1516-1710  AC A0A553RGR3.1
#=GS H3ACS8_LATCH/182-369        AC H3ACS8.1
#=GS A0A1S3Z2K1_TOBAC/206-391    AC A0A1S3Z2K1.1
#=GS A0A091DXE2_FUKDA/163-347    AC A0A091DXE2.1
#=GS A0A453HK30_AEGTS/1-83       AC A0A453HK30.1
#=GS A0A673K1Y3_9TELE/166-350    AC A0A673K1Y3.1
#=GS G3HRG8_CRIGR/19-202         AC G3HRG8.1
#=GS H0ZET4_TAEGU/167-350        AC H0ZET4.2
#=GS A0A3L6Q7P0_PANMI/452-638    AC A0A3L6Q7P0.1
#=GS A0A0F0I8J1_ASPPU/161-342    AC A0A0F0I8J1.1
#=GS A0A0V0RKQ3_9BILA/276-473    AC A0A0V0RKQ3.1
#=GS A0A5B8MXU2_9CHLO/304-462    AC A0A5B8MXU2.1
#=GS A0A6J0P4Y7_RAPSA/233-413    AC A0A6J0P4Y7.1
#=GS A0A067NQ13_PLEOS/161-308    AC A0A067NQ13.1
#=GS L9KW96_TUPCH/56-174         AC L9KW96.1
#=GS A0A672FLB9_SALFA/105-274    AC A0A672FLB9.1
#=GS A0A314KKN6_NICAT/112-295    AC A0A314KKN6.1
#=GS A0A2Y9PCH8_DELLE/160-355    AC A0A2Y9PCH8.1
#=GS A0A5N4C5T5_CAMDR/64-251     AC A0A5N4C5T5.1
#=GS A0A672YRF3_9TELE/107-290    AC A0A672YRF3.1
#=GS A0A3N2PZ17_9PEZI/155-336    AC A0A3N2PZ17.1
#=GS A0A5F5Q0B7_HORSE/121-303    AC A0A5F5Q0B7.1
#=GS A0A670HPN0_PODMU/438-626    AC A0A670HPN0.1
#=GS A0A3Q3LT38_9TELE/549-748    AC A0A3Q3LT38.1
#=GS A0A2K6LRP4_RHIBE/163-347    AC A0A2K6LRP4.1
#=GS A0A4W4GGC3_ELEEL/167-361    AC A0A4W4GGC3.1
#=GS A0A1E4SZG8_9ASCO/169-352    AC A0A1E4SZG8.1
#=GS A0A3L8RZP7_CHLGU/167-351    AC A0A3L8RZP7.1
#=GS A0A383WIW6_TETOB/183-388    AC A0A383WIW6.1
#=GS A0A0C3S1D9_PHLGI/153-338    AC A0A0C3S1D9.1
#=GS A0A2T4C9L9_TRILO/154-335    AC A0A2T4C9L9.1
#=GS R0G966_9BRAS/261-439        AC R0G966.1
#=GS A0A1D3JLG9_PLAMA/165-332    AC A0A1D3JLG9.1
#=GS A0A3Q4HV32_NEOBR/159-353    AC A0A3Q4HV32.1
#=GS A0A0L8FZA7_OCTBM/157-347    AC A0A0L8FZA7.1
#=GS A0A061GYL7_THECC/234-414    AC A0A061GYL7.1
#=GS A0A135UIZ1_9PEZI/41-170     AC A0A135UIZ1.1
#=GS A0A642UTR5_DIURU/171-363    AC A0A642UTR5.1
#=GS A2QFJ8_ASPNC/157-338        AC A2QFJ8.1
#=GS A0A017SC87_9EURO/161-342    AC A0A017SC87.1
#=GS A0A673LSI7_9TELE/167-350    AC A0A673LSI7.1
#=GS B8A5U6_DANRE/152-333        AC B8A5U6.1
#=GS A0A2K5XV03_MANLE/34-221     AC A0A2K5XV03.1
#=GS A0A4U6TUH8_SETVI/179-357    AC A0A4U6TUH8.1
#=GS A0A182E918_ONCOC/16-137     AC A0A182E918.1
#=GS U3JMR1_FICAL/537-726        AC U3JMR1.1
#=GS A0A6P3EUZ8_OCTDE/64-251     AC A0A6P3EUZ8.1
#=GS F7B821_HORSE/163-347        AC F7B821.2
#=GS A0A1B8ELQ1_9PEZI/153-334    AC A0A1B8ELQ1.1
#=GS A0A6J1P0V3_BICAN/293-450    AC A0A6J1P0V3.1
#=GS A0A2Y9NKF4_DELLE/63-250     AC A0A2Y9NKF4.1
#=GS A0A5J4NG44_9TREM/160-344    AC A0A5J4NG44.1
#=GS A0A2A9MHL9_9APIC/376-597    AC A0A2A9MHL9.1
#=GS K7F5X5_PELSI/183-363        AC K7F5X5.1
#=GS A0A0L0FR62_9EUKA/191-377    AC A0A0L0FR62.1
#=GS A0A803J9I6_XENTR/218-404    AC A0A803J9I6.1
#=GS A0A1S7HLX0_9SACH/165-336    AC A0A1S7HLX0.1
#=GS A0A0B1PGM9_9BILA/765-949    AC A0A0B1PGM9.1
#=GS A0A401SX58_CHIPU/206-401    AC A0A401SX58.1
#=GS A0A7P0T9D6_HUMAN/161-345    AC A0A7P0T9D6.1
#=GS A0A6P8WWA6_DROAB/536-693    AC A0A6P8WWA6.1
#=GS A0A287AQH8_PIG/118-301      AC A0A287AQH8.1
#=GS A0A068U7T3_COFCA/235-415    AC A0A068U7T3.1
#=GS W7JAR8_PLAFA/103-225        AC W7JAR8.1
#=GS A0A165GME8_XYLHT/148-329    AC A0A165GME8.1
#=GS L8IQN1_9CETA/160-355        AC L8IQN1.1
#=GS A0A3N4M5H6_9PEZI/169-350    AC A0A3N4M5H6.1
#=GS A0A4U5TXV9_COLLU/594-791    AC A0A4U5TXV9.1
#=GS A0A5E4QFH3_9NEOP/710-886    AC A0A5E4QFH3.1
#=GS A0A3P9C1F3_9CICH/159-343    AC A0A3P9C1F3.1
#=GS H0X907_OTOGA/148-324        AC H0X907.1
#=GS A0A5J5B9K7_9ASTE/173-358    AC A0A5J5B9K7.1
#=GS F6SNH9_MONDO/314-506        AC F6SNH9.2
#=GS A0A420RK88_FUSOX/457-569    AC A0A420RK88.1
#=GS A0A4C1SAW5_EUMVA/195-381    AC A0A4C1SAW5.1
#=GS A0A078IUU7_BRANA/240-418    AC A0A078IUU7.1
#=GS A0A674DSZ0_SALTR/159-342    AC A0A674DSZ0.1
#=GS A0A091K282_COLST/107-292    AC A0A091K282.1
#=GS A0A671TKE7_SPAAU/159-343    AC A0A671TKE7.1
#=GS Q7Z0N8_PARTE/154-338        AC Q7Z0N8.1
#=GS F6UYM0_CALJA/533-722        AC F6UYM0.3
#=GS A0A016S7W8_9BILA/361-540    AC A0A016S7W8.1
#=GS A0A1U8PH00_GOSHI/228-411    AC A0A1U8PH00.1
#=GS A0A673ZTS1_SALTR/173-356    AC A0A673ZTS1.1
#=GS G7PJY2_MACFA/64-251         AC G7PJY2.2
#=GS A0A1E3PT39_9ASCO/167-348    AC A0A1E3PT39.1
#=GS A0A553HPH2_9PEZI/89-262     AC A0A553HPH2.1
#=GS A0A5N5DEB4_9PEZI/153-334    AC A0A5N5DEB4.1
#=GS A0A0D8XI57_DICVI/269-341    AC A0A0D8XI57.1
#=GS A0A6P5M325_PHACI/275-435    AC A0A6P5M325.1
#=GS A0A067GD47_CITSI/233-413    AC A0A067GD47.1
#=GS A0A3M0J2R9_HIRRU/165-349    AC A0A3M0J2R9.1
#=GS A0A165QYD1_EXIGL/158-338    AC A0A165QYD1.1
#=GS A0A6J2XB10_SITOR/157-344    AC A0A6J2XB10.1
#=GS O48949_CHLRE/184-371        AC O48949.1
#=GS A0A3B6RA46_WHEAT/150-333    AC A0A3B6RA46.1
#=GS G0RMH6_HYPJQ/154-335        AC G0RMH6.1
#=GS A0A3Q2GLE2_CYPVA/170-354    AC A0A3Q2GLE2.1
#=GS J0WTS1_AURST/385-552        AC J0WTS1.1
#=GS A0A0V0RNI7_9BILA/153-341    AC A0A0V0RNI7.1
#=GS A0A7C8MJ23_9PEZI/157-338    AC A0A7C8MJ23.1
#=GS A0A2H5NHM0_CITUN/220-394    AC A0A2H5NHM0.1
#=GS A0A671KZ30_9TELE/147-331    AC A0A671KZ30.1
#=GS A0A0N4XEN4_NIPBR/300-474    AC A0A0N4XEN4.1
#=GS A0A2K5EQ24_AOTNA/168-348    AC A0A2K5EQ24.1
#=GS A0A6I9NEA3_9TELE/1-183      AC A0A6I9NEA3.1
#=GS A0A1D6GXN1_MAIZE/228-321    AC A0A1D6GXN1.1
#=GS A0A1Y2A7H2_9FUNG/152-333    AC A0A1Y2A7H2.1
#=GS A0A0V1PG91_9BILA/169-353    AC A0A0V1PG91.1
#=GS A0A2G8LM02_STIJA/233-306    AC A0A2G8LM02.1
#=GS A0A1B8B3P6_FUSPO/155-336    AC A0A1B8B3P6.1
#=GS A0A673HVT6_9TELE/158-352    AC A0A673HVT6.1
#=GS F4WQS3_ACREC/157-343        AC F4WQS3.1
#=GS A0A094N6R9_PODCR/267-458    AC A0A094N6R9.1
#=GS A0A226EGJ7_FOLCA/279-444    AC A0A226EGJ7.1
#=GS A0A6G0TCD4_APHGL/166-352    AC A0A6G0TCD4.1
#=GS A0A3N6SPU3_BRACR/212-397    AC A0A3N6SPU3.1
#=GS A0A6P8ZBN1_THRPL/155-343    AC A0A6P8ZBN1.1
#=GS A0A2P5F9X9_TREOI/178-363    AC A0A2P5F9X9.1
#=GS A0A1S3GI60_DIPOR/127-311    AC A0A1S3GI60.1
#=GS A0A6P8QE33_GEOSA/163-346    AC A0A6P8QE33.1
#=GS A0A6J2A550_ACIJB/89-269     AC A0A6J2A550.1
#=GS W9WZD4_9EURO/188-299        AC W9WZD4.1
#=GS A0A4S2JNI4_9HYME/162-346    AC A0A4S2JNI4.1
#=GS E3Q5T5_COLGM/152-333        AC E3Q5T5.1
#=GS A0A2U9BQ30_SCOMX/46-234     AC A0A2U9BQ30.1
#=GS A0A401NWC4_SCYTO/183-271    AC A0A401NWC4.1
#=GS A0A5D3C662_CUCME/173-355    AC A0A5D3C662.1
#=GS A0A5J5BHM9_9ASTE/215-400    AC A0A5J5BHM9.1
#=GS A0A6J0BTL7_NEOLC/547-688    AC A0A6J0BTL7.1
#=GS A0A6J1WTG8_GALME/711-887    AC A0A6J1WTG8.1
#=GS I1LL59_SOYBN/241-421        AC I1LL59.1
#=GS A0A0M4ESG6_DROBS/168-354    AC A0A0M4ESG6.1
#=GS A0A6P3HUE6_BISBI/373-564    AC A0A6P3HUE6.1
#=GS A0A067TKD6_GALM3/153-338    AC A0A067TKD6.1
#=GS A0A6G1PCD0_9TELE/233-436    AC A0A6G1PCD0.1
#=GS A0A2I0MX61_COLLI/166-347    AC A0A2I0MX61.1
#=GS A0A669PR83_PHACC/1-132      AC A0A669PR83.1
#=GS A0A151RT30_CAJCA/163-348    AC A0A151RT30.1
#=GS A0A674I357_TERCA/155-350    AC A0A674I357.1
#=GS A0A2H3GYU6_FUSOX/150-330    AC A0A2H3GYU6.1
#=GS A0A672L625_SINGR/53-240     AC A0A672L625.1
#=GS A0A6J2YPV7_SITOR/160-345    AC A0A6J2YPV7.1
#=GS A0A671RB85_9TELE/136-317    AC A0A671RB85.1
#=GS A0A3Q3N0Z3_9TELE/124-304    AC A0A3Q3N0Z3.1
#=GS A0A6J1PCN4_9HYME/170-356    AC A0A6J1PCN4.1
#=GS A0A078JNM0_BRANA/11-139     AC A0A078JNM0.1
#=GS H0VIR0_CAVPO/183-369        AC H0VIR0.1
#=GS W5KFZ1_ASTMX/190-376        AC W5KFZ1.2
#=GS A0A672S0P2_SINGR/158-353    AC A0A672S0P2.1
#=GS A0A0V1N1I1_9BILA/279-476    AC A0A0V1N1I1.1
#=GS A0A6J0Y3G9_ODOVR/183-369    AC A0A6J0Y3G9.1
#=GS A0A2K1JRG4_PHYPA/162-343    AC A0A2K1JRG4.1
#=GS A0A553Q8V9_9TELE/152-346    AC A0A553Q8V9.1
#=GS A0A6P8F5R4_CLUHA/180-364    AC A0A6P8F5R4.1
#=GS A0A674MND1_TAKRU/164-348    AC A0A674MND1.1
#=GS A0A3R7MFR1_PENVA/149-347    AC A0A3R7MFR1.1
#=GS A0A2U9BP42_SCOMX/170-356    AC A0A2U9BP42.1
#=GS A0A0E0MDH9_ORYPU/220-371    AC A0A0E0MDH9.1
#=GS B3S7N1_TRIAD/601-788        AC B3S7N1.1
#=GS A0A3Q1JLA1_ANATE/147-342    AC A0A3Q1JLA1.2
#=GS A0A194QPL7_PAPMA/342-425    AC A0A194QPL7.1
#=GS A0A6I8Q0F1_XENTR/155-351    AC A0A6I8Q0F1.1
#=GS A0A2R6Q190_ACTCC/180-361    AC A0A2R6Q190.1
#=GS A0A3N2PKQ6_9PEZI/174-290    AC A0A3N2PKQ6.1
#=GS A0A553Q2I1_9TELE/150-297    AC A0A553Q2I1.1
#=GS PDI52_ORYSJ/191-363         AC Q0JD42.2
#=GS A0A3P4RY56_GULGU/188-305    AC A0A3P4RY56.1
#=GS A0A015KEW5_RHIIW/162-342    AC A0A015KEW5.1
#=GS E1Z8V1_CHLVA/158-341        AC E1Z8V1.1
#=GS A0A674J4N6_TERCA/167-350    AC A0A674J4N6.1
#=GS E4WSU3_OIKDI/227-422        AC E4WSU3.1
#=GS A0A3Q1CGM4_AMPOC/199-385    AC A0A3Q1CGM4.1
#=GS A0DAI3_PARTE/158-329        AC A0DAI3.1
#=GS A0A3Q1B7N8_AMPOC/46-234     AC A0A3Q1B7N8.1
#=GS A0A663LYU1_ATHCN/239-432    AC A0A663LYU1.1
#=GS U3IW20_ANAPP/167-350        AC U3IW20.2
#=GS A0A0M9AAE8_9HYME/170-372    AC A0A0M9AAE8.1
#=GS A0A3Q3FBP8_9LABR/159-342    AC A0A3Q3FBP8.1
#=GS A0A1S3B3L3_CUCME/173-355    AC A0A1S3B3L3.1
#=GS A0A395HC06_9EURO/119-300    AC A0A395HC06.1
#=GS A0A671XUW9_SPAAU/151-340    AC A0A671XUW9.1
#=GS A0A5N6FLV1_PETAA/161-342    AC A0A5N6FLV1.1
#=GS A0A6J2P9W5_COTGO/160-354    AC A0A6J2P9W5.1
#=GS W5JK16_ANODA/161-345        AC W5JK16.1
#=GS A0A672S0X4_SINGR/150-345    AC A0A672S0X4.1
#=GS L8X9Z5_THACA/151-337        AC L8X9Z5.1
#=GS A0A2K5PS36_CEBIM/313-505    AC A0A2K5PS36.1
#=GS G1N1E5_MELGA/45-229         AC G1N1E5.2
#=GS A0A2G9GB41_9LAMI/216-401    AC A0A2G9GB41.1
#=GS A0A0S3RDH4_PHAAN/173-358    AC A0A0S3RDH4.1
#=GS A0A671P528_9TELE/155-350    AC A0A671P528.1
#=GS A0A4U5MB86_POPAL/205-390    AC A0A4U5MB86.1
#=GS T1ITS1_STRMM/565-728        AC T1ITS1.1
#=GS A0A674H5I7_TAEGU/191-377    AC A0A674H5I7.1
#=GS A0A6L2PCR7_COPFO/156-343    AC A0A6L2PCR7.1
#=GS A0A182YNV8_ANOST/305-444    AC A0A182YNV8.1
#=GS A0A5N5TLJ2_9CRUS/282-473    AC A0A5N5TLJ2.1
#=GS A0A2J6JGP5_LACSA/171-367    AC A0A2J6JGP5.1
#=GS A0A6P4YIL4_BRABE/556-743    AC A0A6P4YIL4.1
#=GS A0A6P8PB53_GEOSA/292-408    AC A0A6P8PB53.1
#=GS A0A066XPG2_COLSU/119-294    AC A0A066XPG2.1
#=GS F2UE34_SALR5/164-347        AC F2UE34.1
#=GS A0A6P8IZQ9_ACTTE/160-344    AC A0A6P8IZQ9.1
#=GS A0A6J1VTD6_9SAUR/60-175     AC A0A6J1VTD6.1
#=GS A0A364L7K6_9EURO/157-338    AC A0A364L7K6.1
#=GS A0A1Q2YJU2_9ASCO/171-358    AC A0A1Q2YJU2.1
#=GS A0A6A5F7E2_PERFL/168-351    AC A0A6A5F7E2.1
#=GS E3LT43_CAERE/281-478        AC E3LT43.1
#=GS A0A1S3RZE5_SALSA/176-348    AC A0A1S3RZE5.1
#=GS A0A238FH11_9BASI/189-369    AC A0A238FH11.1
#=GS A0A0H5S3G8_BRUMA/13-137     AC A0A0H5S3G8.1
#=GS A0A445HM32_GLYSO/234-414    AC A0A445HM32.1
#=GS A0A061FRV0_THECC/175-350    AC A0A061FRV0.1
#=GS A0A067F083_CITSI/1-121      AC A0A067F083.1
#=GS S7PKX2_MYOBR/208-397        AC S7PKX2.1
#=GS A0A671TM67_SPAAU/159-343    AC A0A671TM67.1
#=GS A0A016W0V5_9BILA/154-336    AC A0A016W0V5.1
#=GS A0A4Y8CM44_9HELO/152-333    AC A0A4Y8CM44.1
#=GS A0A3Q1GVC2_9TELE/211-397    AC A0A3Q1GVC2.1
#=GS A0A093JBG3_EURHL/144-324    AC A0A093JBG3.1
#=GS A0A091GKW7_9AVES/165-349    AC A0A091GKW7.1
#=GS A0A0V1AVD5_TRISP/661-850    AC A0A0V1AVD5.1
#=GS A0A1E5VXW3_9POAL/1216-1400  AC A0A1E5VXW3.1
#=GS A0A4W5N3U8_9TELE/148-342    AC A0A4W5N3U8.1
#=GS A0A0D0B3R3_9AGAM/325-498    AC A0A0D0B3R3.1
#=GS A0A093C4R2_TAUER/144-324    AC A0A093C4R2.1
#=GS A0A6J0VCC3_9SAUR/168-352    AC A0A6J0VCC3.1
#=GS A0A6I9MET6_PERMB/160-355    AC A0A6I9MET6.1
#=GS A0A1Q3BE75_CEPFO/187-366    AC A0A1Q3BE75.1
#=GS A0A667YSP0_9TELE/124-284    AC A0A667YSP0.1
#=GS A0A2C5ZJY3_9HYPO/158-339    AC A0A2C5ZJY3.1
#=GS A0A093NWG7_PYGAD/513-702    AC A0A093NWG7.1
#=GS A0A087SVU2_STEMI/157-325    AC A0A087SVU2.1
#=GS A0A6P3VY25_CLUHA/152-332    AC A0A6P3VY25.1
#=GS A0A3P6VA19_LITSI/360-541    AC A0A3P6VA19.1
#=GS A0A0D2U2W7_CAPO3/153-345    AC A0A0D2U2W7.1
#=GS A0A067NGT1_PLEOS/161-347    AC A0A067NGT1.1
#=GS A0A150GCM2_GONPE/183-369    AC A0A150GCM2.1
#=GS A0A3Q7S665_VULVU/64-251     AC A0A3Q7S665.1
#=GS A0A2P4ZZS7_9HYPO/99-270     AC A0A2P4ZZS7.1
#=GS Q28HX8_XENTR/169-352        AC Q28HX8.1
#=GS W5JGI8_ANODA/297-460        AC W5JGI8.1
#=GS W7M885_GIBM7/144-319        AC W7M885.1
#=GS A0A5E4BW19_MARMO/167-350    AC A0A5E4BW19.1
#=GS A7TFE6_VANPO/163-347        AC A7TFE6.1
#=GS A0A0J1B0C0_9TREE/318-479    AC A0A0J1B0C0.1
#=GS A0A4D9DPB0_9SAUR/189-375    AC A0A4D9DPB0.1
#=GS A0A672R6B6_SINGR/160-343    AC A0A672R6B6.1
#=GS A2DVG0_TRIVA/151-339        AC A2DVG0.1
#=GS A0A6A3D339_HIBSY/232-412    AC A0A6A3D339.1
#=GS A0A067LD89_JATCU/181-353    AC A0A067LD89.1
#=GS A0A3Q7Q6U0_CALUR/158-338    AC A0A3Q7Q6U0.1
#=GS T1GC80_MEGSC/3-86           AC T1GC80.1
#=GS A0A261Y3I8_9FUNG/278-433    AC A0A261Y3I8.1
#=GS A0A3L6PE55_PANMI/134-323    AC A0A3L6PE55.1
#=GS A0A6I9VID7_BACDO/535-691    AC A0A6I9VID7.1
#=GS W6LA81_9TRYP/187-327        AC W6LA81.1
#=GS M4BRM5_HYAAE/171-338        AC M4BRM5.1
#=GS Q1ECX9_DANRE/309-501        AC Q1ECX9.1
#=GS F6UUF9_CIOIN/160-339        AC F6UUF9.2
#=GS A0A0E0N8D7_ORYRU/281-373    AC A0A0E0N8D7.1
#=GS A0A443HQC0_BYSSP/115-295    AC A0A443HQC0.1
#=GS A0A2V0PD80_9CHLO/160-345    AC A0A2V0PD80.1
#=GS A0A5N5KRK3_PANHP/167-350    AC A0A5N5KRK3.1
#=GS A0A2Y9K003_ENHLU/311-428    AC A0A2Y9K003.1
#=GS A0A1B6PQQ6_SORBI/145-330    AC A0A1B6PQQ6.1
#=GS A0A3M2RIW5_9HYPO/155-336    AC A0A3M2RIW5.1
#=GS F4K0F7_ARATH/241-420        AC F4K0F7.1
#=GS M0SGS3_MUSAM/186-371        AC M0SGS3.1
#=GS A0A341CL30_NEOAA/272-350    AC A0A341CL30.1
#=GS K7FL23_PELSI/119-314        AC K7FL23.1
#=GS A0A1S2YBR2_CICAR/203-388    AC A0A1S2YBR2.1
#=GS A0A183W915_TRIRE/54-249     AC A0A183W915.1
#=GS A0A1S4BY11_TOBAC/178-359    AC A0A1S4BY11.1
#=GS A0A0J8UTL3_COCIT/159-340    AC A0A0J8UTL3.1
#=GS A0A6J1QLU8_9HYME/571-727    AC A0A6J1QLU8.1
#=GS A0A6G1E5F1_9ORYZ/217-397    AC A0A6G1E5F1.1
#=GS A0A0S7DU71_9EURO/743-924    AC A0A0S7DU71.1
#=GS G3SFP6_GORGO/140-320        AC G3SFP6.2
#=GS A0A663F4M9_AQUCH/189-375    AC A0A663F4M9.1
#=GS A0A1L8H859_XENLA/287-403    AC A0A1L8H859.1
#=GS A0A2K6TVM7_SAIBB/180-365    AC A0A2K6TVM7.1
#=GS A0A0K9R285_SPIOL/229-413    AC A0A0K9R285.1
#=GS A0A453HJX8_AEGTS/1-84       AC A0A453HJX8.1
#=GS A0A5N4AG31_PHOPY/176-358    AC A0A5N4AG31.1
#=GS A0A0P7XE05_SCLFO/143-324    AC A0A0P7XE05.1
#=GS A0A093Q7D9_9PASS/148-331    AC A0A093Q7D9.1
#=GS A0A671KVP0_9TELE/144-327    AC A0A671KVP0.1
#=GS G9F6X8_PIG/161-345          AC G9F6X8.1
#=GS A0A0V1H7H5_9BILA/163-347    AC A0A0V1H7H5.1
#=GS A0A2J6S180_9HELO/149-330    AC A0A2J6S180.1
#=GS A0A4Q9Q8T6_9APHY/154-342    AC A0A4Q9Q8T6.1
#=GS A0A087VRP1_BALRE/148-331    AC A0A087VRP1.1
#=GS A0A5J5N333_MUNRE/60-247     AC A0A5J5N333.1
#=GS A0A3B3I7C9_ORYLA/206-368    AC A0A3B3I7C9.1
#=GS I3LXS9_ICTTR/180-365        AC I3LXS9.1
#=GS A0A674PF88_TAKRU/482-629    AC A0A674PF88.1
#=GS A0A6J1XD59_ACIJB/311-428    AC A0A6J1XD59.1
#=GS T0M7G6_COLGC/152-333        AC T0M7G6.1
#=GS A0A643BR24_BALPH/173-345    AC A0A643BR24.1
#=GS G3SVJ9_LOXAF/64-251         AC G3SVJ9.1
#=GS A0A2P4T3Y1_BAMTH/158-353    AC A0A2P4T3Y1.1
#=GS A0A671Q2K6_9TELE/152-346    AC A0A671Q2K6.1
#=GS A0A0V1C0V9_TRISP/1003-1187  AC A0A0V1C0V9.1
#=GS A0A2K2BFD6_POPTR/167-352    AC A0A2K2BFD6.1
#=GS W5PMM2_SHEEP/167-350        AC W5PMM2.1
#=GS A0A3Q2CEI0_CYPVA/47-234     AC A0A3Q2CEI0.1
#=GS A0A5M9JQT9_MONFR/204-280    AC A0A5M9JQT9.1
#=GS M7THY6_EUTLA/46-221         AC M7THY6.1
#=GS A0A0R4J0Z1_MOUSE/308-500    AC A0A0R4J0Z1.1
#=GS A0A093BMA9_9AVES/123-304    AC A0A093BMA9.1
#=GS A0A401RWM8_CHIPU/310-502    AC A0A401RWM8.1
#=GS A0A0D2ELA9_9EURO/164-341    AC A0A0D2ELA9.1
#=GS A0A0V0R3H3_PSEPJ/160-344    AC A0A0V0R3H3.1
#=GS A0A665X5H4_ECHNA/149-344    AC A0A665X5H4.1
#=GS A0A0K9RYB1_SPIOL/173-356    AC A0A0K9RYB1.1
#=GS A0A4Z1JNZ6_9HELO/152-333    AC A0A4Z1JNZ6.1
#=GS A0A1D6PSB8_MAIZE/172-348    AC A0A1D6PSB8.1
#=GS U3KHZ2_FICAL/184-369        AC U3KHZ2.1
#=GS A0A1B7MUD4_9AGAM/163-347    AC A0A1B7MUD4.1
#=GS A0A4W4EBS6_ELEEL/47-232     AC A0A4W4EBS6.1
#=GS A0A0E0DEI1_9ORYZ/170-354    AC A0A0E0DEI1.1
#=GS A0A7M7MGK5_APIME/565-721    AC A0A7M7MGK5.1
#=GS A0A6G1A833_CROCR/199-316    AC A0A6G1A833.1
#=GS A0A096P291_PAPAN/198-313    AC A0A096P291.2
#=GS A0A0A1NW57_RHIZD/156-337    AC A0A0A1NW57.1
#=GS A0A5N6KT90_9ROSI/208-390    AC A0A5N6KT90.1
#=GS A0A319DHC7_9EURO/157-338    AC A0A319DHC7.1
#=GS A0A5N4E282_CAMDR/416-613    AC A0A5N4E282.1
#=GS A0A4W5JTG2_9TELE/306-498    AC A0A4W5JTG2.1
#=GS A0A2X0KKZ0_9BASI/286-466    AC A0A2X0KKZ0.1
#=GS A0A673TR99_SURSU/64-251     AC A0A673TR99.1
#=GS A0A0D3CQ74_BRAOL/212-397    AC A0A0D3CQ74.1
#=GS M3AK23_PSEFD/151-335        AC M3AK23.1
#=GS A0A0N4YDW4_NIPBR/168-365    AC A0A0N4YDW4.1
#=GS A0A4W4EIU7_ELEEL/162-340    AC A0A4W4EIU7.1
#=GS A0A0D3FW34_9ORYZ/170-356    AC A0A0D3FW34.1
#=GS A0A2P8A0G9_9PEZI/153-334    AC A0A2P8A0G9.1
#=GS A0A2G5BIZ8_COERN/134-314    AC A0A2G5BIZ8.1
#=GS A0A2U3WJB1_ODORO/312-504    AC A0A2U3WJB1.1
#=GS A0A6I9HGG2_GEOFO/178-363    AC A0A6I9HGG2.1
#=GS A0A4W6CDP2_LATCA/163-346    AC A0A4W6CDP2.1
#=GS A0A7E5WQ31_TRINI/169-355    AC A0A7E5WQ31.1
#=GS A0A2K5BVF0_AOTNA/149-346    AC A0A2K5BVF0.1
#=GS A0A1R2CBZ1_9CILI/156-334    AC A0A1R2CBZ1.1
#=GS A0A669Q0S7_PHACC/510-677    AC A0A669Q0S7.1
#=GS A0A1D6F5C2_MAIZE/170-386    AC A0A1D6F5C2.1
#=GS A0A0D8Y5Q2_DICVI/1-108      AC A0A0D8Y5Q2.1
#=GS E5SW38_TRISP/279-476        AC E5SW38.1
#=GS A0A1X1BMI2_9APIC/183-323    AC A0A1X1BMI2.1
#=GS A0A6P8TZP2_GYMAC/17-197     AC A0A6P8TZP2.1
#=GS A0A0V1M4I5_9BILA/153-341    AC A0A0V1M4I5.1
#=GS A0A2P8Z6V6_BLAGE/100-286    AC A0A2P8Z6V6.1
#=GS A0A4Y9Z6R8_9AGAM/419-604    AC A0A4Y9Z6R8.1
#=GS A0A0L7KAZ0_PLAFX/162-341    AC A0A0L7KAZ0.1
#=GS A0A6J3L9F9_9HYME/1605-1768  AC A0A6J3L9F9.1
#=GS A0A0C9YYV8_9AGAM/332-509    AC A0A0C9YYV8.1
#=GS A0A6L2Q4C4_COPFO/105-291    AC A0A6L2Q4C4.1
#=GS A0A6P9ETY5_JUGRE/224-405    AC A0A6P9ETY5.1
#=GS A0A6J2TJQ1_DROLE/158-342    AC A0A6J2TJQ1.1
#=GS A0A087VY02_ECHMU/157-341    AC A0A087VY02.1
#=GS A0A671QZ29_9TELE/150-345    AC A0A671QZ29.1
#=GS A0A4X2KBH3_VOMUR/163-358    AC A0A4X2KBH3.1
#=GS G8Y1C1_PICSO/180-377        AC G8Y1C1.1
#=GS K3ZI56_SETIT/171-356        AC K3ZI56.1
#=GS A0A2I4BGL6_9TELE/170-354    AC A0A2I4BGL6.1
#=GS A0A6A2ZA80_HIBSY/259-438    AC A0A6A2ZA80.1
#=GS A0A4Q2DKV0_9AGAR/300-456    AC A0A4Q2DKV0.1
#=GS A0A665W7B2_ECHNA/200-385    AC A0A665W7B2.1
#=GS A0A3Q7MX25_CALUR/180-365    AC A0A3Q7MX25.1
#=GS A0A4U5U565_COLLU/44-232     AC A0A4U5U565.1
#=GS S4R7K3_PETMA/157-336        AC S4R7K3.1
#=GS A0A2K5S3T0_CEBIM/180-367    AC A0A2K5S3T0.1
#=GS U7PU23_SPOS1/157-338        AC U7PU23.1
#=GS A0A3Q2HFE3_HORSE/400-559    AC A0A3Q2HFE3.1
#=GS A0A3Q3FQF1_9LABR/302-494    AC A0A3Q3FQF1.1
#=GS A0A673ZGL6_SALTR/153-348    AC A0A673ZGL6.1
#=GS V5GCL1_BYSSN/157-338        AC V5GCL1.1
#=GS A0A3P6TGF2_LITSI/148-330    AC A0A3P6TGF2.1
#=GS A0A6A4JTV0_APOLU/151-343    AC A0A6A4JTV0.1
#=GS A0A1Y3NN13_PIRSE/5-186      AC A0A1Y3NN13.1
#=GS A0A4U5PG70_STECR/160-339    AC A0A4U5PG70.1
#=GS W5LQ27_ASTMX/311-502        AC W5LQ27.2
#=GS A0A3Q3N2X0_9TELE/149-344    AC A0A3Q3N2X0.2
#=GS A0A803JDT7_XENTR/218-404    AC A0A803JDT7.1
#=GS A0A1A8YVQ0_9APIC/104-245    AC A0A1A8YVQ0.1
#=GS A0A1A6HEZ6_NEOLE/222-411    AC A0A1A6HEZ6.1
#=GS A0A2K3NWF8_TRIPR/169-354    AC A0A2K3NWF8.1
#=GS A0A2I0VBW2_9ASPA/231-411    AC A0A2I0VBW2.1
#=GS A0A2C5X6C1_9PEZI/154-335    AC A0A2C5X6C1.1
#=GS A0A0K9PQZ5_ZOSMR/174-359    AC A0A0K9PQZ5.1
#=GS A0A1E4TNP5_PACTA/414-533    AC A0A1E4TNP5.1
#=GS A0A3Q0E430_CARSF/105-288    AC A0A3Q0E430.1
#=GS A0A498JGA8_MALDO/182-360    AC A0A498JGA8.1
#=GS A0A3Q3AHI2_KRYMA/159-343    AC A0A3Q3AHI2.1
#=GS A0A177B7J3_9BILA/164-326    AC A0A177B7J3.1
#=GS A0A5P1FGJ9_ASPOF/175-353    AC A0A5P1FGJ9.1
#=GS T1KD42_TETUR/156-336        AC T1KD42.1
#=GS Q304D5_CAEEL/172-361        AC Q304D5.1
#=GS A0A674GQF4_TAEGU/546-735    AC A0A674GQF4.1
#=GS A0A6P7HX22_9TELE/540-739    AC A0A6P7HX22.1
#=GS A0A6J1V8U9_9SAUR/165-351    AC A0A6J1V8U9.1
#=GS A0A672PGB0_SINGR/87-252     AC A0A672PGB0.1
#=GS A0A674DW61_SALTR/306-498    AC A0A674DW61.1
#=GS B8MS71_TALSN/80-245         AC B8MS71.1
#=GS A0A6G0XX97_9STRA/161-340    AC A0A6G0XX97.1
#=GS A0A671L0X6_9TELE/152-346    AC A0A671L0X6.1
#=GS A0A6A5NS46_LUPAL/218-398    AC A0A6A5NS46.1
#=GS A0A397I3W4_9GLOM/165-346    AC A0A397I3W4.1
#=GS A0A3S4N6M7_9MAGN/215-399    AC A0A3S4N6M7.1
#=GS A0A087QWZ1_APTFO/148-331    AC A0A087QWZ1.1
#=GS A0A6A4QU24_LUPAL/170-351    AC A0A6A4QU24.1
#=GS A0A2I3SZJ8_PANTR/9-150      AC A0A2I3SZJ8.1
#=GS A0A287AEF6_PIG/538-727      AC A0A287AEF6.1
#=GS A0A0F8B1K5_CERFI/155-335    AC A0A0F8B1K5.1
#=GS A0A0D2DS74_9EURO/153-333    AC A0A0D2DS74.1
#=GS PDI_DROME/161-345           AC P54399.1
#=GS A0A6I8U4L0_AEDAE/530-688    AC A0A6I8U4L0.1
#=GS A0A5D3CBN4_CUCME/169-366    AC A0A5D3CBN4.1
#=GS A0A3Q7WP15_URSAR/226-406    AC A0A3Q7WP15.1
#=GS A0A2U1KQY2_ARTAN/168-352    AC A0A2U1KQY2.1
#=GS A0A1D5QRX6_MACMU/311-503    AC A0A1D5QRX6.1
#=GS A0A6P7WWH8_9AMPH/155-350    AC A0A6P7WWH8.1
#=GS A0A2R6NV03_9APHY/153-338    AC A0A2R6NV03.1
#=GS B5X1H7_SALSA/149-344        AC B5X1H7.1
#=GS A0A498NL60_LABRO/71-131     AC A0A498NL60.1
#=GS A0A672J8C8_SALFA/100-279    AC A0A672J8C8.1
#=GS A0A6J2H3E3_9PASS/179-375    AC A0A6J2H3E3.1
#=GS I1M5K0_SOYBN/196-352        AC I1M5K0.1
#=GS A0A674DSP3_SALTR/159-342    AC A0A674DSP3.1
#=GS H2ZN93_CIOSA/144-329        AC H2ZN93.1
#=GS A0A2P5YGK3_GOSBA/169-354    AC A0A2P5YGK3.1
#=GS A0A091VLJ1_PHORB/124-268    AC A0A091VLJ1.1
#=GS A0A671P586_9TELE/126-314    AC A0A671P586.1
#=GS A0A3N0XVL0_ANAGA/529-722    AC A0A3N0XVL0.1
#=GS Q7ZWU3_XENLA/156-352        AC Q7ZWU3.1
#=GS A0A6P7TQ50_OCTVU/64-238     AC A0A6P7TQ50.1
#=GS A0A7I4AY08_PHYPA/191-380    AC A0A7I4AY08.1
#=GS A0A1I7VVT9_LOALO/163-346    AC A0A1I7VVT9.1
#=GS A0A7E5WEJ6_TRINI/157-343    AC A0A7E5WEJ6.1
#=GS S3BZ86_OPHP1/155-336        AC S3BZ86.1
#=GS A0A6Q2X6Y7_ESOLU/143-268    AC A0A6Q2X6Y7.1
#=GS A0A5N5MQI9_9ROSI/259-416    AC A0A5N5MQI9.1
#=GS A0A016TY16_9BILA/178-365    AC A0A016TY16.1
#=GS A0A4W6EVL6_LATCA/192-378    AC A0A4W6EVL6.1
#=GS M3YQT4_MUSPF/201-318        AC M3YQT4.1
#=GS A0A0V0XWP9_TRIPS/60-235     AC A0A0V0XWP9.1
#=GS A0A0D7BVC1_9AGAR/158-334    AC A0A0D7BVC1.1
#=GS A0A446X332_TRITD/153-336    AC A0A446X332.1
#=GS A0A1I7VTU5_LOALO/13-137     AC A0A1I7VTU5.1
#=GS A0A286UNP2_9AGAM/157-341    AC A0A286UNP2.1
#=GS A0A6I8VRU3_DROPS/519-677    AC A0A6I8VRU3.1
#=GS A0A485MUA4_LYNPA/159-354    AC A0A485MUA4.1
#=GS A0A674CYE0_SALTR/162-356    AC A0A674CYE0.1
#=GS A0A6J0V1J0_9SAUR/308-500    AC A0A6J0V1J0.1
#=GS A0A1S3BAJ9_CUCME/167-351    AC A0A1S3BAJ9.1
#=GS A0A1U7YH43_NICSY/165-350    AC A0A1U7YH43.1
#=GS A0A674E629_SALTR/129-312    AC A0A674E629.1
#=GS A0A093C8B5_TAUER/44-228     AC A0A093C8B5.1
#=GS A0A5N6Q0Q0_9ASTR/176-361    AC A0A5N6Q0Q0.1
#=GS A0A287WGB3_HORVV/15-124     AC A0A287WGB3.1
#=GS A0A2K6Q2I6_RHIRO/533-722    AC A0A2K6Q2I6.1
#=GS J3K9W4_COCIM/159-340        AC J3K9W4.2
#=GS J9JW44_ACYPI/154-347        AC J9JW44.2
#=GS A0A4W3H400_CALMI/107-302    AC A0A4W3H400.1
#=GS D8R0G0_SELML/163-346        AC D8R0G0.1
#=GS A0A3B0JPC9_DROGU/204-361    AC A0A3B0JPC9.1
#=GS A0A6P7LVZ8_BETSP/564-763    AC A0A6P7LVZ8.1
#=GS A0A6P8I2E5_ACTTE/157-342    AC A0A6P8I2E5.1
#=GS A0A4T0WAJ8_9PEZI/201-319    AC A0A4T0WAJ8.1
#=GS A0A2K5K966_COLAP/167-350    AC A0A2K5K966.1
#=GS A0A6P6VK14_COFAR/198-380    AC A0A6P6VK14.1
#=GS A0A4S8JCZ2_MUSBA/144-323    AC A0A4S8JCZ2.1
#=GS A0CZX8_PARTE/155-332        AC A0CZX8.1
#=GS A0A196SCA5_BLAHN/174-346    AC A0A196SCA5.1
#=GS A0A1D2NLC2_ORCCI/182-368    AC A0A1D2NLC2.1
#=GS A0A091KSI4_9GRUI/78-273     AC A0A091KSI4.1
#=GS A0A2J6TC37_9HELO/147-325    AC A0A2J6TC37.1
#=GS A0A445K851_GLYSO/170-356    AC A0A445K851.1
#=GS A0A0D9S4M6_CHLSB/163-347    AC A0A0D9S4M6.1
#=GS A0A287TFQ7_HORVV/2-87       AC A0A287TFQ7.1
#=GS A0A2U3YBQ5_LEPWE/167-350    AC A0A2U3YBQ5.1
#=GS A0A672QXM7_SINGR/159-343    AC A0A672QXM7.1
#=GS A0A455BRQ7_PHYMC/601-786    AC A0A455BRQ7.1
#=GS A0A1V1T2T7_9FUNG/175-319    AC A0A1V1T2T7.1
#=GS A0A4W4FNH6_ELEEL/541-732    AC A0A4W4FNH6.1
#=GS A0A674GPR3_TAEGU/165-349    AC A0A674GPR3.1
#=GS A0A287II25_HORVV/1-131      AC A0A287II25.1
#=GS J9JBU0_9SPIT/318-507        AC J9JBU0.1
#=GS G3R1W5_GORGO/180-365        AC G3R1W5.2
#=GS A0A2H2HYC5_CAEJA/156-336    AC A0A2H2HYC5.1
#=GS A0A674PB75_TAKRU/218-402    AC A0A674PB75.1
#=GS A0A2B4RVE6_STYPI/157-342    AC A0A2B4RVE6.1
#=GS A0A6P9BQY7_PANGU/303-495    AC A0A6P9BQY7.1
#=GS A0A384A3D3_BALAS/183-350    AC A0A384A3D3.1
#=GS A0A024UE67_9STRA/227-422    AC A0A024UE67.1
#=GS A0A4X3NTU9_PRIPA/159-337    AC A0A4X3NTU9.1
#=GS A0A6J5TU63_PRUAR/202-380    AC A0A6J5TU63.1
#=GS A0A316V8U8_9BASI/124-307    AC A0A316V8U8.1
#=GS A0A2K5RRA2_CEBIM/533-722    AC A0A2K5RRA2.1
#=GS A0A6I9ZF51_ACIJB/160-355    AC A0A6I9ZF51.1
#=GS G9NCX1_HYPVG/144-315        AC G9NCX1.1
#=GS A0A388JJG0_CHABU/1-138      AC A0A388JJG0.1
#=GS A0A6H5J1Q4_9HYME/81-267     AC A0A6H5J1Q4.1
#=GS A0A453C0L9_AEGTS/95-188     AC A0A453C0L9.1
#=GS A0A672MAT7_SINGR/166-350    AC A0A672MAT7.1
#=GS A0A3Q3EYP5_KRYMA/168-351    AC A0A3Q3EYP5.1
#=GS A0A6P8WTS3_DROAB/524-681    AC A0A6P8WTS3.1
#=GS A0A087UTY8_STEMI/297-490    AC A0A087UTY8.1
#=GS K7BNU8_PANTR/533-722        AC K7BNU8.1
#=GS A0A6J1CIG7_MOMCH/169-366    AC A0A6J1CIG7.1
#=GS A0A3B1K4A1_ASTMX/534-732    AC A0A3B1K4A1.1
#=GS A0A7N6ATX0_ANATE/127-297    AC A0A7N6ATX0.1
#=GS S0DN43_GIBF5/456-569        AC S0DN43.1
#=GS A0A2C9V1F9_MANES/235-416    AC A0A2C9V1F9.1
#=GS A0A668SU63_OREAU/165-364    AC A0A668SU63.1
#=GS A0A0C2CMU1_9BILA/43-218     AC A0A0C2CMU1.1
#=GS A0A7M7L6D3_APIME/564-721    AC A0A7M7L6D3.1
#=GS A0A2I1GUW1_9GLOM/162-342    AC A0A2I1GUW1.1
#=GS A0A3L8T0S1_CHLGU/158-339    AC A0A3L8T0S1.1
#=GS A0A401NJV1_SCYTO/168-351    AC A0A401NJV1.1
#=GS I0YWW3_COCSC/164-343        AC I0YWW3.1
#=GS A0A2I3HN88_NOMLE/146-326    AC A0A2I3HN88.1
#=GS A0A087YG62_POEFO/159-342    AC A0A087YG62.2
#=GS A0A2G9HJ22_9LAMI/169-352    AC A0A2G9HJ22.1
#=GS A0A2K1IHS6_PHYPA/239-424    AC A0A2K1IHS6.1
#=GS A0A1S3U8T0_VIGRR/199-384    AC A0A1S3U8T0.1
#=GS A0A6P8I7L6_ACTTE/946-1134   AC A0A6P8I7L6.1
#=GS A0A384L712_PLAKH/199-379    AC A0A384L712.1
#=GS A0A210QS50_MIZYE/167-351    AC A0A210QS50.1
#=GS A0A6P7GWI8_DIAVI/151-337    AC A0A6P7GWI8.1
#=GS G3NVG1_GASAC/151-346        AC G3NVG1.1
#=GS A0A6J3E017_AYTFU/295-410    AC A0A6J3E017.1
#=GS A0A4W5P118_9TELE/159-342    AC A0A4W5P118.1
#=GS A0A6A3A889_HIBSY/225-355    AC A0A6A3A889.1
#=GS A0A3Q1IHZ9_ANATE/284-475    AC A0A3Q1IHZ9.1
#=GS M0WGB4_HORVV/92-268         AC M0WGB4.1
#=GS A0A669PM03_PHACC/192-378    AC A0A669PM03.1
#=GS A0A1W0X251_HYPDU/178-365    AC A0A1W0X251.1
#=GS A0A672KWW6_SINGR/193-380    AC A0A672KWW6.1
#=GS V4LD03_EUTSA/177-357        AC V4LD03.1
#=GS A0A452I4D6_9SAUR/155-350    AC A0A452I4D6.1
#=GS A0A1X2HIA2_SYNRA/141-321    AC A0A1X2HIA2.1
#=GS A0A673G786_9TELE/307-499    AC A0A673G786.1
#=GS A0A6G0X8Z7_9STRA/197-342    AC A0A6G0X8Z7.1
#=GS A0A183LA75_9TREM/27-189     AC A0A183LA75.1
#=GS Q93XQ8_WHEAT/176-361        AC Q93XQ8.1
#=GS H3CJH3_TETNG/47-234         AC H3CJH3.1
#=GS A0A5F8G293_MONDO/299-491    AC A0A5F8G293.1
#=GS A0A553Q3U6_9TELE/150-333    AC A0A553Q3U6.1
#=GS A0A672LX60_SINGR/131-308    AC A0A672LX60.1
#=GS A0A5J5CG43_9PERO/414-582    AC A0A5J5CG43.1
#=GS A0A1D1VC21_RAMVA/307-509    AC A0A1D1VC21.1
#=GS A0A397YTM4_BRACM/205-390    AC A0A397YTM4.1
#=GS A0A1S4AWE2_TOBAC/240-419    AC A0A1S4AWE2.1
#=GS A0A507FDM8_9FUNG/161-337    AC A0A507FDM8.1
#=GS A0A6Q2XZ44_ESOLU/221-316    AC A0A6Q2XZ44.1
#=GS A0A0B7FSP6_THACB/342-477    AC A0A0B7FSP6.1
#=GS C4Y795_CLAL4/217-371        AC C4Y795.1
#=GS A0A433TKM6_ELYCH/154-343    AC A0A433TKM6.1
#=GS A0A1L8H0R6_XENLA/155-351    AC A0A1L8H0R6.1
#=GS A0A6J1QKD7_9HYME/556-715    AC A0A6J1QKD7.1
#=GS A0A093QVY4_PHACA/80-275     AC A0A093QVY4.1
#=GS A0A091VS04_OPIHO/200-315    AC A0A091VS04.1
#=GS A0A2I3GXF7_NOMLE/174-355    AC A0A2I3GXF7.1
#=GS A0A1Y1V1R6_9FUNG/179-371    AC A0A1Y1V1R6.1
#=GS W5KVZ1_ASTMX/66-174         AC W5KVZ1.2
#=GS A0A4Q4V586_9PEZI/157-338    AC A0A4Q4V586.1
#=GS H0VH03_CAVPO/160-335        AC H0VH03.2
#=GS F7DPZ7_MACMU/539-728        AC F7DPZ7.3
#=GS A0A671T6A8_9TELE/36-223     AC A0A671T6A8.1
#=GS A0A0D2HMI8_9EURO/149-330    AC A0A0D2HMI8.1
#=GS A0A6J3EUR9_SAPAP/167-350    AC A0A6J3EUR9.1
#=GS A0A2R9CE71_PANPA/167-350    AC A0A2R9CE71.1
#=GS A0A0D3A953_BRAOL/13-161     AC A0A0D3A953.1
#=GS A0A5F8G5B5_MONDO/244-425    AC A0A5F8G5B5.1
#=GS U1FX64_ENDPU/153-334        AC U1FX64.1
#=GS E4WRZ2_OIKDI/158-327        AC E4WRZ2.1
#=GS A0A4D9DVE3_9SAUR/167-350    AC A0A4D9DVE3.1
#=GS A0A4Z1KKH2_9HELO/152-333    AC A0A4Z1KKH2.1
#=GS C4LU87_ENTHI/162-334        AC C4LU87.1
#=GS A0A670JH61_PODMU/183-371    AC A0A670JH61.1
#=GS A0A6A2ZLK5_HIBSY/204-372    AC A0A6A2ZLK5.1
#=GS A0A663EPP8_AQUCH/121-227    AC A0A663EPP8.1
#=GS B4JE62_DROGR/153-342        AC B4JE62.1
#=GS A0A3P6SXG2_CYLGO/13-158     AC A0A3P6SXG2.1
#=GS A0A398A8X5_BRACM/230-409    AC A0A398A8X5.1
#=GS S7MHA1_MYOBR/215-332        AC S7MHA1.1
#=GS A0A2K6DBL3_MACNE/64-251     AC A0A2K6DBL3.1
#=GS A0A091IX13_EGRGA/193-308    AC A0A091IX13.1
#=GS A0A6J1Y4F1_ACIJB/261-324    AC A0A6J1Y4F1.1
#=GS G1L5C7_AILME/458-647        AC G1L5C7.2
#=GS A0A6J0Y0Y4_ODOVR/180-311    AC A0A6J0Y0Y4.1
#=GS S8CY36_9LAMI/211-398        AC S8CY36.1
#=GS D6W727_TRICA/157-344        AC D6W727.1
#=GS A0A0E0L894_ORYPU/203-387    AC A0A0E0L894.1
#=GS X6MMU7_RETFI/3-125          AC X6MMU7.1
#=GS A0A6P8Q316_GEOSA/1-182      AC A0A6P8Q316.1
#=GS B6Q377_TALMQ/157-338        AC B6Q377.1
#=GS A0A0C3CPW8_HEBCY/154-338    AC A0A0C3CPW8.1
#=GS A0A0V0RHP9_9BILA/652-841    AC A0A0V0RHP9.1
#=GS R7UID4_CAPTE/152-352        AC R7UID4.1
#=GS A0A1B8E4N7_9PEZI/386-534    AC A0A1B8E4N7.1
#=GS A0A1S4B4G2_TOBAC/162-348    AC A0A1S4B4G2.1
#=GS A0A6H0Y1U2_9PEZI/150-334    AC A0A6H0Y1U2.1
#=GS A0A6A4ME91_9ERIC/219-405    AC A0A6A4ME91.1
#=GS A0A4V1XCC3_9PEZI/46-225     AC A0A4V1XCC3.1
#=GS A0A1X7V4D7_AMPQE/211-378    AC A0A1X7V4D7.1
#=GS A0A6I9VXJ6_9HYME/151-353    AC A0A6I9VXJ6.1
#=GS A0A195CBZ6_9HYME/160-354    AC A0A195CBZ6.1
#=GS A0A2K6LMX4_RHIBE/86-291     AC A0A2K6LMX4.1
#=GS A0A199UJ49_ANACO/191-367    AC A0A199UJ49.1
#=GS A0A397GHE8_9EURO/742-923    AC A0A397GHE8.1
#=GS A0A2K6LJW4_RHIBE/9-150      AC A0A2K6LJW4.1
#=GS W2SH94_NECAM/157-341        AC W2SH94.1
#=GS A0A6J2LM83_9CHIR/167-350    AC A0A6J2LM83.1
#=GS A0A059F5H7_9MICR/116-274    AC A0A059F5H7.1
#=GS A0A3Q2CL87_CYPVA/160-344    AC A0A3Q2CL87.1
#=GS A0A2K5M2K5_CERAT/167-350    AC A0A2K5M2K5.1
#=GS A0A3S2LQW2_CHISP/168-352    AC A0A3S2LQW2.1
#=GS E4WUS5_OIKDI/151-342        AC E4WUS5.1
#=GS PDI11_ARATH/168-353         AC Q9XI01.1
#=GS YB1D_SCHPO/421-543          AC P87178.1
#=GS A0A0K9PER6_ZOSMR/171-359    AC A0A0K9PER6.1
#=GS A0A6P7H332_DIAVI/162-346    AC A0A6P7H332.1
#=GS A0A3G2S5V9_9BASI/162-347    AC A0A3G2S5V9.1
#=GS A0A1V8SR14_9PEZI/150-334    AC A0A1V8SR14.1
#=GS A0A446VWW2_TRITD/125-304    AC A0A446VWW2.1
#=GS N4U2Y7_FUSC1/150-330        AC N4U2Y7.1
#=GS A0A0V0V0G8_9BILA/156-340    AC A0A0V0V0G8.1
#=GS A0A2K5M4V6_CERAT/9-150      AC A0A2K5M4V6.1
#=GS A0A1S4AT83_TOBAC/167-345    AC A0A1S4AT83.1
#=GS A0A3Q1EK86_9TELE/555-754    AC A0A3Q1EK86.1
#=GS H2ZN92_CIOSA/2-177          AC H2ZN92.1
#=GS A0A0G4KWG7_9PEZI/158-339    AC A0A0G4KWG7.1
#=GS A0A2G5UG86_9PELO/157-338    AC A0A2G5UG86.1
#=GS A0A4U5R7L2_POPAL/167-352    AC A0A4U5R7L2.1
#=GS A0A669B3B1_ORENI/159-343    AC A0A669B3B1.1
#=GS A0A091JIQ0_EGRGA/148-331    AC A0A091JIQ0.1
#=GS A0A6J2MRD8_9CHIR/157-338    AC A0A6J2MRD8.1
#=GS A0A453C015_AEGTS/215-391    AC A0A453C015.1
#=GS A0A671NEY2_9TELE/193-380    AC A0A671NEY2.1
#=GS A0A034W0S7_BACDO/168-365    AC A0A034W0S7.1
#=GS A0A024XBB1_PLAFC/112-279    AC A0A024XBB1.1
#=GS A0A6G1PBF3_9TELE/61-249     AC A0A6G1PBF3.1
#=GS A0A2I0AP71_9ASPA/182-349    AC A0A2I0AP71.1
#=GS A0A6H5I108_9HYME/1512-1675  AC A0A6H5I108.1
#=GS A0A2P5WV30_GOSBA/173-341    AC A0A2P5WV30.1
#=GS A0A2Y9TKE0_PHYMC/157-338    AC A0A2Y9TKE0.1
#=GS A0A6P8VP16_GYMAC/169-353    AC A0A6P8VP16.1
#=GS A0A2K5EPZ3_AOTNA/158-338    AC A0A2K5EPZ3.1
#=GS A0A1D6QVG0_MAIZE/221-410    AC A0A1D6QVG0.1
#=GS A0A3Q1HLQ9_ANATE/558-757    AC A0A3Q1HLQ9.2
#=GS A0A0L1J1A7_ASPNO/161-342    AC A0A0L1J1A7.1
#=GS K0KYD4_WICCF/167-344        AC K0KYD4.1
#=GS A0A093FDC7_TYTAL/3-145      AC A0A093FDC7.1
#=GS A0A182YH88_ANOST/146-332    AC A0A182YH88.1
#=GS A0A091GKN9_9AVES/280-472    AC A0A091GKN9.1
#=GS A0A2R6QZV8_ACTCC/211-396    AC A0A2R6QZV8.1
#=GS A0A5B8MKM9_9CHLO/169-366    AC A0A5B8MKM9.1
#=GS A0A315VN00_GAMAF/149-342    AC A0A315VN00.1
#=GS A0A665X5L3_ECHNA/145-340    AC A0A665X5L3.1
#=GS H2L7K9_ORYLA/148-343        AC H2L7K9.2
#=GS G3HTH1_CRIGR/219-410        AC G3HTH1.1
#=GS A0A2I3HZ60_NOMLE/173-354    AC A0A2I3HZ60.1
#=GS A0A672UUU6_STRHB/164-348    AC A0A672UUU6.1
#=GS A0A7E4S645_CIMLE/141-358    AC A0A7E4S645.1
#=GS A0A2G3C7A2_CAPCH/168-354    AC A0A2G3C7A2.1
#=GS A0A0U1LNQ0_TALIS/157-338    AC A0A0U1LNQ0.1
#=GS A0A6J2KN84_BOMMA/308-468    AC A0A6J2KN84.1
#=GS A0A667X5Z7_9TELE/194-380    AC A0A667X5Z7.1
#=GS A0A6F9BEY1_9TELE/115-219    AC A0A6F9BEY1.1
#=GS A0A452G855_CAPHI/163-345    AC A0A452G855.1
#=GS A0A369JUR4_HYPMA/156-341    AC A0A369JUR4.1
#=GS G3VLI1_SARHA/263-449        AC G3VLI1.2
#=GS A0A0E0H136_ORYNI/170-356    AC A0A0E0H136.1
#=GS A0A4U5QWZ3_POPAL/172-347    AC A0A4U5QWZ3.1
#=GS A0A3P7E673_WUCBA/114-185    AC A0A3P7E673.1
#=GS A0A261CTU6_9PELO/157-341    AC A0A261CTU6.1
#=GS A0A553P5Y4_TIGCA/302-494    AC A0A553P5Y4.1
#=GS J3L8N6_ORYBR/218-398        AC J3L8N6.1
#=GS L5K1Q2_PTEAL/307-496        AC L5K1Q2.1
#=GS A0A6P7GHU5_DIAVI/169-355    AC A0A6P7GHU5.1
#=GS A0A0F9YPK6_9MICR/110-271    AC A0A0F9YPK6.1
#=GS A0A1S3K797_LINUN/162-351    AC A0A1S3K797.1
#=GS A0A6A4WVI2_AMPAM/803-987    AC A0A6A4WVI2.1
#=GS A0A6I9JQ78_CHRAS/167-350    AC A0A6I9JQ78.1
#=GS A0A091SS99_PELCR/112-296    AC A0A091SS99.1
#=GS A0A671FUG2_RHIFE/4-150      AC A0A671FUG2.1
#=GS A0A2U1MJY9_ARTAN/220-405    AC A0A2U1MJY9.1
#=GS A0A4U1EYV4_MONMO/123-294    AC A0A4U1EYV4.1
#=GS A0A0G4H885_VITBC/176-358    AC A0A0G4H885.1
#=GS I3K1Q5_ORENI/557-754        AC I3K1Q5.2
#=GS A0A2Y9DTG2_TRIMA/200-395    AC A0A2Y9DTG2.1
#=GS A0A2K6LJS2_RHIBE/64-251     AC A0A2K6LJS2.1
#=GS F7FT98_MONDO/179-364        AC F7FT98.2
#=GS A0A177U872_9BASI/166-351    AC A0A177U872.1
#=GS A0A672YRG8_9TELE/167-351    AC A0A672YRG8.1
#=GS A0A446X338_TRITD/201-384    AC A0A446X338.1
#=GS A0A482V1T6_9CUCU/159-346    AC A0A482V1T6.1
#=GS H9F866_MACMU/59-175         AC H9F866.1
#=GS A0A6P4HV46_DROKI/161-345    AC A0A6P4HV46.1
#=GS A0A0L0HQV3_SPIPD/356-539    AC A0A0L0HQV3.1
#=GS A0A1E5VG39_9POAL/178-363    AC A0A1E5VG39.1
#=GS A0A670J218_PODMU/40-186     AC A0A670J218.1
#=GS Q7S399_NEUCR/153-334        AC Q7S399.1
#=GS A0A5E4A5K9_MARMO/185-370    AC A0A5E4A5K9.1
#=GS M7ZH58_TRIUA/122-302        AC M7ZH58.1
#=GS A0A058Z7G2_FONAL/159-338    AC A0A058Z7G2.1
#=GS A0A670IMN5_PODMU/161-341    AC A0A670IMN5.1
#=GS A0A096NTJ3_PAPAN/163-347    AC A0A096NTJ3.2
#=GS B4MY49_DROWI/534-691        AC B4MY49.2
#=GS A0A0P7B3H1_9HYPO/156-338    AC A0A0P7B3H1.1
#=GS A0A6J2RUH6_COTGO/176-328    AC A0A6J2RUH6.1
#=GS A0A453P584_AEGTS/184-351    AC A0A453P584.1
#=GS A0A2K5S911_CEBIM/163-347    AC A0A2K5S911.1
#=GS A0A668SV86_OREAU/160-359    AC A0A668SV86.1
#=GS A0A1X2GJ92_9FUNG/132-278    AC A0A1X2GJ92.1
#=GS A0A183EAY7_9BILA/97-250     AC A0A183EAY7.1
#=GS A0A1E5VKC9_9POAL/183-360    AC A0A1E5VKC9.1
#=GS A0A6J2XMS1_SITOR/523-668    AC A0A6J2XMS1.1
#=GS A0A663DMN4_AQUCH/164-348    AC A0A663DMN4.1
#=GS A0A091IKS5_CALAN/141-327    AC A0A091IKS5.1
#=GS A0A665UYD3_ECHNA/262-446    AC A0A665UYD3.1
#=GS A0A5B8MCF6_9CHLO/183-372    AC A0A5B8MCF6.1
#=GS D8M2K9_BLAHO/155-334        AC D8M2K9.1
#=GS A0A2Y9PQB7_DELLE/163-347    AC A0A2Y9PQB7.1
#=GS A0A0D2MNM5_GOSRA/227-407    AC A0A0D2MNM5.1
#=GS A0A2Y9QRH5_TRIMA/534-723    AC A0A2Y9QRH5.1
#=GS A0A3Q1GDA9_9TELE/160-354    AC A0A3Q1GDA9.1
#=GS A0A6P6P5Y3_CARAU/48-235     AC A0A6P6P5Y3.1
#=GS A0A6P6UA67_COFAR/234-440    AC A0A6P6UA67.1
#=GS A0A077S4K0_WHEAT/243-422    AC A0A077S4K0.1
#=GS A0A0P8XY41_DROAN/75-230     AC A0A0P8XY41.1
#=GS A0A7E4ULX0_PANRE/385-557    AC A0A7E4ULX0.1
#=GS A0A2F0AZJ7_ESCRO/153-265    AC A0A2F0AZJ7.1
#=GS A0A4D9DZ31_9SAUR/235-426    AC A0A4D9DZ31.1
#=GS A0A2P5FQX6_TREOI/176-346    AC A0A2P5FQX6.1
#=GS A0A091G023_9AVES/512-701    AC A0A091G023.1
#=GS A0A2A2JM66_9BILA/276-473    AC A0A2A2JM66.1
#=GS A0A0D2H8M3_9EURO/148-331    AC A0A0D2H8M3.1
#=GS E1BP97_BOVIN/180-365        AC E1BP97.1
#=GS A0A2U4BHR4_TURTR/158-305    AC A0A2U4BHR4.1
#=GS A0A0E0HLJ7_ORYNI/157-341    AC A0A0E0HLJ7.1
#=GS A0A0V0U1X0_9BILA/156-340    AC A0A0V0U1X0.1
#=GS A0A3P8WA18_CYNSE/109-281    AC A0A3P8WA18.1
#=GS A0A1A8ZCN1_9APIC/198-379    AC A0A1A8ZCN1.1
#=GS A0A0N5CUX4_THECL/25-192     AC A0A0N5CUX4.1
#=GS A0A5G2QE39_PIG/157-320      AC A0A5G2QE39.1
#=GS A0A1D1VHE6_RAMVA/302-500    AC A0A1D1VHE6.1
#=GS PDI_ARTBC/164-343           AC D4B2L8.1
#=GS A0A446X328_TRITD/201-381    AC A0A446X328.1
#=GS A0A498NFM7_LABRO/814-996    AC A0A498NFM7.1
#=GS A0A1D6PSB6_MAIZE/1-123      AC A0A1D6PSB6.1
#=GS T0JM20_COLGC/136-304        AC T0JM20.1
#=GS A0A670K1S6_PODMU/180-365    AC A0A670K1S6.1
#=GS A0A4X2JWR0_VOMUR/193-379    AC A0A4X2JWR0.1
#=GS Q2HZY3_TELCI/157-341        AC Q2HZY3.1
#=GS A0A059EH66_9MICR/1-74       AC A0A059EH66.1
#=GS A0A5A7R0N9_STRAF/258-443    AC A0A5A7R0N9.1
#=GS A0A1L8F9V5_XENLA/524-711    AC A0A1L8F9V5.1
#=GS A0A498NEK6_LABRO/176-359    AC A0A498NEK6.1
#=GS A0A4Q0A4F8_9FUNG/160-342    AC A0A4Q0A4F8.1
#=GS A0A3Q1FD84_9TELE/143-337    AC A0A3Q1FD84.1
#=GS A0A6P7KH82_9TELE/155-335    AC A0A6P7KH82.1
#=GS A0A5A7QFV6_STRAF/295-480    AC A0A5A7QFV6.1
#=GS A0A444UFU9_ACIRT/306-498    AC A0A444UFU9.1
#=GS F7VKY9_SORMK/153-334        AC F7VKY9.1
#=GS A0A6Q2Z281_ESOLU/205-385    AC A0A6Q2Z281.1
#=GS A0A2K5RGD0_CEBIM/137-325    AC A0A2K5RGD0.1
#=GS A0A195ERL3_9HYME/157-343    AC A0A195ERL3.1
#=GS A0A4V1IW28_9FUNG/250-447    AC A0A4V1IW28.1
#=GS ERP44_HUMAN/167-350         AC Q9BS26.1
#=GS ERP44_HUMAN/167-350         DR PDB; 5HQP D; 138-213;
#=GS ERP44_HUMAN/167-350         DR PDB; 5XWM D; 138-321;
#=GS ERP44_HUMAN/167-350         DR PDB; 5XWM C; 138-321;
#=GS ERP44_HUMAN/167-350         DR PDB; 2R2J A; 138-321;
#=GS ERP44_HUMAN/167-350         DR PDB; 5GU7 C; 138-321;
#=GS ERP44_HUMAN/167-350         DR PDB; 5XWM A; 138-321;
#=GS ERP44_HUMAN/167-350         DR PDB; 5GU6 A; 138-321;
#=GS ERP44_HUMAN/167-350         DR PDB; 5XWM B; 138-321;
#=GS ERP44_HUMAN/167-350         DR PDB; 5HQP C; 138-321;
#=GS A0A093II15_FULGA/148-331    AC A0A093II15.1
#=GS A0A2K5WA29_MACFA/158-338    AC A0A2K5WA29.1
#=GS A0A674DSV6_SALTR/159-342    AC A0A674DSV6.1
#=GS A0A316ZE47_9BASI/161-344    AC A0A316ZE47.1
#=GS G0QNY5_ICHMG/169-351        AC G0QNY5.1
#=GS I3J5R5_ORENI/164-348        AC I3J5R5.2
#=GS I3MH10_ICTTR/539-728        AC I3MH10.2
#=GS A0A4Q9LI03_9MICR/130-291    AC A0A4Q9LI03.1
#=GS A0A5D2TLB4_GOSMU/170-339    AC A0A5D2TLB4.1
#=GS A0A669PLE7_PHACC/171-281    AC A0A669PLE7.1
#=GS A0A6A5EG90_PERFL/307-499    AC A0A6A5EG90.1
#=GS A0A5F4WEL6_CALJA/168-348    AC A0A5F4WEL6.1
#=GS A0A6J3LC45_9HYME/604-761    AC A0A6J3LC45.1
#=GS A0A0R3SXU5_HYMDI/145-330    AC A0A0R3SXU5.1
#=GS A0A671P652_9TELE/151-346    AC A0A671P652.1
#=GS A0A5J9V114_9POAL/164-348    AC A0A5J9V114.1
#=GS A0A103XC25_CYNCS/171-356    AC A0A103XC25.1
#=GS A0A093JLJ7_EURHL/44-228     AC A0A093JLJ7.1
#=GS A0A2K5J7G6_COLAP/180-365    AC A0A2K5J7G6.1
#=GS A0A3F3PT16_9EURO/157-338    AC A0A3F3PT16.1
#=GS A0A5A9NPQ1_9TELE/526-716    AC A0A5A9NPQ1.1
#=GS A0A0C2G8G3_9BILA/7-159      AC A0A0C2G8G3.1
#=GS A0A0J9Y4R8_BRUMA/119-286    AC A0A0J9Y4R8.1
#=GS A0A423VLN7_9PEZI/162-345    AC A0A423VLN7.1
#=GS R4XF06_TAPDE/390-517        AC R4XF06.1
#=GS A0A6J2M858_9CHIR/162-346    AC A0A6J2M858.1
#=GS A0A2K5DRY0_AOTNA/116-289    AC A0A2K5DRY0.1
#=GS I1KAB7_SOYBN/170-356        AC I1KAB7.1
#=GS A0A2U9AY80_SCOMX/168-351    AC A0A2U9AY80.1
#=GS A0A2I0S2T2_9PEZI/150-334    AC A0A2I0S2T2.1
#=GS A0A6P6XY75_DERPT/183-373    AC A0A6P6XY75.1
#=GS Q9SBN2_VOLCA/181-367        AC Q9SBN2.1
#=GS A0A2U9CKC6_SCOMX/155-335    AC A0A2U9CKC6.1
#=GS A0A6I8NQT1_ORNAN/232-412    AC A0A6I8NQT1.1
#=GS A0A2I4BBJ7_9TELE/288-481    AC A0A2I4BBJ7.1
#=GS D7FM90_ECTSI/160-345        AC D7FM90.1
#=GS A0A6A3CVM5_HIBSY/171-356    AC A0A6A3CVM5.1
#=GS M1BHF1_SOLTU/171-356        AC M1BHF1.1
#=GS L5JTX5_PTEAL/205-320        AC L5JTX5.1
#=GS A0A673VPN9_SURSU/163-347    AC A0A673VPN9.1
#=GS A0A6I9JKJ7_CHRAS/204-358    AC A0A6I9JKJ7.1
#=GS A0A2Y9KSU3_ENHLU/180-365    AC A0A2Y9KSU3.1
#=GS A0A1Y2VFQ2_9PEZI/149-320    AC A0A1Y2VFQ2.1
#=GS A0A2K2AIB0_POPTR/168-353    AC A0A2K2AIB0.1
#=GS A0A6G0TDV2_APHGL/156-342    AC A0A6G0TDV2.1
#=GS A0A3P9N1C3_POERE/130-297    AC A0A3P9N1C3.1
#=GS A0A2A2KEQ5_9BILA/157-341    AC A0A2A2KEQ5.1
#=GS A0A2Z7BSI2_9LAMI/196-366    AC A0A2Z7BSI2.1
#=GS A0A4W5N3S6_9TELE/160-350    AC A0A4W5N3S6.1
#=GS F7E4L7_MONDO/163-358        AC F7E4L7.2
#=GS A0A6I8VG84_DROPS/161-346    AC A0A6I8VG84.1
#=GS A0A6J1NZI3_BICAN/711-835    AC A0A6J1NZI3.1
#=GS A0A7M7H788_NASVI/549-707    AC A0A7M7H788.1
#=GS A0A1U7TCB9_CARSF/167-350    AC A0A1U7TCB9.1
#=GS A0A4U1FMR3_MONMO/667-859    AC A0A4U1FMR3.1
#=GS A0A195EEY5_9HYME/157-343    AC A0A195EEY5.1
#=GS A0A091JVM0_COLST/78-273     AC A0A091JVM0.1
#=GS A0A2R6W8U2_MARPO/271-456    AC A0A2R6W8U2.1
#=GS A0A1W4W2X2_AGRPL/504-659    AC A0A1W4W2X2.1
#=GS A0A673Y918_SALTR/125-316    AC A0A673Y918.1
#=GS A0A423W984_9PEZI/153-334    AC A0A423W984.1
#=GS A0A166K213_9AGAM/114-297    AC A0A166K213.1
#=GS A0A1D2VBI9_9ASCO/167-353    AC A0A1D2VBI9.1
#=GS U3IS54_ANAPP/159-354        AC U3IS54.2
#=GS A0A6P6XZB4_DERPT/185-370    AC A0A6P6XZB4.1
#=GS A0A6Q2XS69_ESOLU/210-319    AC A0A6Q2XS69.1
#=GS A0A672RRR6_SINGR/152-341    AC A0A672RRR6.1
#=GS A0A151XHR9_9HYME/151-353    AC A0A151XHR9.1
#=GS E2R947_CANLF/178-268        AC E2R947.3
#=GS A0A1S2XY74_CICAR/169-348    AC A0A1S2XY74.1
#=GS X6M9N0_RETFI/170-317        AC X6M9N0.1
#=GS A0A3Q0EBB0_CARSF/69-179     AC A0A3Q0EBB0.1
#=GS A0A6I8S091_XENTR/484-671    AC A0A6I8S091.1
#=GS A0CHN0_PARTE/159-342        AC A0CHN0.1
#=GS A0A437DN67_ORYJA/85-271     AC A0A437DN67.1
#=GS A0A484D8T8_PERFV/168-351    AC A0A484D8T8.1
#=GS A0A2Y9KFU7_ENHLU/180-367    AC A0A2Y9KFU7.1
#=GS A0A226PNU5_COLVI/167-351    AC A0A226PNU5.1
#=GS A0A094AHY1_9PEZI/153-334    AC A0A094AHY1.1
#=GS W5MDR5_LEPOC/179-362        AC W5MDR5.1
#=GS A0A6I8TQV2_AEDAE/165-355    AC A0A6I8TQV2.1
#=GS A0A3P9BZ16_9CICH/164-348    AC A0A3P9BZ16.1
#=GS A0A665TQ06_ECHNA/405-602    AC A0A665TQ06.1
#=GS L5KIF9_PTEAL/157-315        AC L5KIF9.1
#=GS A0A1V1T5A4_9FUNG/157-338    AC A0A1V1T5A4.1
#=GS A0A151WTY0_9HYME/359-519    AC A0A151WTY0.1
#=GS A0A0E0PTX2_ORYRU/202-386    AC A0A0E0PTX2.1
#=GS A0A0V0YJC7_TRIPS/156-340    AC A0A0V0YJC7.1
#=GS F1PIX5_CANLF/158-338        AC F1PIX5.2
#=GS A0A2J6LRP0_LACSA/224-404    AC A0A2J6LRP0.1
#=GS A0A4Z2ECZ1_9TELE/1-121      AC A0A4Z2ECZ1.1
#=GS A0A5G2QN66_PIG/161-345      AC A0A5G2QN66.1
#=GS A0A6A4WNU0_AMPAM/142-286    AC A0A6A4WNU0.1
#=GS A0A0B7NET4_9FUNG/312-487    AC A0A0B7NET4.1
#=GS A0A6J0UVK6_9SAUR/255-370    AC A0A6J0UVK6.1
#=GS G9NW38_HYPAI/154-335        AC G9NW38.1
#=GS A0A671S170_9TELE/118-284    AC A0A671S170.1
#=GS I1H0R3_BRADI/203-387        AC I1H0R3.1
#=GS A0A2P4SK03_BAMTH/4-111      AC A0A2P4SK03.1
#=GS A0A2G8LM02_STIJA/152-238    AC A0A2G8LM02.1
#=GS A0A341ARH5_NEOAA/192-307    AC A0A341ARH5.1
#=GS A0A663LQU0_ATHCN/459-645    AC A0A663LQU0.1
#=GS A0A6J3J5D5_SAPAP/17-197     AC A0A6J3J5D5.1
#=GS K7DKH1_PANTR/233-424        AC K7DKH1.1
#=GS R0KTN7_NOSB1/97-263         AC R0KTN7.1
#=GS A0A6P6TPI6_COFAR/190-370    AC A0A6P6TPI6.1
#=GS A0A670JMG2_PODMU/105-288    AC A0A670JMG2.1
#=GS A0A1L7XIS1_9HELO/193-303    AC A0A1L7XIS1.1
#=GS A0A6J2ILN8_9PASS/549-738    AC A0A6J2ILN8.2
#=GS A0A7N8X1Z2_9TELE/159-342    AC A0A7N8X1Z2.1
#=GS A0A6J3LEB2_9HYME/1600-1763  AC A0A6J3LEB2.1
#=GS A0A5B1QBL5_9AGAM/156-341    AC A0A5B1QBL5.1
#=GS A0A7R5KQC8_9PASS/172-357    AC A0A7R5KQC8.1
#=GS A0A5N7D1X2_9EURO/161-342    AC A0A5N7D1X2.1
#=GS A0A3P7E3H6_WUCBA/193-394    AC A0A3P7E3H6.1
#=GS A0A151ZD42_9MYCE/170-345    AC A0A151ZD42.1
#=GS I1BVC6_RHIO9/361-541        AC I1BVC6.1
#=GS A0A6P3XSJ5_DINQU/157-343    AC A0A6P3XSJ5.1
#=GS A0A5A9N465_9TELE/239-422    AC A0A5A9N465.1
#=GS A0A0C3E566_9AGAM/161-345    AC A0A0C3E566.1
#=GS A0A226P5T4_COLVI/115-301    AC A0A226P5T4.1
#=GS A0A673ZQ12_SALTR/535-729    AC A0A673ZQ12.1
#=GS A0A2U9BVT4_SCOMX/149-344    AC A0A2U9BVT4.1
#=GS A0A671XW79_SPAAU/114-287    AC A0A671XW79.1
#=GS A0A0N4T0Q9_BRUPA/161-352    AC A0A0N4T0Q9.1
#=GS A0A6P6N8I2_CARAU/149-329    AC A0A6P6N8I2.1
#=GS A0A6J2PBZ5_COTGO/184-288    AC A0A6J2PBZ5.1
#=GS A0A6I8VRC5_DROPS/531-688    AC A0A6I8VRC5.1
#=GS A0A452RLB2_URSAM/179-267    AC A0A452RLB2.1
#=GS W5PMM5_SHEEP/166-349        AC W5PMM5.1
#=GS F6WMN4_HORSE/59-175         AC F6WMN4.3
#=GS A0A6P6XZ53_DERPT/283-480    AC A0A6P6XZ53.1
#=GS A0A0V0VMT6_9BILA/394-578    AC A0A0V0VMT6.1
#=GS D7U0H4_VITVI/213-398        AC D7U0H4.1
#=GS A0A2Y9IXK5_ENHLU/64-251     AC A0A2Y9IXK5.1
#=GS A0A672KGR1_SINGR/152-346    AC A0A672KGR1.1
#=GS A0A178B9Y9_9PLEO/141-329    AC A0A178B9Y9.1
#=GS A0A3Q3EHU2_9LABR/209-395    AC A0A3Q3EHU2.1
#=GS A0A250WRK6_9CHLO/174-360    AC A0A250WRK6.1
#=GS A0A087TAQ7_STEMI/163-350    AC A0A087TAQ7.1
#=GS A0A672H0N3_SALFA/176-360    AC A0A672H0N3.1
#=GS A0A674MSI0_TAKRU/152-333    AC A0A674MSI0.1
#=GS A0A0C3SEJ1_PHLGI/316-492    AC A0A0C3SEJ1.1
#=GS C3Z6N3_BRAFL/158-342        AC C3Z6N3.1
#=GS A0A453C0R9_AEGTS/1-191      AC A0A453C0R9.1
#=GS A0A1D5QD93_MACMU/178-365    AC A0A1D5QD93.2
#=GS A0A3Q4HL15_NEOBR/137-320    AC A0A3Q4HL15.1
#=GS A0A4X3P006_PRIPA/157-360    AC A0A4X3P006.1
#=GS A0A7F8QGF9_LEPWE/17-197     AC A0A7F8QGF9.1
#=GS A0A218UHH0_9PASE/546-735    AC A0A218UHH0.1
#=GS A0A2K3Q8V7_9HYPO/217-398    AC A0A2K3Q8V7.1
#=GS A0A1B8EYS7_9PEZI/382-532    AC A0A1B8EYS7.1
#=GS A0A094NCM3_ANTCR/107-292    AC A0A094NCM3.1
#=GS A0A060X8X2_ONCMY/158-352    AC A0A060X8X2.1
#=GS A0A553P3D3_TIGCA/217-400    AC A0A553P3D3.1
#=GS A0A0N5D0Q1_THECL/134-316    AC A0A0N5D0Q1.1
#=GS A0A3P7MJA3_ONCOC/26-190     AC A0A3P7MJA3.1
#=GS A0A5E4CPC1_MARMO/64-251     AC A0A5E4CPC1.1
#=GS A0A5E4MCM6_9HEMI/156-342    AC A0A5E4MCM6.1
#=GS A0A673ZF72_SALTR/149-344    AC A0A673ZF72.1
#=GS Q7Z0N9_PARTE/155-339        AC Q7Z0N9.1
#=GS A0A6I9NTM0_9TELE/168-351    AC A0A6I9NTM0.1
#=GS E2BE86_HARSA/485-644        AC E2BE86.1
#=GS Q9VXI3_DROME/134-320        AC Q9VXI3.1
#=GS A0A232M6K6_9EURO/157-338    AC A0A232M6K6.1
#=GS A0A504Y8F4_FASGI/77-257     AC A0A504Y8F4.1
#=GS A0A6P6CG76_PTEVA/236-351    AC A0A6P6CG76.1
#=GS G3X3P9_SARHA/179-364        AC G3X3P9.1
#=GS A0A0E0DEI2_9ORYZ/170-354    AC A0A0E0DEI2.1
#=GS G0N5D8_CAEBE/281-478        AC G0N5D8.1
#=GS A0A4W4EJL6_ELEEL/167-339    AC A0A4W4EJL6.1
#=GS A0A2I4EP21_JUGRE/177-352    AC A0A2I4EP21.1
#=GS A0A287WGA8_HORVV/1-88       AC A0A287WGA8.1
#=GS A0A4W6FXA9_LATCA/161-354    AC A0A4W6FXA9.1
#=GS A0A1G4JZ33_9SACH/171-352    AC A0A1G4JZ33.1
#=GS A0A0D3GD65_9ORYZ/204-388    AC A0A0D3GD65.1
#=GS A0A197K215_9FUNG/158-334    AC A0A197K215.1
#=GS M3Y1V8_MUSPF/534-723        AC M3Y1V8.1
#=GS A0A482SI19_9ARCH/4-177      AC A0A482SI19.1
#=GS A0A6J0BDE7_NEOLC/153-346    AC A0A6J0BDE7.1
#=GS A0A3Q2X2N7_HAPBU/159-353    AC A0A3Q2X2N7.1
#=GS B4KW57_DROMO/154-351        AC B4KW57.1
#=GS A0A1Y3B181_EURMA/1-103      AC A0A1Y3B181.1
#=GS A0A445K845_GLYSO/170-356    AC A0A445K845.1
#=GS A0A3L8SGY0_CHLGU/191-377    AC A0A3L8SGY0.1
#=GS A0A673Y8K1_SALTR/113-300    AC A0A673Y8K1.1
#=GS B3M733_DROAN/161-345        AC B3M733.1
#=GS A0A6P6R2R5_CARAU/167-350    AC A0A6P6R2R5.1
#=GS A0A2H5NE75_CITUN/231-413    AC A0A2H5NE75.1
#=GS D3BP03_POLPP/170-352        AC D3BP03.1
#=GS K7FW01_PELSI/550-725        AC K7FW01.1
#=GS A0A0K9Q036_ZOSMR/213-401    AC A0A0K9Q036.1
#=GS A0A0D2TWN3_GOSRA/169-354    AC A0A0D2TWN3.1
#=GS A0A287TFR5_HORVV/27-139     AC A0A287TFR5.1
#=GS A0A2F0AVA2_ESCRO/63-119     AC A0A2F0AVA2.1
#=GS Q175U4_AEDAE/148-345        AC Q175U4.1
#=GS A0A4W3JX25_CALMI/156-339    AC A0A4W3JX25.1
#=GS A0A1V4K257_PATFA/255-370    AC A0A1V4K257.1
#=GS A0A158Q969_ENTVE/158-330    AC A0A158Q969.1
#=GS A0A178DWG9_9PLEO/380-512    AC A0A178DWG9.1
#=GS U3BGX9_CALJA/235-426        AC U3BGX9.1
#=GS A0A2I3N9L1_PAPAN/119-303    AC A0A2I3N9L1.1
#=GS A0A3P8WZ65_CYNSE/155-335    AC A0A3P8WZ65.1
#=GS A0A287VSC1_HORVV/171-355    AC A0A287VSC1.1
#=GS A0A669PDL4_PHACC/309-500    AC A0A669PDL4.1
#=GS A0A287VRV4_HORVV/171-355    AC A0A287VRV4.1
#=GS A0A6I9LYB8_PERMB/164-345    AC A0A6I9LYB8.1
#=GS U6LP74_9EIME/166-337        AC U6LP74.1
#=GS A0A6P8YRD3_THRPL/193-390    AC A0A6P8YRD3.1
#=GS A0A672F955_SALFA/152-340    AC A0A672F955.1
#=GS A0A158Q529_DRAME/122-307    AC A0A158Q529.1
#=GS A0A140LI41_MOUSE/8-102      AC A0A140LI41.1
#=GS A0A2T2NB27_CORCC/150-331    AC A0A2T2NB27.1
#=GS A0A2U3UYG5_TURTR/163-347    AC A0A2U3UYG5.2
#=GS B4MYN2_DROWI/158-343        AC B4MYN2.1
#=GS A0A6A1QBM6_BALPH/63-113     AC A0A6A1QBM6.1
#=GS A0A166VS55_9AGAM/156-341    AC A0A166VS55.1
#=GS A0A0G4ISS0_PLABS/196-380    AC A0A0G4ISS0.1
#=GS M0ZYC1_SOLTU/165-348        AC M0ZYC1.1
#=GS A0A2R6RDG0_ACTCC/168-354    AC A0A2R6RDG0.1
#=GS A0A261BJ45_9PELO/392-561    AC A0A261BJ45.1
#=GS A0A016UVV1_9BILA/314-511    AC A0A016UVV1.1
#=GS A0A7N4P1Z6_SARHA/167-350    AC A0A7N4P1Z6.1
#=GS B9PM19_TOXGV/224-424        AC B9PM19.1
#=GS A0A0E0FMQ0_ORYNI/192-367    AC A0A0E0FMQ0.1
#=GS A0A077ZWN7_STYLE/161-349    AC A0A077ZWN7.1
#=GS A0A091QTE4_MERNU/412-601    AC A0A091QTE4.1
#=GS A0A0V1NVW0_9BILA/279-476    AC A0A0V1NVW0.1
#=GS A0A5N5Q6I0_PANHP/153-347    AC A0A5N5Q6I0.1
#=GS A0A667Y0K0_9TELE/200-383    AC A0A667Y0K0.1
#=GS A0A672RR97_SINGR/152-346    AC A0A672RR97.1
#=GS A0A1V6XZH5_PENNA/162-343    AC A0A1V6XZH5.1
#=GS A0A6P7K1D4_9TELE/156-336    AC A0A6P7K1D4.1
#=GS J9JJ80_ACYPI/164-350        AC J9JJ80.1
#=GS H2RN65_TAKRU/158-352        AC H2RN65.3
#=GS A0A498LFD6_LABRO/2421-2613  AC A0A498LFD6.1
#=GS A0A2R6XRT7_MARPO/177-365    AC A0A2R6XRT7.1
#=GS G3Q2E2_GASAC/159-343        AC G3Q2E2.1
#=GS A0A671S2B3_9TELE/118-284    AC A0A671S2B3.1
#=GS A0A6I9IMZ3_VICPA/214-329    AC A0A6I9IMZ3.1
#=GS C5LJJ4_PERM5/8-130          AC C5LJJ4.1
#=GS A0A397TPC9_9GLOM/311-486    AC A0A397TPC9.1
#=GS A0A1S8W248_9FUNG/169-344    AC A0A1S8W248.1
#=GS M1B3K5_SOLTU/157-340        AC M1B3K5.1
#=GS A0A3S3N5Q3_9MAGN/191-299    AC A0A3S3N5Q3.1
#=GS A0A663M649_ATHCN/29-213     AC A0A663M649.1
#=GS A0A6A5BIU3_NAEFO/178-256    AC A0A6A5BIU3.1
#=GS B4GUE5_DROPE/158-342        AC B4GUE5.1
#=GS E2AH19_CAMFO/519-682        AC E2AH19.1
#=GS A0A504YYD5_FASGI/152-337    AC A0A504YYD5.1
#=GS A0A5N5P324_9ROSI/214-399    AC A0A5N5P324.1
#=GS A0A5N5GCY3_9ROSA/214-399    AC A0A5N5GCY3.1
#=GS A0A669EM41_ORENI/151-339    AC A0A669EM41.1
#=GS A0A1S2XEP3_CICAR/209-394    AC A0A1S2XEP3.1
#=GS A0A2I3H2C8_NOMLE/64-251     AC A0A2I3H2C8.1
#=GS A0A5J9TSW1_9POAL/172-359    AC A0A5J9TSW1.1
#=GS A0A2I2F4L1_9EURO/161-342    AC A0A2I2F4L1.1
#=GS A0A1A0HEL6_9ASCO/209-371    AC A0A1A0HEL6.1
#=GS A0A0V1MR00_9BILA/177-361    AC A0A0V1MR00.1
#=GS A0A6P9CPX0_PANGU/158-339    AC A0A6P9CPX0.1
#=GS A0A0R3RB92_9BILA/25-192     AC A0A0R3RB92.1
#=GS A0A673Y4C0_SALTR/149-344    AC A0A673Y4C0.1
#=GS A0A3Q7TMY8_VULVU/534-723    AC A0A3Q7TMY8.1
#=GS A0A7E4V3C4_PANRE/163-343    AC A0A7E4V3C4.1
#=GS A0A2Y9H9N6_NEOSC/311-503    AC A0A2Y9H9N6.1
#=GS A0A1Y3N962_PIRSE/808-998    AC A0A1Y3N962.1
#=GS A0A6P6YDG2_DERPT/162-348    AC A0A6P6YDG2.1
#=GS A0A0E0H107_ORYNI/189-361    AC A0A0E0H107.1
#=GS W9WZH0_9EURO/153-333        AC W9WZH0.1
#=GS A0A553R7A4_9TELE/231-411    AC A0A553R7A4.1
#=GS A0A0V1GZ78_9BILA/773-963    AC A0A0V1GZ78.1
#=GS A0A674DW00_SALTR/297-489    AC A0A674DW00.1
#=GS A0A665X5G9_ECHNA/150-339    AC A0A665X5G9.1
#=GS A0A4X2LLG1_VOMUR/515-704    AC A0A4X2LLG1.1
#=GS A0A6S7NS49_LACSI/179-363    AC A0A6S7NS49.1
#=GS N1J7Y7_BLUG1/176-348        AC N1J7Y7.1
#=GS G7IRR6_MEDTR/215-395        AC G7IRR6.1
#=GS A0A0D3D1E1_BRAOL/168-352    AC A0A0D3D1E1.1
#=GS A0A1L0DW35_9ASCO/179-370    AC A0A1L0DW35.1
#=GS A0A7N6AFI5_ANATE/159-343    AC A0A7N6AFI5.1
#=GS Q0U7L3_PHANO/150-331        AC Q0U7L3.1
#=GS A0A0V0RHQ8_9BILA/672-861    AC A0A0V0RHQ8.1
#=GS A0A061J826_TRYRA/1-120      AC A0A061J826.1
#=GS A0A5B7FDH4_PORTR/161-345    AC A0A5B7FDH4.1
#=GS B6AEA0_CRYMR/221-430        AC B6AEA0.1
#=GS A0A6J0AD86_VICPA/127-311    AC A0A6J0AD86.1
#=GS A0A093QTY0_9PASS/124-293    AC A0A093QTY0.1
#=GS A0A024TIU8_9STRA/173-340    AC A0A024TIU8.1
#=GS G3B0N1_CANTC/169-364        AC G3B0N1.1
#=GS C5KLL5_PERM5/54-228         AC C5KLL5.1
#=GS Q0U657_PHANO/404-518        AC Q0U657.1
#=GS A0A6J1P5Z4_BICAN/159-344    AC A0A6J1P5Z4.1
#=GS PDI_YEAST/166-341           AC P17967.2
#=GS PDI_YEAST/166-341           DR PDB; 3BOA A; 166-341;
#=GS PDI_YEAST/166-341           DR PDB; 2B5E A; 166-341;
#=GS A0A2P6TPB0_CHLSO/176-320    AC A0A2P6TPB0.1
#=GS A0A663F140_AQUCH/158-338    AC A0A663F140.1
#=GS A0A672R6B1_SINGR/167-350    AC A0A672R6B1.1
#=GS A0A2A4IUY4_HELVI/247-408    AC A0A2A4IUY4.1
#=GS A0A0N4TXT6_BRUPA/119-286    AC A0A0N4TXT6.1
#=GS K7G7T7_PELSI/314-505        AC K7G7T7.1
#=GS A0A6J5U8S1_PRUAR/212-397    AC A0A6J5U8S1.1
#=GS A0A6J0X2K3_ODOVR/60-247     AC A0A6J0X2K3.1
#=GS A0A674HEA6_TAEGU/606-795    AC A0A674HEA6.1
#=GS A0A453MNV4_AEGTS/89-270     AC A0A453MNV4.1
#=GS H3BIM7_LATCH/536-723        AC H3BIM7.1
#=GS R4G8E4_RHOPR/46-234         AC R4G8E4.1
#=GS A0A6P4FVR7_DRORH/80-218     AC A0A6P4FVR7.1
#=GS PDILT_HUMAN/180-365         AC Q8N807.2
#=GS PDILT_HUMAN/180-365         DR PDB; 4NWY D; 258-365;
#=GS PDILT_HUMAN/180-365         DR PDB; 5XF7 A; 180-365;
#=GS PDILT_HUMAN/180-365         DR PDB; 4NWY C; 258-365;
#=GS PDILT_HUMAN/180-365         DR PDB; 4NWY B; 258-365;
#=GS PDILT_HUMAN/180-365         DR PDB; 4NWY A; 258-365;
#=GS A0A5N6PDY3_9ASTR/170-346    AC A0A5N6PDY3.1
#=GS A0A3L8S1I5_CHLGU/161-356    AC A0A3L8S1I5.1
#=GS A0A5C6PLS3_9TELE/148-331    AC A0A5C6PLS3.1
#=GS A0A2K6RLF9_RHIRO/303-495    AC A0A2K6RLF9.1
#=GS A0A6Q2XS75_ESOLU/159-342    AC A0A6Q2XS75.1
#=GS A0A0C2X1M6_AMAMU/155-340    AC A0A0C2X1M6.1
#=GS A0A1J1H640_PLARL/162-341    AC A0A1J1H640.1
#=GS G9MI10_HYPVG/154-335        AC G9MI10.1
#=GS A0A1U7U900_CARSF/312-504    AC A0A1U7U900.1
#=GS A0A671TM79_SPAAU/121-305    AC A0A671TM79.1
#=GS F0YFS6_AURAN/107-301        AC F0YFS6.1
#=GS A8NXM1_COPC7/153-338        AC A8NXM1.1
#=GS A0A671MB42_9TELE/156-328    AC A0A671MB42.1
#=GS A0A4W6E0L4_LATCA/155-335    AC A0A4W6E0L4.1
#=GS A0A093IF74_DRYPU/112-296    AC A0A093IF74.1
#=GS M3W9X1_FELCA/312-504        AC M3W9X1.3
#=GS A0A093FPI3_TYTAL/107-292    AC A0A093FPI3.1
#=GS A0A2K6SVR8_SAIBB/112-296    AC A0A2K6SVR8.1
#=GS A0A670YQP5_PSETE/60-175     AC A0A670YQP5.1
#=GS L8IZL4_9CETA/190-305        AC L8IZL4.1
#=GS A0A3M0J5J2_HIRRU/161-356    AC A0A3M0J5J2.1
#=GS F6WYW5_CIOIN/167-352        AC F6WYW5.2
#=GS A0A5F5XHM1_FELCA/225-388    AC A0A5F5XHM1.1
#=GS A0A5C3EMV1_9BASI/470-634    AC A0A5C3EMV1.1
#=GS S3DC94_GLAL2/152-333        AC S3DC94.1
#=GS A0A6G1QM03_9TELE/308-499    AC A0A6G1QM03.1
#=GS V8P4R3_OPHHA/188-316        AC V8P4R3.1
#=GS A0A384CK30_URSMA/180-365    AC A0A384CK30.1
#=GS A0A2P6NB58_9EUKA/589-775    AC A0A2P6NB58.1
#=GS A0A0B1SLF2_OESDE/62-244     AC A0A0B1SLF2.1
#=GS A0A091WF24_NIPNI/281-472    AC A0A091WF24.1
#=GS A0A261AV62_9PELO/157-341    AC A0A261AV62.1
#=GS A0A6P3Q2R1_PTEVA/222-337    AC A0A6P3Q2R1.1
#=GS A0A493TYB5_ANAPP/43-158     AC A0A493TYB5.1
#=GS A0A674CRR4_SALTR/150-344    AC A0A674CRR4.1
#=GS A0A484DNQ0_PERFV/427-613    AC A0A484DNQ0.1
#=GS A0A1A8W0G1_9APIC/198-379    AC A0A1A8W0G1.1
#=GS R0KBX6_ANAPL/282-473        AC R0KBX6.1
#=GS A0A0D0BTN6_9AGAM/160-342    AC A0A0D0BTN6.1
#=GS A0A433TMM9_ELYCH/82-277     AC A0A433TMM9.1
#=GS A0A1U8LAB3_GOSHI/169-354    AC A0A1U8LAB3.1
#=GS A0A5B6U9U8_9ROSI/188-368    AC A0A5B6U9U8.1
#=GS A0A1I8IGN6_9PLAT/155-343    AC A0A1I8IGN6.1
#=GS A0A5N5NQS0_9ROSI/167-358    AC A0A5N5NQS0.1
#=GS A0A6A5NFL3_LUPAL/246-431    AC A0A6A5NFL3.1
#=GS N1RBX3_FUSC4/145-319        AC N1RBX3.1
#=GS A0A0M3QUI7_DROBS/158-343    AC A0A0M3QUI7.1
#=GS A0A2F0BJA5_ESCRO/1-140      AC A0A2F0BJA5.1
#=GS B4KKP5_DROMO/182-371        AC B4KKP5.2
#=GS A0A673JMV3_9TELE/150-345    AC A0A673JMV3.1
#=GS A0A5N5KS22_PANHP/177-359    AC A0A5N5KS22.1
#=GS A0A1R3FWT9_COCAP/173-350    AC A0A1R3FWT9.1
#=GS I3J5R8_ORENI/205-391        AC I3J5R8.1
#=GS Q0UT27_PHANO/80-226         AC Q0UT27.2
#=GS A0A1Y1NL94_PHOPY/168-354    AC A0A1Y1NL94.1
#=GS A0A2K5DQV6_AOTNA/223-407    AC A0A2K5DQV6.1
#=GS A0A2K6DBL7_MACNE/9-171      AC A0A2K6DBL7.1
#=GS A0A0G4MQD8_9PEZI/1-98       AC A0A0G4MQD8.1
#=GS A0A5N5MQI9_9ROSI/167-255    AC A0A5N5MQI9.1
#=GS A0A267H926_9PLAT/163-351    AC A0A267H926.1
#=GS U6MXT6_9EIME/572-751        AC U6MXT6.1
#=GS A0A4Y7T429_9AGAR/298-455    AC A0A4Y7T429.1
#=GS A0A423VJV7_9PEZI/153-334    AC A0A423VJV7.1
#=GS A0A2T7F0K0_9POAL/229-407    AC A0A2T7F0K0.1
#=GS A0A6J3LC45_9HYME/1566-1728  AC A0A6J3LC45.1
#=GS A0A3B3HIL9_ORYLA/216-321    AC A0A3B3HIL9.1
#=GS A0A6P5A8R1_BRABE/165-348    AC A0A6P5A8R1.1
#=GS A0A670KDD3_PODMU/151-346    AC A0A670KDD3.1
#=GS A0A2P6QWG1_ROSCH/1-83       AC A0A2P6QWG1.1
#=GS A0A395MAN8_9HYPO/148-314    AC A0A395MAN8.1
#=GS A0A6P7GPH8_DIAVI/158-344    AC A0A6P7GPH8.1
#=GS A0A444Y833_ARAHY/234-414    AC A0A444Y833.1
#=GS R0KWN1_ANAPL/1-142          AC R0KWN1.1
#=GS A0A7M7RAP6_APIME/170-372    AC A0A7M7RAP6.1
#=GS A0A671P4W8_9TELE/158-353    AC A0A671P4W8.1
#=GS A0A4D9EIU1_9SAUR/164-344    AC A0A4D9EIU1.1
#=GS A0A6J2T1Z1_DROLE/726-857    AC A0A6J2T1Z1.1
#=GS A0A3Q1I1Y2_ANATE/159-341    AC A0A3Q1I1Y2.2
#=GS A0A6J0XS47_ODOVR/89-269     AC A0A6J0XS47.1
#=GS A0A2G5FAG3_AQUCA/215-400    AC A0A2G5FAG3.1
#=GS A0A167QN61_CALVF/159-344    AC A0A167QN61.1
#=GS A0A2H3IHI7_9EURO/146-309    AC A0A2H3IHI7.1
#=GS A0A3Q2CQ94_CYPVA/138-331    AC A0A3Q2CQ94.1
#=GS A0A445EWZ5_ARAHY/147-351    AC A0A445EWZ5.1
#=GS A0A0C3DSS4_9PEZI/85-265     AC A0A0C3DSS4.1
#=GS M4AF75_XIPMA/149-342        AC M4AF75.1
#=GS A0A075AXE6_ROZAC/141-320    AC A0A075AXE6.1
#=GS A0A672FAK1_SALFA/149-344    AC A0A672FAK1.1
#=GS A0A5P1EXS5_ASPOF/234-414    AC A0A5P1EXS5.1
#=GS A0A0Q3R777_AMAAE/60-244     AC A0A0Q3R777.1
#=GS A0A4V4H786_MUSBA/205-390    AC A0A4V4H786.1
#=GS A0A0V0SLZ7_9BILA/253-324    AC A0A0V0SLZ7.1
#=GS A0A6P5IFQ8_PHACI/212-397    AC A0A6P5IFQ8.1
#=GS A0A6P6HFQ9_PUMCO/160-355    AC A0A6P6HFQ9.1
#=GS A0A4U0V4Q5_9PEZI/157-328    AC A0A4U0V4Q5.1
#=GS F7BSY3_XENTR/344-536        AC F7BSY3.4
#=GS A0A674AE40_SALTR/152-333    AC A0A674AE40.1
#=GS A0A2K5Z5Q3_MANLE/180-365    AC A0A2K5Z5Q3.1
#=GS A0A6A6MZE7_HEVBR/279-367    AC A0A6A6MZE7.1
#=GS A0A493TDB9_ANAPP/86-249     AC A0A493TDB9.1
#=GS A0A0A1NFL0_RHIZD/152-334    AC A0A0A1NFL0.1
#=GS A0A6I9KG04_CHRAS/183-369    AC A0A6I9KG04.1
#=GS Q5AW94_EMENI/161-342        AC Q5AW94.1
#=GS H2ZN95_CIOSA/140-325        AC H2ZN95.1
#=GS A0A0M9G4E8_9TRYP/151-331    AC A0A0M9G4E8.1
#=GS A0A401SAH9_CHIPU/515-706    AC A0A401SAH9.1
#=GS A0A091WLL7_OPIHO/148-331    AC A0A091WLL7.1
#=GS A0A1L8GPC1_XENLA/60-247     AC A0A1L8GPC1.1
#=GS A0A6P3WQR1_DINQU/566-726    AC A0A6P3WQR1.1
#=GS A0A673Y4A0_SALTR/149-334    AC A0A673Y4A0.1
#=GS A0A0A2JIT7_PENEN/162-343    AC A0A0A2JIT7.1
#=GS A0A099Z8P3_TINGU/200-315    AC A0A099Z8P3.1
#=GS A7ECC8_SCLS1/152-333        AC A7ECC8.1
#=GS J4G0R1_9APHY/326-495        AC J4G0R1.1
#=GS A0A3P7DU05_WUCBA/315-483    AC A0A3P7DU05.1
#=GS A0A6P7MP79_BETSP/159-343    AC A0A6P7MP79.1
#=GS A6QL97_BOVIN/158-338        AC A6QL97.1
#=GS I2GVZ5_TETBL/168-357        AC I2GVZ5.1
#=GS A0A1D6PSC1_MAIZE/1-87       AC A0A1D6PSC1.1
#=GS I3L4M2_HUMAN/161-345        AC I3L4M2.2
#=GS A0A401GBD2_9APHY/163-344    AC A0A401GBD2.1
#=GS A0A0B4KHU4_DROME/60-232     AC A0A0B4KHU4.1
#=GS A0A0J7L6A5_LASNI/161-345    AC A0A0J7L6A5.1
#=GS A0A5B0M0E6_PUCGR/161-345    AC A0A5B0M0E6.1
#=GS A0A6D2I9C8_9BRAS/178-350    AC A0A6D2I9C8.1
#=GS K7LX68_SOYBN/169-354        AC K7LX68.1
#=GS A0A2B7YDW7_9EURO/160-341    AC A0A2B7YDW7.1
#=GS A0A6P8VUW0_GYMAC/149-344    AC A0A6P8VUW0.1
#=GS A0A673HEN2_9TELE/193-380    AC A0A673HEN2.1
#=GS H3D9F6_TETNG/164-348        AC H3D9F6.1
#=GS A0A367LAN3_9HYPO/156-337    AC A0A367LAN3.1
#=GS A0A423TW07_PENVA/348-538    AC A0A423TW07.1
#=GS W2PGM1_PHYPN/179-347        AC W2PGM1.1
#=GS A0A444UMM9_ACIRT/90-274     AC A0A444UMM9.1
#=GS A0A3P9N572_POERE/159-342    AC A0A3P9N572.1
#=GS M5W6Y1_PRUPE/227-408        AC M5W6Y1.1
#=GS A0A433DL62_9FUNG/154-334    AC A0A433DL62.1
#=GS F7H0K4_CALJA/167-350        AC F7H0K4.1
#=GS A0A545VYX5_9HYPO/157-338    AC A0A545VYX5.1
#=GS A0A0L8FZT7_OCTBM/183-366    AC A0A0L8FZT7.1
#=GS A0A6P5J875_PHACI/540-729    AC A0A6P5J875.1
#=GS C5FFB3_ARTOC/162-343        AC C5FFB3.1
#=GS A0A0C3HRD9_9PEZI/152-333    AC A0A0C3HRD9.1
#=GS A0A4S2L6L5_9HYME/208-394    AC A0A4S2L6L5.1
#=GS A0A453C0T8_AEGTS/46-230     AC A0A453C0T8.1
#=GS A0A287WGD4_HORVV/19-128     AC A0A287WGD4.1
#=GS A0A093QVT7_PYGAD/106-301    AC A0A093QVT7.1
#=GS A0A1E3HKV6_9TREE/297-484    AC A0A1E3HKV6.1
#=GS A0A443STW1_9ACAR/292-487    AC A0A443STW1.1
#=GS A0A668UM04_OREAU/155-323    AC A0A668UM04.1
#=GS A0A0R0GKU7_SOYBN/125-310    AC A0A0R0GKU7.1
#=GS A0A3P8XF33_ESOLU/149-344    AC A0A3P8XF33.1
#=GS A0A6I9VB73_BACDO/204-360    AC A0A6I9VB73.1
#=GS M0ZRX7_SOLTU/99-284         AC M0ZRX7.1
#=GS A0A2A4IUY4_HELVI/460-599    AC A0A2A4IUY4.1
#=GS A0A4W5Q824_9TELE/121-315    AC A0A4W5Q824.1
#=GS A0A4V3S8V3_OPIFE/158-342    AC A0A4V3S8V3.1
#=GS A0A6I9T8W1_SESIN/221-401    AC A0A6I9T8W1.1
#=GS A0A182DWZ8_ONCOC/209-392    AC A0A182DWZ8.1
#=GS A0A2K5M4V3_CERAT/64-251     AC A0A2K5M4V3.1
#=GS H3BXQ8_TETNG/51-238         AC H3BXQ8.1
#=GS A0A498S3Y2_ACAVI/257-403    AC A0A498S3Y2.1
#=GS G3Q2D8_GASAC/159-343        AC G3Q2D8.1
#=GS A0A2W1C322_HELAM/169-355    AC A0A2W1C322.1
#=GS A0A446X399_TRITD/104-287    AC A0A446X399.1
#=GS A0A1C1CZQ6_9EURO/154-333    AC A0A1C1CZQ6.1
#=GS V4VBI9_CITCL/247-369        AC V4VBI9.1
#=GS A0A0D2KHW6_9EURO/103-284    AC A0A0D2KHW6.1
#=GS A0A1D6I5P0_MAIZE/1-160      AC A0A1D6I5P0.1
#=GS A0A4U5PTX6_POPAL/168-353    AC A0A4U5PTX6.1
#=GS A0A060XS59_ONCMY/149-344    AC A0A060XS59.1
#=GS A0A672MRW6_SINGR/204-391    AC A0A672MRW6.1
#=GS D6WN86_TRICA/156-343        AC D6WN86.1
#=GS A0A6P4FM13_DRORH/532-689    AC A0A6P4FM13.1
#=GS A0A0M4EB39_DROBS/103-292    AC A0A0M4EB39.1
#=GS A0A067DVG6_CITSI/187-344    AC A0A067DVG6.1
#=GS A0A3Q0E470_CARSF/1-129      AC A0A3Q0E470.1
#=GS G5ED07_CAEEL/154-342        AC G5ED07.1
#=GS A0A091GSG8_BUCRH/66-250     AC A0A091GSG8.1
#=GS I3JFG2_ORENI/155-338        AC I3JFG2.2
#=GS A0A3Q0FFS0_VIGRR/168-349    AC A0A3Q0FFS0.1
#=GS A0A0D2MS26_9CHLO/40-107     AC A0A0D2MS26.1
#=GS A0A1S4ATH4_TOBAC/166-344    AC A0A1S4ATH4.1
#=GS A0A0D3BMM2_BRAOL/165-350    AC A0A0D3BMM2.1
#=GS A0A091QJH3_9GRUI/126-309    AC A0A091QJH3.1
#=GS A0A4D9AEZ1_SALSN/166-349    AC A0A4D9AEZ1.1
#=GS A0A2Y9IQF5_ENHLU/534-723    AC A0A2Y9IQF5.1
#=GS I1KKH4_SOYBN/198-308        AC I1KKH4.1
#=GS E3LT72_CAERE/157-338        AC E3LT72.1
#=GS A0A2R9BZ42_PANPA/128-317    AC A0A2R9BZ42.1
#=GS A0A2Y9ILN9_ENHLU/534-723    AC A0A2Y9ILN9.1
#=GS A0A2I1GB29_9GLOM/302-488    AC A0A2I1GB29.1
#=GS A0A5N6MIV6_9ASTR/174-359    AC A0A5N6MIV6.1
#=GS G5C2G4_HETGA/182-366        AC G5C2G4.1
#=GS A0A3Q7TV21_VULVU/167-350    AC A0A3Q7TV21.1
#=GS A2G758_TRIVA/148-321        AC A2G758.1
#=GS A0A340XPH3_LIPVE/158-338    AC A0A340XPH3.1
#=GS A0A2K5J4J5_COLAP/312-504    AC A0A2K5J4J5.1
#=GS H0VL04_CAVPO/163-347        AC H0VL04.1
#=GS A0A5N5F7B7_9ROSA/178-359    AC A0A5N5F7B7.1
#=GS A0A2J7R328_9NEOP/158-342    AC A0A2J7R328.1
#=GS A0A061DEV9_BABBI/243-409    AC A0A061DEV9.1
#=GS A0A1W4WET8_AGRPL/174-344    AC A0A1W4WET8.1
#=GS A0A4V5NK13_9PEZI/154-335    AC A0A4V5NK13.1
#=GS A0A4U0VZ09_9BASI/150-332    AC A0A4U0VZ09.1
#=GS A0A232F3W4_9HYME/152-347    AC A0A232F3W4.1
#=GS A0A6J2MCA7_9CHIR/311-428    AC A0A6J2MCA7.1
#=GS K5W7Z1_PHACS/150-334        AC K5W7Z1.1
#=GS A0A3Q4MGL0_NEOBR/205-262    AC A0A3Q4MGL0.1
#=GS A0A074YHL2_AURSE/151-331    AC A0A074YHL2.1
#=GS A0A2U3X1C9_ODORO/565-754    AC A0A2U3X1C9.1
#=GS M0ZUY2_SOLTU/218-397        AC M0ZUY2.1
#=GS A0A2K5DRX6_AOTNA/116-289    AC A0A2K5DRX6.1
#=GS A0A3P7EHL3_WUCBA/9-130      AC A0A3P7EHL3.1
#=GS H2AXQ8_KAZAF/174-351        AC H2AXQ8.1
#=GS A0A7M7M1X1_NASVI/1537-1700  AC A0A7M7M1X1.1
#=GS A0A0V1C172_TRISP/1015-1100  AC A0A0V1C172.1
#=GS A0A674E6B2_SALTR/167-350    AC A0A674E6B2.1
#=GS F1P212_CHICK/181-362        AC F1P212.4
#=GS A0A6S7NNA4_LACSI/179-363    AC A0A6S7NNA4.1
#=GS A0A2A2KB89_9BILA/165-350    AC A0A2A2KB89.1
#=GS A0A3S3NSB1_9ACAR/149-333    AC A0A3S3NSB1.1
#=GS G1N546_MELGA/190-305        AC G1N546.1
#=GS W4IU84_PLAFP/162-341        AC W4IU84.1
#=GS Q5K7H6_CRYNJ/154-340        AC Q5K7H6.1
#=GS T0K0R7_COLGC/82-257         AC T0K0R7.1
#=GS A0A099ZAU2_TINGU/148-331    AC A0A099ZAU2.1
#=GS A0A0K9NQQ8_ZOSMR/200-377    AC A0A0K9NQQ8.1
#=GS F1A2H6_DICPU/111-293        AC F1A2H6.1
#=GS Q7RRT0_PLAYO/173-340        AC Q7RRT0.1
#=GS S8CPX2_9LAMI/175-341        AC S8CPX2.1
#=GS A0A0D3CGA4_BRAOL/178-348    AC A0A0D3CGA4.1
#=GS A0A0G2E9C0_9EURO/153-334    AC A0A0G2E9C0.1
#=GS A0A4W6CCJ1_LATCA/307-499    AC A0A4W6CCJ1.1
#=GS A0A1W0W988_HYPDU/203-388    AC A0A1W0W988.1
#=GS M4DUP6_BRARP/229-408        AC M4DUP6.1
#=GS A0A671RAU7_9TELE/136-313    AC A0A671RAU7.1
#=GS A0A4Z2FHP5_9TELE/154-293    AC A0A4Z2FHP5.1
#=GS A0A4W4GRB2_ELEEL/167-350    AC A0A4W4GRB2.1
#=GS A0A197JFZ7_9FUNG/300-478    AC A0A197JFZ7.1
#=GS A0A6I8QP47_XENTR/183-368    AC A0A6I8QP47.1
#=GS A0A2I2YHE3_GORGO/160-355    AC A0A2I2YHE3.1
#=GS A0A158PP38_ANISI/149-314    AC A0A158PP38.1
#=GS A0A2I1CLP1_ASPN1/161-342    AC A0A2I1CLP1.1
#=GS A0A4U5U402_COLLU/169-353    AC A0A4U5U402.1
#=GS H2S5J7_TAKRU/216-400        AC H2S5J7.3
#=GS A0A2G3BYM1_CAPCH/150-282    AC A0A2G3BYM1.1
#=GS A0A5J5DMZ4_9PERO/228-414    AC A0A5J5DMZ4.1
#=GS A0A2K6R7X5_RHIRO/167-350    AC A0A2K6R7X5.1
#=GS A0A3P8ZF50_ESOLU/98-281     AC A0A3P8ZF50.1
#=GS A0A1S4ADU3_TOBAC/243-423    AC A0A1S4ADU3.1
#=GS A0A163MVG7_ABSGL/157-341    AC A0A163MVG7.1
#=GS A0A093JCU9_FULGA/53-234     AC A0A093JCU9.1
#=GS A0A3Q1ETM7_9TELE/168-351    AC A0A3Q1ETM7.1
#=GS A0A6P7H6R7_DIAVI/2-140      AC A0A6P7H6R7.1
#=GS A0A1Y1YRQ5_9FUNG/156-336    AC A0A1Y1YRQ5.1
#=GS A0A091NSS3_APAVI/138-318    AC A0A091NSS3.1
#=GS A0A087UV28_STEMI/33-228     AC A0A087UV28.1
#=GS A0A2H3JHI9_WOLCO/161-341    AC A0A2H3JHI9.1
#=GS A0A6L2PWI0_COPFO/143-337    AC A0A6L2PWI0.1
#=GS I3JGI3_ORENI/154-335        AC I3JGI3.2
#=GS A0A196SC55_BLAHN/151-347    AC A0A196SC55.1
#=GS A0A2P5FTY4_TREOI/214-393    AC A0A2P5FTY4.1
#=GS A0A1D6EAK1_MAIZE/181-354    AC A0A1D6EAK1.1
#=GS A0A553NMP1_9TELE/47-172     AC A0A553NMP1.1
#=GS A0A674DSN3_SALTR/159-342    AC A0A674DSN3.1
#=GS A0A0B7NJC2_9FUNG/528-709    AC A0A0B7NJC2.1
#=GS V4MFZ0_EUTSA/214-399        AC V4MFZ0.1
#=GS D3BRH7_POLPP/253-363        AC D3BRH7.1
#=GS A0A5N6TD55_9EURO/161-342    AC A0A5N6TD55.1
#=GS A0A673JMU8_9TELE/150-345    AC A0A673JMU8.1
#=GS A0A158PJN8_ANGCS/240-414    AC A0A158PJN8.1
#=GS A0A061FHE2_THECC/261-446    AC A0A061FHE2.1
#=GS T1H7X1_RHOPR/685-811        AC T1H7X1.1
#=GS A0A022RHC1_ERYGU/227-408    AC A0A022RHC1.1
#=GS A0A1B9IFW0_9TREE/154-341    AC A0A1B9IFW0.1
#=GS M7U1V7_BOTF1/152-333        AC M7U1V7.1
#=GS A0A1L8FX18_XENLA/316-508    AC A0A1L8FX18.1
#=GS A0A6P7SYP7_OCTVU/157-347    AC A0A6P7SYP7.1
#=GS A0A7F5RLI5_AGRPL/53-237     AC A0A7F5RLI5.1
#=GS A0A178F3U6_TRIRU/170-343    AC A0A178F3U6.1
#=GS A0A2I0M4W6_COLLI/282-473    AC A0A2I0M4W6.1
#=GS A0A067L9F7_JATCU/321-435    AC A0A067L9F7.1
#=GS A0A6I8VRF1_DROPS/531-688    AC A0A6I8VRF1.1
#=GS H2ZN98_CIOSA/140-327        AC H2ZN98.1
#=GS Q6FX95_CANGA/167-339        AC Q6FX95.1
#=GS A0A067G4G2_CITSI/231-412    AC A0A067G4G2.1
#=GS A0A5E4F6U8_PRUDU/228-408    AC A0A5E4F6U8.1
#=GS A0A6P5L0H9_PHACI/167-350    AC A0A6P5L0H9.1
#=GS B9PQF6_TOXGV/374-599        AC B9PQF6.1
#=GS A0A667ZFZ7_9TELE/158-353    AC A0A667ZFZ7.1
#=GS A0A6F9ABL4_9TELE/158-352    AC A0A6F9ABL4.1
#=GS A0A0V1HBL3_9BILA/199-374    AC A0A0V1HBL3.1
#=GS A0A5A7RKG0_STRAF/219-404    AC A0A5A7RKG0.1
#=GS A0A6G1BZL7_9ORYZ/172-366    AC A0A6G1BZL7.1
#=GS U3IFH7_ANAPP/207-384        AC U3IFH7.2
#=GS A0A0Q3T1U5_AMAAE/158-338    AC A0A0Q3T1U5.1
#=GS A0A2K6LRN1_RHIBE/163-347    AC A0A2K6LRN1.1
#=GS A0A6G1C508_9ORYZ/179-364    AC A0A6G1C508.1
#=GS A0A068TP47_COFCA/99-284     AC A0A068TP47.1
#=GS A0A6J1QLU8_9HYME/1567-1730  AC A0A6J1QLU8.1
#=GS A0A167JP96_CALVF/302-490    AC A0A167JP96.1
#=GS A0A384A3D9_BALAS/183-370    AC A0A384A3D9.1
#=GS A0A6J0ZUX4_9ROSI/234-414    AC A0A6J0ZUX4.1
#=GS A0A401S3R9_CHIPU/169-352    AC A0A401S3R9.1
#=GS A0A091PLB3_HALAL/124-304    AC A0A091PLB3.1
#=GS A0A674IUI0_TERCA/156-337    AC A0A674IUI0.1
#=GS A0A423WTT3_9PEZI/162-351    AC A0A423WTT3.1
#=GS A0A673ZHT8_SALTR/158-352    AC A0A673ZHT8.1
#=GS ERP27_HUMAN/64-251          AC Q96DN0.1
#=GS ERP27_HUMAN/64-251          DR PDB; 4F9Z C; 64-251;
#=GS ERP27_HUMAN/64-251          DR PDB; 2L4C A; 39-116;
#=GS ERP27_HUMAN/64-251          DR PDB; 4F9Z B; 64-251;
#=GS ERP27_HUMAN/64-251          DR PDB; 4F9Z E; 64-251;
#=GS ERP27_HUMAN/64-251          DR PDB; 4F9Z D; 64-251;
#=GS ERP27_HUMAN/64-251          DR PDB; 4F9Z A; 64-251;
#=GS A0A452IF65_9SAUR/538-727    AC A0A452IF65.1
#=GS E9FUV9_DAPPU/156-341        AC E9FUV9.1
#=GS F1ND60_CHICK/545-734        AC F1ND60.4
#=GS A0A4Z2ICI4_9TELE/168-351    AC A0A4Z2ICI4.1
#=GS A0A6P8Z5K5_THRPL/759-937    AC A0A6P8Z5K5.1
#=GS A0A3M6US65_POCDA/593-747    AC A0A3M6US65.1
#=GS A0A669EI38_ORENI/196-303    AC A0A669EI38.1
#=GS A0A165YED1_9AGAM/361-531    AC A0A165YED1.1
#=GS A0A445FVI6_GLYSO/197-306    AC A0A445FVI6.1
#=GS A0A6P7GYS8_DIAVI/162-345    AC A0A6P7GYS8.1
#=GS H3AF92_LATCH/167-358        AC H3AF92.1
#=GS A0A444UQJ4_ACIRT/160-344    AC A0A444UQJ4.1
#=GS F2UCE5_SALR5/296-476        AC F2UCE5.1
#=GS A0A6J3EZM1_SAPAP/180-363    AC A0A6J3EZM1.1
#=GS A0A0K9QKT5_SPIOL/212-397    AC A0A0K9QKT5.1
#=GS A0A1X2IT69_9FUNG/157-339    AC A0A1X2IT69.1
#=GS A0A2C9U1I9_MANES/167-352    AC A0A2C9U1I9.1
#=GS A0A5N6QG59_9ROSI/213-398    AC A0A5N6QG59.1
#=GS A0A384BBR7_BALAS/105-284    AC A0A384BBR7.1
#=GS A0A7H9AWG3_ZYGMR/165-341    AC A0A7H9AWG3.1
#=GS A0A484D3W6_PERFV/149-344    AC A0A484D3W6.1
#=GS G2HFN6_PANTR/160-355        AC G2HFN6.1
#=GS A0A0D3EZE7_9ORYZ/216-401    AC A0A0D3EZE7.1
#=GS A0A317V8K0_9EURO/157-338    AC A0A317V8K0.1
#=GS A0A7E5WAY7_TRINI/158-343    AC A0A7E5WAY7.1
#=GS A0A6J2ANE8_ACIJB/312-504    AC A0A6J2ANE8.1
#=GS Q8LSK4_PHYPA/169-341        AC Q8LSK4.1
#=GS A0A4W4F4C1_ELEEL/158-352    AC A0A4W4F4C1.1
#=GS A0A1J4K8Z4_9EUKA/218-366    AC A0A1J4K8Z4.1
#=GS A0A446X363_TRITD/1-172      AC A0A446X363.1
#=GS U4U691_DENPD/157-344        AC U4U691.1
#=GS A0A5C3LQ79_9AGAR/302-477    AC A0A5C3LQ79.1
#=GS A0A6J2UXY9_CHACN/310-502    AC A0A6J2UXY9.1
#=GS L8IG29_9CETA/148-331        AC L8IG29.1
#=GS A0A168SJ78_ABSGL/157-339    AC A0A168SJ78.1
#=GS A0A674D9B7_SALTR/47-233     AC A0A674D9B7.1
#=GS L5LL23_MYODS/186-301        AC L5LL23.1
#=GS A0A093QD66_9PASS/193-308    AC A0A093QD66.1
#=GS A0A0A0A3L2_CHAVO/282-473    AC A0A0A0A3L2.1
#=GS J5JHT2_BEAB2/156-338        AC J5JHT2.1
#=GS A0A2G5UUB3_9PELO/111-277    AC A0A2G5UUB3.1
#=GS A0A2K6QZX1_RHIRO/9-150      AC A0A2K6QZX1.1
#=GS A0A1L8ER13_XENLA/183-368    AC A0A1L8ER13.1
#=GS A0A6A5FJU2_PERFL/46-234     AC A0A6A5FJU2.1
#=GS A0A1X6MWL3_9APHY/331-492    AC A0A1X6MWL3.1
#=GS A0A665X0W3_ECHNA/48-236     AC A0A665X0W3.1
#=GS V7BW18_PHAVU/213-394        AC V7BW18.1
#=GS A0A672MU97_SINGR/196-307    AC A0A672MU97.1
#=GS M3WMZ2_FELCA/246-429        AC M3WMZ2.2
#=GS A0A5A9N647_9TELE/34-226     AC A0A5A9N647.1
#=GS A0A034VQH7_BACDO/162-346    AC A0A034VQH7.1
#=GS A0A194YM02_SORBI/233-413    AC A0A194YM02.2
#=GS H2LSQ4_ORYLA/308-500        AC H2LSQ4.1
#=GS A0A2G3C817_CAPCH/194-376    AC A0A2G3C817.1
#=GS A0A672MAF2_SINGR/159-343    AC A0A672MAF2.1
#=GS A0A2K6A841_MANLE/112-296    AC A0A2K6A841.1
#=GS N1RMP4_FUSC4/155-336        AC N1RMP4.1
#=GS A0A6J1ZVQ0_ACIJB/534-675    AC A0A6J1ZVQ0.1
#=GS A0A1W4WET8_AGRPL/504-642    AC A0A1W4WET8.1
#=GS A0A1S3HQX1_LINUN/108-293    AC A0A1S3HQX1.1
#=GS A0C5T5_PARTE/153-321        AC A0C5T5.1
#=GS L0PD31_PNEJ8/917-1097       AC L0PD31.1
#=GS A0A2I0XH65_9ASPA/305-405    AC A0A2I0XH65.1
#=GS E2RAJ4_CANLF/64-251         AC E2RAJ4.2
#=GS A0A670ZPS4_PSETE/158-339    AC A0A670ZPS4.1
#=GS A0A0W4ZVZ8_PNEJ7/158-338    AC A0A0W4ZVZ8.1
#=GS E2R947_CANLF/292-396        AC E2R947.3
#=GS A0A372QP14_9GLOM/162-342    AC A0A372QP14.1
#=GS A0A3P9MT48_POERE/169-353    AC A0A3P9MT48.1
#=GS A0A671LMH4_9TELE/166-350    AC A0A671LMH4.1
#=GS A0A1S3M1K3_SALSA/158-352    AC A0A1S3M1K3.1
#=GS A0A3Q3W8H3_MOLML/211-370    AC A0A3Q3W8H3.1
#=GS A0A3B5Q0L0_XIPMA/48-235     AC A0A3B5Q0L0.1
#=GS A0A0A0A9V7_CHAVO/112-296    AC A0A0A0A9V7.1
#=GS A0A4Q4YZS2_9PEZI/157-338    AC A0A4Q4YZS2.1
#=GS I3JKW6_ORENI/159-353        AC I3JKW6.2
#=GS A0A3Q1ATC6_AMPOC/33-227     AC A0A3Q1ATC6.1
#=GS G0P3K3_CAEBE/154-342        AC G0P3K3.1
#=GS A0A2N5RXW7_9BASI/161-287    AC A0A2N5RXW7.1
#=GS A0A3Q3N299_9TELE/298-490    AC A0A3Q3N299.2
#=GS A0A7N6AC88_ANATE/172-327    AC A0A7N6AC88.1
#=GS A0A1X7R6U2_9SACH/193-377    AC A0A1X7R6U2.1
#=GS A0A2K6U871_SAIBB/180-367    AC A0A2K6U871.1
#=GS A0A078AFU2_STYLE/150-343    AC A0A078AFU2.1
#=GS A0A397SHQ0_9GLOM/156-336    AC A0A397SHQ0.1
#=GS A0A5A9PTH6_9TELE/150-345    AC A0A5A9PTH6.1
#=GS A0A340Y1S5_LIPVE/160-355    AC A0A340Y1S5.1
#=GS A0A452SIF6_URSAM/89-269     AC A0A452SIF6.1
#=GS A0A2R6RP65_ACTCC/170-355    AC A0A2R6RP65.1
#=GS A0A317SSJ4_9PEZI/163-343    AC A0A317SSJ4.1
#=GS F6YRS8_CIOIN/159-344        AC F6YRS8.2
#=GS A0A673AAY1_9TELE/151-332    AC A0A673AAY1.1
#=GS A0A1D6NUN7_MAIZE/207-362    AC A0A1D6NUN7.1
#=GS A0A2K5JLN1_COLAP/159-343    AC A0A2K5JLN1.1
#=GS H2SP27_TAKRU/305-497        AC H2SP27.3
#=GS A0A444V327_ACIRT/149-344    AC A0A444V327.1
#=GS A0A674IPK4_TERCA/16-149     AC A0A674IPK4.1
#=GS A0A1S3RPA4_SALSA/33-154     AC A0A1S3RPA4.1
#=GS A0A6P3VQL5_CLUHA/550-742    AC A0A6P3VQL5.1
#=GS A0A093QL59_9PASS/78-273     AC A0A093QL59.1
#=GS V7AV18_PHAVU/171-356        AC V7AV18.1
#=GS A0A7M7NQ17_STRPU/112-292    AC A0A7M7NQ17.1
#=GS G1SFV1_RABIT/312-505        AC G1SFV1.2
#=GS H3D824_TETNG/150-331        AC H3D824.1
#=GS A0A251S5S6_HELAN/181-365    AC A0A251S5S6.1
#=GS A0A4Z2J1H4_9TELE/47-234     AC A0A4Z2J1H4.1
#=GS A0A6J2QGF5_COTGO/18-234     AC A0A6J2QGF5.1
#=GS A0A2A3E2U3_APICC/170-356    AC A0A2A3E2U3.1
#=GS A0A6J2XM90_SITOR/523-668    AC A0A6J2XM90.1
#=GS PDIA3_BOVIN/160-355         AC P38657.1
#=GS A0A667Y0I0_9TELE/116-299    AC A0A667Y0I0.1
#=GS A0A090LA80_STRRB/388-568    AC A0A090LA80.1
#=GS A0A091QW85_9GRUI/3-146      AC A0A091QW85.1
#=GS A0A087STY6_AUXPR/132-329    AC A0A087STY6.1
#=GS A0A1D6EAJ9_MAIZE/181-344    AC A0A1D6EAJ9.1
#=GS A0A6H5KJP1_9PHAE/552-691    AC A0A6H5KJP1.1
#=GS V4VB74_CITCL/187-371        AC V4VB74.1
#=GS A0A1B8G8I1_9PEZI/153-334    AC A0A1B8G8I1.1
#=GS A0A1S4DPD3_TOBAC/86-264     AC A0A1S4DPD3.1
#=GS A0A1S3NNE6_SALSA/157-351    AC A0A1S3NNE6.1
#=GS S2IU60_MUCC1/159-337        AC S2IU60.1
#=GS A4L9H0_GOSAR/169-354        AC A4L9H0.1
#=GS A0A4W2IKI1_BOBOX/180-363    AC A0A4W2IKI1.1
#=GS A2X610_ORYSI/165-353        AC A2X610.1
#=GS W5PNJ7_SHEEP/190-305        AC W5PNJ7.1
#=GS A0A1U7R0Z8_MESAU/167-350    AC A0A1U7R0Z8.1
#=GS Q5VLR5_RAT/167-350          AC Q5VLR5.1
#=GS A0A6I9XT36_9SAUR/166-349    AC A0A6I9XT36.1
#=GS A0A1V6PS42_9EURO/164-345    AC A0A1V6PS42.1
#=GS A0A6P4FPD6_DRORH/80-218     AC A0A6P4FPD6.1
#=GS G2PZX2_MYCTT/153-334        AC G2PZX2.1
#=GS A0A1W0E2Y9_9MICR/256-444    AC A0A1W0E2Y9.1
#=GS L8WNX4_THACA/311-480        AC L8WNX4.1
#=GS A0A162TBM2_PHYB8/134-315    AC A0A162TBM2.1
#=GS H2QAP2_PANTR/180-365        AC H2QAP2.1
#=GS J6EQ53_SACK1/169-337        AC J6EQ53.1
#=GS A0A3P7FNI0_WUCBA/120-300    AC A0A3P7FNI0.1
#=GS A0A0V0RHZ3_9BILA/656-845    AC A0A0V0RHZ3.1
#=GS PDIA4_CAEEL/281-478         AC P34329.2
#=GS A0A6P3H2R7_BISBI/531-720    AC A0A6P3H2R7.1
#=GS A0A2G2ZDT9_CAPAN/212-383    AC A0A2G2ZDT9.1
#=GS A0A166B8S5_9AGAM/155-261    AC A0A166B8S5.1
#=GS C1MRN2_MICPC/177-374        AC C1MRN2.1
#=GS A0A158P235_ATTCE/159-343    AC A0A158P235.1
#=GS A0A445E4K7_ARAHY/292-472    AC A0A445E4K7.1
#=GS A0A7N6AM18_ANATE/167-355    AC A0A7N6AM18.1
#=GS A0A093HSL9_STRCA/106-291    AC A0A093HSL9.1
#=GS A0A3L8S7Q2_CHLGU/625-814    AC A0A3L8S7Q2.1
#=GS A0A164Z9N3_DAUCS/235-415    AC A0A164Z9N3.1
#=GS A0A388L1W7_CHABU/202-390    AC A0A388L1W7.1
#=GS A0A2R8Q5I0_DANRE/193-380    AC A0A2R8Q5I0.1
#=GS A0A6J1QQR2_9HYME/1531-1694  AC A0A6J1QQR2.1
#=GS PDIA3_HUMAN/160-355         AC P30101.4
#=GS PDIA3_HUMAN/160-355         DR PDB; 3F8U C; 160-355;
#=GS PDIA3_HUMAN/160-355         DR PDB; 6ENY D; 160-355;
#=GS PDIA3_HUMAN/160-355         DR PDB; 2H8L A; 160-355;
#=GS PDIA3_HUMAN/160-355         DR PDB; 3F8U A; 160-355;
#=GS PDIA3_HUMAN/160-355         DR PDB; 2H8L B; 160-355;
#=GS PDIA3_HUMAN/160-355         DR PDB; 2H8L C; 160-355;
#=GS A0A2I0M6S7_COLLI/116-311    AC A0A2I0M6S7.1
#=GS A0A1W0WVX5_HYPDU/1119-1278  AC A0A1W0WVX5.1
#=GS A0A453C0U2_AEGTS/22-206     AC A0A453C0U2.1
#=GS F7B737_XENTR/524-711        AC F7B737.3
#=GS A0A6J2W2D4_CHACN/159-343    AC A0A6J2W2D4.1
#=GS A0A166CXM8_9AGAM/320-496    AC A0A166CXM8.1
#=GS A0A6P7GZE3_DIAVI/151-348    AC A0A6P7GZE3.1
#=GS F7ET41_ORNAN/1-83           AC F7ET41.2
#=GS A0A0A0B2D8_CHAVO/515-704    AC A0A0A0B2D8.1
#=GS L1IFP1_GUITC/165-346        AC L1IFP1.1
#=GS A8B3I4_GIAIC/144-328        AC A8B3I4.1
#=GS W4GE47_9STRA/166-341        AC W4GE47.1
#=GS A0A1S3FQF4_DIPOR/167-350    AC A0A1S3FQF4.1
#=GS A0A803K804_XENTR/176-362    AC A0A803K804.1
#=GS A0A194UQW2_9PEZI/153-334    AC A0A194UQW2.1
#=GS A0A0D2UVK4_GOSRA/20-201     AC A0A0D2UVK4.1
#=GS A0A673JYE3_9TELE/162-346    AC A0A673JYE3.1
#=GS A0A673ULJ2_SURSU/534-723    AC A0A673ULJ2.1
#=GS A0A670IKJ4_PODMU/247-427    AC A0A670IKJ4.1
#=GS A0A6J1XG07_ACIJB/64-251     AC A0A6J1XG07.1
#=GS A0A6J1QQQ0_9HYME/160-344    AC A0A6J1QQQ0.1
#=GS A0A267E632_9PLAT/153-334    AC A0A267E632.1
#=GS A0A2I4DCI2_9TELE/184-377    AC A0A2I4DCI2.1
#=GS G2R472_THETT/153-334        AC G2R472.1
#=GS A0A4W5R6E1_9TELE/151-330    AC A0A4W5R6E1.1
#=GS A0A314UMR1_PRUYE/85-225     AC A0A314UMR1.1
#=GS A0A446R4W7_TRITD/176-265    AC A0A446R4W7.1
#=GS G4MW50_MAGO7/180-323        AC G4MW50.1
#=GS A0A446QEX1_TRITD/5-184      AC A0A446QEX1.1
#=GS A0A6J1Y4B0_ACIJB/179-366    AC A0A6J1Y4B0.1
#=GS A0A199VMW7_ANACO/212-394    AC A0A199VMW7.1
#=GS A0A507DKE2_9FUNG/210-386    AC A0A507DKE2.1
#=GS A0A6J2T152_DROLE/200-356    AC A0A6J2T152.1
#=GS A0A4W3GMQ0_CALMI/129-324    AC A0A4W3GMQ0.1
#=GS PDIA1_RABIT/162-346         AC P21195.1
#=GS A0A672N0H8_SINGR/196-383    AC A0A672N0H8.1
#=GS A0A4W5MT49_9TELE/97-186     AC A0A4W5MT49.1
#=GS A0A4W6CDP0_LATCA/158-341    AC A0A4W6CDP0.1
#=GS S8DU37_9LAMI/229-407        AC S8DU37.1
#=GS A0A673ZI99_SALTR/149-344    AC A0A673ZI99.1
#=GS A0A3P7FIN2_HYDTA/161-345    AC A0A3P7FIN2.1
#=GS A0A3B6NJB3_WHEAT/233-413    AC A0A3B6NJB3.1
#=GS A0A7N8WXZ5_9TELE/159-342    AC A0A7N8WXZ5.1
#=GS A0A453P594_AEGTS/66-234     AC A0A453P594.1
#=GS F4K0F5_ARATH/241-376        AC F4K0F5.1
#=GS A0A7P0T8X1_HUMAN/161-345    AC A0A7P0T8X1.1
#=GS A0A1J6J7Z6_NICAT/227-407    AC A0A1J6J7Z6.1
#=GS A0A1C7NT00_9FUNG/152-326    AC A0A1C7NT00.1
#=GS A0A2K6RLF4_RHIRO/310-502    AC A0A2K6RLF4.1
#=GS A0A340XRN8_LIPVE/167-350    AC A0A340XRN8.1
#=GS A0A194X9D1_9HELO/159-333    AC A0A194X9D1.1
#=GS A0A498SAC8_ACAVI/122-291    AC A0A498SAC8.1
#=GS A0A671XCR1_SPAAU/207-390    AC A0A671XCR1.1
#=GS A0A098VSI7_9MICR/165-329    AC A0A098VSI7.1
#=GS G0S3E6_CHATD/1180-1354      AC G0S3E6.1
#=GS A0A2G2WTW8_CAPBA/181-364    AC A0A2G2WTW8.1
#=GS A0A452G8A7_CAPHI/63-250     AC A0A452G8A7.1
#=GS A0A4U6XBN8_9PEZI/152-333    AC A0A4U6XBN8.1
#=GS F2U0G6_SALR5/355-461        AC F2U0G6.1
#=GS A0A091LYJ4_CARIC/280-469    AC A0A091LYJ4.1
#=GS A0A0S6XE14_9FUNG/150-336    AC A0A0S6XE14.1
#=GS A0A3P6Q8D3_9BILA/3-108      AC A0A3P6Q8D3.1
#=GS A0A673Y9E0_SALTR/122-276    AC A0A673Y9E0.1
#=GS A0A3L6Q8Q3_PANMI/181-358    AC A0A3L6Q8Q3.1
#=GS A0A4W3GMU4_CALMI/139-334    AC A0A4W3GMU4.1
#=GS A0A1W4WNQ6_AGRPL/157-344    AC A0A1W4WNQ6.1
#=GS A0A3Q2GFW5_CYPVA/168-351    AC A0A3Q2GFW5.1
#=GS A0A0G2IDK2_9PEZI/29-203     AC A0A0G2IDK2.1
#=GS G0P244_CAEBE/161-341        AC G0P244.1
#=GS A0A3Q7XHD3_URSAR/250-433    AC A0A3Q7XHD3.1
#=GS A0A2I0M4C4_COLLI/163-349    AC A0A2I0M4C4.1
#=GS A0A4W6FXB8_LATCA/163-358    AC A0A4W6FXB8.1
#=GS A0A1Y2GNB2_9FUNG/160-335    AC A0A1Y2GNB2.1
#=GS A0A452REG2_URSAM/59-175     AC A0A452REG2.1
#=GS L1INJ9_GUITC/144-303        AC L1INJ9.1
#=GS A0A0E0KQW2_ORYPU/170-356    AC A0A0E0KQW2.1
#=GS A0A6P4G273_DRORH/532-689    AC A0A6P4G273.1
#=GS F8PF85_SERL3/327-494        AC F8PF85.1
#=GS A0A6J0XV65_ODOVR/531-720    AC A0A6J0XV65.1
#=GS A0A080WJL1_TRIRC/168-343    AC A0A080WJL1.1
#=GS A0A667X7X3_9TELE/308-500    AC A0A667X7X3.1
#=GS A0A4W3IA13_CALMI/203-371    AC A0A4W3IA13.1
#=GS A0A2J6T2J7_9HELO/153-333    AC A0A2J6T2J7.1
#=GS A0A0M3JUL1_ANISI/85-267     AC A0A0M3JUL1.1
#=GS A0A1S3A1V1_ERIEU/179-366    AC A0A1S3A1V1.1
#=GS A0A6P9A2K6_THRPL/187-374    AC A0A6P9A2K6.1
#=GS A0A1L9VVV6_ASPGL/161-342    AC A0A1L9VVV6.1
#=GS A0A672YRI6_9TELE/124-308    AC A0A672YRI6.1
#=GS A0A5A9NW73_9TELE/49-236     AC A0A5A9NW73.1
#=GS A0A699ZX91_HAELA/103-290    AC A0A699ZX91.1
#=GS A0A6J1HZ63_CUCMA/237-417    AC A0A6J1HZ63.1
#=GS A0A673KI75_9TELE/193-380    AC A0A673KI75.1
#=GS A0A2P4T586_BAMTH/1-129      AC A0A2P4T586.1
#=GS A0A182H8I6_AEDAL/155-352    AC A0A182H8I6.1
#=GS A0A2H3HNW8_FUSOX/457-569    AC A0A2H3HNW8.1
#=GS A0A493T965_ANAPP/215-325    AC A0A493T965.1
#=GS A0A093ZK80_9PEZI/153-334    AC A0A093ZK80.1
#=GS D8QLQ0_SCHCM/303-474        AC D8QLQ0.1
#=GS A0A218V003_9PASE/73-259     AC A0A218V003.1
#=GS A0A3Q1KC12_ANATE/47-234     AC A0A3Q1KC12.1
#=GS A0A6P4FPD6_DRORH/201-358    AC A0A6P4FPD6.1
#=GS A0A0D2QTC6_GOSRA/238-415    AC A0A0D2QTC6.1
#=GS A0A1V9Z4F4_9STRA/165-346    AC A0A1V9Z4F4.1
#=GS G4LYC3_SCHMA/157-340        AC G4LYC3.1
#=GS A0A674DWU9_SALTR/295-487    AC A0A674DWU9.1
#=GS A0A0C9XYD0_9AGAR/157-342    AC A0A0C9XYD0.1
#=GS A0A1A8YKB5_9APIC/235-402    AC A0A1A8YKB5.1
#=GS A0A7E4V0D3_PANRE/212-402    AC A0A7E4V0D3.1
#=GS A7SXD7_NEMVE/154-340        AC A7SXD7.1
#=GS A0A444T049_ARMVU/140-306    AC A0A444T049.1
#=GS A0A1J4KGX7_9EUKA/183-344    AC A0A1J4KGX7.1
#=GS A0A087XTK5_POEFO/159-352    AC A0A087XTK5.1
#=GS A0A420Y026_9PEZI/29-209     AC A0A420Y026.1
#=GS A0A3Q2VNH2_HAPBU/155-335    AC A0A3Q2VNH2.1
#=GS A0A6P4B637_ARADU/172-357    AC A0A6P4B637.1
#=GS H9JQN8_BOMMO/158-343        AC H9JQN8.1
#=GS A0A453C0S5_AEGTS/120-276    AC A0A453C0S5.1
#=GS M3YG84_MUSPF/160-355        AC M3YG84.1
#=GS A0A1D6QVG1_MAIZE/226-406    AC A0A1D6QVG1.1
#=GS A0A7F8KHK4_DELLE/159-346    AC A0A7F8KHK4.1
#=GS A0A6P6PDL7_CARAU/159-343    AC A0A6P6PDL7.1
#=GS A0A314KW65_NICAT/173-356    AC A0A314KW65.1
#=GS V8NBS9_OPHHA/166-349        AC V8NBS9.1
#=GS A0A7N5K566_AILME/121-303    AC A0A7N5K566.1
#=GS A0A5A7PYH8_STRAF/194-379    AC A0A5A7PYH8.1
#=GS A0A0D9VH15_9ORYZ/1-126      AC A0A0D9VH15.1
#=GS W7K3S2_PLAFO/162-256        AC W7K3S2.1
#=GS A0A179UR13_BLAGS/159-340    AC A0A179UR13.1
#=GS A0A5E4C7W0_MARMO/539-728    AC A0A5E4C7W0.1
#=GS E3Q963_COLGM/110-286        AC E3Q963.1
#=GS A0A672SJF6_SINGR/147-330    AC A0A672SJF6.1
#=GS A0A0V1C154_TRISP/1015-1199  AC A0A0V1C154.1
#=GS A0A498J1Q4_MALDO/488-682    AC A0A498J1Q4.1
#=GS A0A2G9UML3_TELCI/366-515    AC A0A2G9UML3.1
#=GS B9RQL5_RICCO/214-398        AC B9RQL5.1
#=GS M3WT19_FELCA/534-723        AC M3WT19.4
#=GS A0A1W0E822_9MICR/115-274    AC A0A1W0E822.1
#=GS A0A5J4NZV6_9TREM/182-362    AC A0A5J4NZV6.1
#=GS A0A3R7LYM3_PENVA/107-283    AC A0A3R7LYM3.1
#=GS A0A3P8UNF9_CYNSE/217-400    AC A0A3P8UNF9.1
#=GS A0A1M8A057_MALS4/355-533    AC A0A1M8A057.1
#=GS A0A4R8RIH4_COLTR/148-324    AC A0A4R8RIH4.1
#=GS A0A0G4IND5_PLABS/152-328    AC A0A0G4IND5.1
#=GS A0A0J0XVC3_9TREE/149-334    AC A0A0J0XVC3.1
#=GS A0A369SL84_9METZ/162-341    AC A0A369SL84.1
#=GS A0A672GG99_SALFA/200-386    AC A0A672GG99.1
#=GS A0A6I9VFC2_BACDO/522-678    AC A0A6I9VFC2.1
#=GS A0A663FI97_AQUCH/296-410    AC A0A663FI97.1
#=GS A0A091WJR6_OPIHO/80-225     AC A0A091WJR6.1
#=GS A0A087Y074_POEFO/157-337    AC A0A087Y074.2
#=GS A0A672LWS2_SINGR/154-282    AC A0A672LWS2.1
#=GS R7UDG3_CAPTE/155-343        AC R7UDG3.1
#=GS A0A6I9HJ51_GEOFO/73-259     AC A0A6I9HJ51.1
#=GS Q5TMX9_ANOGA/161-345        AC Q5TMX9.3
#=GS Q5KCK8_CRYNJ/302-485        AC Q5KCK8.1
#=GS A0A6P8NIW4_GEOSA/154-349    AC A0A6P8NIW4.1
#=GS A0A2K6QZX3_RHIRO/64-251     AC A0A2K6QZX3.1
#=GS D7KLW4_ARALL/179-347        AC D7KLW4.1
#=GS A0A4W6DBQ0_LATCA/159-342    AC A0A4W6DBQ0.1
#=GS A0A7E4RSS3_CIMLE/133-320    AC A0A7E4RSS3.1
#=GS A0A6I8PKX1_ORNAN/5-143      AC A0A6I8PKX1.1
#=GS PDI12_ORYSJ/170-356         AC Q7XRB5.2
#=GS A0A287H2Q9_HORVV/59-167     AC A0A287H2Q9.1
#=GS A0A087HQ82_ARAAL/166-350    AC A0A087HQ82.1
#=GS A0A7N4PCY8_SARHA/311-410    AC A0A7N4PCY8.1
#=GS A0A2I3HJ88_NOMLE/197-313    AC A0A2I3HJ88.1
#=GS A0A553NGM7_9TELE/9-196      AC A0A553NGM7.1
#=GS A0A6P6YC35_DERPT/208-378    AC A0A6P6YC35.1
#=GS A0A072VPJ1_MEDTR/164-344    AC A0A072VPJ1.1
#=GS A0A3Q3B4Q6_KRYMA/155-335    AC A0A3Q3B4Q6.1
#=GS A0A4C1WW42_EUMVA/159-344    AC A0A4C1WW42.1
#=GS A0A1Y1VTS1_9FUNG/166-321    AC A0A1Y1VTS1.1
#=GS A0A3P9Q0R4_POERE/168-351    AC A0A3P9Q0R4.1
#=GS A0A6P8WGI0_DROAB/524-681    AC A0A6P8WGI0.1
#=GS A0A5E4Q2L0_9NEOP/163-349    AC A0A5E4Q2L0.1
#=GS A0A1G4B6R3_9PEZI/152-333    AC A0A1G4B6R3.1
#=GS A0A6P5RXV9_PRUAV/168-353    AC A0A6P5RXV9.1
#=GS A0A6I8US16_DROPS/164-351    AC A0A6I8US16.1
#=GS A0A2S4PWY0_9PEZI/155-334    AC A0A2S4PWY0.1
#=GS A0A5F5Y798_FELCA/64-251     AC A0A5F5Y798.1
#=GS A0A0V0XWF7_TRIPS/155-266    AC A0A0V0XWF7.1
#=GS A4RXK8_OSTLU/139-320        AC A4RXK8.1
#=GS A0A6J1WLA4_GALME/713-886    AC A0A6J1WLA4.1
#=GS A0A663LQX0_ATHCN/492-674    AC A0A663LQX0.1
#=GS A0A2Y9GVE6_NEOSC/158-338    AC A0A2Y9GVE6.1
#=GS A0A1L9PSV3_ASPVE/161-342    AC A0A1L9PSV3.1
#=GS A0A1X2IU78_9FUNG/157-340    AC A0A1X2IU78.1
#=GS A0A4W5KNU2_9TELE/167-345    AC A0A4W5KNU2.1
#=GS A0A0D3AR80_BRAOL/167-352    AC A0A0D3AR80.1
#=GS A0A3P9PNC9_POERE/150-338    AC A0A3P9PNC9.1
#=GS A0A2A2JYS7_9BILA/152-340    AC A0A2A2JYS7.1
#=GS A0A4W2DGX6_BOBOX/4-165      AC A0A4W2DGX6.1
#=GS A0A5J5BTP8_9ASTE/173-348    AC A0A5J5BTP8.1
#=GS A0A672FAZ2_SALFA/159-343    AC A0A672FAZ2.1
#=GS A5K5H2_PLAVS/165-331        AC A5K5H2.1
#=GS I1IXU8_BRADI/185-361        AC I1IXU8.1
#=GS A0A183DUC7_9BILA/50-191     AC A0A183DUC7.1
#=GS A0A2R6RJM6_ACTCC/169-354    AC A0A2R6RJM6.1
#=GS A0A3E2H8Y6_SCYLI/838-1023   AC A0A3E2H8Y6.1
#=GS F9FK15_FUSOF/145-319        AC F9FK15.1
#=GS PDIA1_MOUSE/163-347         AC P09103.2
#=GS A0A2G3CHR3_CAPCH/181-364    AC A0A2G3CHR3.1
#=GS A0A1U7RBU9_ALLSI/188-374    AC A0A1U7RBU9.1
#=GS A4L9H5_GOSHI/169-354        AC A4L9H5.1
#=GS A0A061GIB2_THECC/213-398    AC A0A061GIB2.1
#=GS A0A453MNW7_AEGTS/90-229     AC A0A453MNW7.1
#=GS K1PYH4_CRAGI/576-769        AC K1PYH4.1
#=GS A0A1D6PSC4_MAIZE/118-305    AC A0A1D6PSC4.1
#=GS A0A397V3F8_9GLOM/158-338    AC A0A397V3F8.1
#=GS W5LNW1_ASTMX/130-313        AC W5LNW1.2
#=GS PDI12_ARATH/167-351         AC Q9SRG3.1
#=GS M2RPD0_CERS8/164-341        AC M2RPD0.1
#=GS A0A1X6PEF9_PORUM/162-347    AC A0A1X6PEF9.1
#=GS K3YSN0_SETIT/197-370        AC K3YSN0.1
#=GS A0A1X7VVX6_AMPQE/286-476    AC A0A1X7VVX6.1
#=GS S0DND2_GIBF5/155-336        AC S0DND2.1
#=GS A0A7M7L6D3_APIME/1561-1723  AC A0A7M7L6D3.1
#=GS A0A6J2KN84_BOMMA/715-847    AC A0A6J2KN84.1
#=GS A0A7F5R3F3_AGRPL/139-325    AC A0A7F5R3F3.1
#=GS A0A482W4E5_9CUCU/63-264     AC A0A482W4E5.1
#=GS A0A1J4JE62_9EUKA/161-349    AC A0A1J4JE62.1
#=GS A0A287T4T0_HORVV/207-388    AC A0A287T4T0.1
#=GS A0A4W6F942_LATCA/307-499    AC A0A4W6F942.1
#=GS A0A671TK53_SPAAU/159-343    AC A0A671TK53.1
#=GS A0A2K5D5E3_AOTNA/156-312    AC A0A2K5D5E3.1
#=GS A0A3Q3F5B4_9LABR/122-302    AC A0A3Q3F5B4.1
#=GS A0A0V1HBM3_9BILA/279-476    AC A0A0V1HBM3.1
#=GS A0A4W4GCY1_ELEEL/171-365    AC A0A4W4GCY1.1
#=GS A0A446R507_TRITD/177-362    AC A0A446R507.1
#=GS A0A1S2ZW99_ERIEU/167-350    AC A0A1S2ZW99.1
#=GS A0A091S588_NESNO/107-292    AC A0A091S588.1
#=GS B3N0U2_DROAN/168-354        AC B3N0U2.1
#=GS B2KIQ0_RHIFE/160-355        AC B2KIQ0.1
#=GS M7B355_CHEMY/170-355        AC M7B355.1
#=GS A0A6I9HCX8_GEOFO/546-735    AC A0A6I9HCX8.1
#=GS A0A6I9QQU5_ELAGV/175-360    AC A0A6I9QQU5.1
#=GS A0A3P8ZRT1_ESOLU/167-350    AC A0A3P8ZRT1.1
#=GS A0A2R9B577_PANPA/161-330    AC A0A2R9B577.1
#=GS A0A674MF79_TAKRU/164-354    AC A0A674MF79.1
#=GS A0A6J2U996_DROLE/152-349    AC A0A6J2U996.1
#=GS A0A384AF24_BALAS/163-347    AC A0A384AF24.1
#=GS A0A7N6BNX0_ANATE/160-349    AC A0A7N6BNX0.1
#=GS V8NJH5_OPHHA/303-495        AC V8NJH5.1
#=GS A0A0E0P9C4_ORYRU/192-364    AC A0A0E0P9C4.1
#=GS A0A3N2PTH1_9PEZI/191-369    AC A0A3N2PTH1.1
#=GS A0A6J2R8L9_COTGO/168-351    AC A0A6J2R8L9.1
#=GS A0A061J3S7_TRYRA/92-242     AC A0A061J3S7.1
#=GS H0X0P4_OTOGA/160-341        AC H0X0P4.1
#=GS V9DZ10_PHYPR/179-347        AC V9DZ10.1
#=GS A0A2G3AFP1_CAPAN/222-403    AC A0A2G3AFP1.1
#=GS A0A091L318_CATAU/123-304    AC A0A091L318.1
#=GS W9I5V2_FUSOX/145-319        AC W9I5V2.1
#=GS H3CBM5_TETNG/156-335        AC H3CBM5.1
#=GS I3LEF2_PIG/313-428          AC I3LEF2.2
#=GS A0A2I4BEK4_9TELE/402-595    AC A0A2I4BEK4.1
#=GS V7BGM9_PHAVU/173-348        AC V7BGM9.1
#=GS A0A0V1LFQ2_9BILA/190-365    AC A0A0V1LFQ2.1
#=GS M1V423_CYAM1/177-379        AC M1V423.1
#=GS A0A0B2VC49_TOXCA/151-339    AC A0A0B2VC49.1
#=GS A0A668SW94_OREAU/160-344    AC A0A668SW94.1
#=GS A0A4S8JPF2_MUSBA/303-462    AC A0A4S8JPF2.1
#=GS A0A6I9Y333_9SAUR/155-346    AC A0A6I9Y333.1
#=GS A0A6J1PH92_9HYME/153-349    AC A0A6J1PH92.1
#=GS A0A663LQ99_ATHCN/105-288    AC A0A663LQ99.1
#=GS A0A484C6G6_PERFV/307-499    AC A0A484C6G6.1
#=GS A0A6I9YNB6_9SAUR/166-352    AC A0A6I9YNB6.1
#=GS A0A091DAH5_FUKDA/64-251     AC A0A091DAH5.1
#=GS L5KLP0_PTEAL/162-346        AC L5KLP0.1
#=GS H1A0N3_TAEGU/295-410        AC H1A0N3.2
#=GS A0A2K5DS02_AOTNA/89-262     AC A0A2K5DS02.1
#=GS A0A1J9PMT5_9EURO/159-340    AC A0A1J9PMT5.1
#=GS A0A367KAN7_RHIAZ/345-523    AC A0A367KAN7.1
#=GS A0A2A2KSJ2_9BILA/162-342    AC A0A2A2KSJ2.1
#=GS A0A4Q4UTK4_9PEZI/157-338    AC A0A4Q4UTK4.1
#=GS A0A261Y3I8_9FUNG/177-305    AC A0A261Y3I8.1
#=GS T5A8S6_OPHSC/157-338        AC T5A8S6.1
#=GS A0A3B6HYX1_WHEAT/157-342    AC A0A3B6HYX1.1
#=GS H2NS39_PONAB/264-379        AC H2NS39.2
#=GS A0A2H2I1M3_CAEJA/141-319    AC A0A2H2I1M3.1
#=GS A0A1S9D5Y6_ASPOZ/161-342    AC A0A1S9D5Y6.1
#=GS A0A168DZC9_9EURO/89-208     AC A0A168DZC9.1
#=GS A0A137PD51_CONC2/162-342    AC A0A137PD51.1
#=GS A0A6A5F422_PERFL/74-254     AC A0A6A5F422.1
#=GS A0A420U8M7_FUSOX/145-316    AC A0A420U8M7.1
#=GS A0A2G5FAI9_AQUCA/215-400    AC A0A2G5FAI9.1
#=GS Q9VI96_DROME/165-352        AC Q9VI96.1
#=GS K6UDG3_PLACD/162-241        AC K6UDG3.1
#=GS A0A4X2LM99_VOMUR/170-354    AC A0A4X2LM99.1
#=GS A0A6P7SRS6_OCTVU/297-488    AC A0A6P7SRS6.1
#=GS A0A5B0PAB0_PUCGR/161-345    AC A0A5B0PAB0.1
#=GS A0A6I8VSH2_DROPS/531-688    AC A0A6I8VSH2.1
#=GS A0A6P4IQD2_DROKI/534-691    AC A0A6P4IQD2.1
#=GS A0A2K6DP42_MACNE/222-406    AC A0A2K6DP42.1
#=GS A0A0C3LCR8_9AGAM/153-338    AC A0A0C3LCR8.1
#=GS A0A090MY70_STRRB/267-464    AC A0A090MY70.1
#=GS A0A154PEH3_DUFNO/519-676    AC A0A154PEH3.1
#=GS A0A183I9K1_9BILA/2-152      AC A0A183I9K1.1
#=GS A0A0R3SBH5_HYMDI/157-341    AC A0A0R3SBH5.1
#=GS B3L582_PLAKH/162-341        AC B3L582.1
#=GS A0A093EQI0_9AVES/278-469    AC A0A093EQI0.1
#=GS A0C4U5_PARTE/167-377        AC A0C4U5.1
#=GS A0A4W5R728_9TELE/163-358    AC A0A4W5R728.1
#=GS A0A6Q2ZMF7_ESOLU/141-334    AC A0A6Q2ZMF7.1
#=GS D7SWG9_VITVI/174-360        AC D7SWG9.1
#=GS A0A437AIX1_9MICR/118-273    AC A0A437AIX1.1
#=GS A0A4V6QEM0_COLTR/145-317    AC A0A4V6QEM0.1
#=GS A0A341C8D9_NEOAA/158-338    AC A0A341C8D9.1
#=GS A0A341C811_NEOAA/17-197     AC A0A341C811.1
#=GS E0CR49_VITVI/173-358        AC E0CR49.1
#=GS K1V9U0_TRIAC/140-326        AC K1V9U0.1
#=GS A0A2Z7ABI8_9LAMI/168-351    AC A0A2Z7ABI8.1
#=GS A0A6I9QV42_ELAGV/211-390    AC A0A6I9QV42.1
#=GS A0A0B0PX58_GOSAR/213-397    AC A0A0B0PX58.1
#=GS A0A1J7JVY3_9PEZI/148-327    AC A0A1J7JVY3.1
#=GS Q2M1A2_DROPS/158-342        AC Q2M1A2.1
#=GS A0A6I8TS45_AEDAE/530-688    AC A0A6I8TS45.1
#=GS S2JCM6_MUCC1/317-496        AC S2JCM6.1
#=GS A0A2I2Z7B0_GORGO/117-301    AC A0A2I2Z7B0.1
#=GS A0A0E9NL23_SAICN/153-335    AC A0A0E9NL23.1
#=GS A0A673AB35_9TELE/152-333    AC A0A673AB35.1
#=GS A0A077ZTH3_STYLE/95-287     AC A0A077ZTH3.1
#=GS A0A4X2KQ71_VOMUR/163-347    AC A0A4X2KQ71.1
#=GS A0A2I0WZW2_9ASPA/206-307    AC A0A2I0WZW2.1
#=GS K7GIB0_PELSI/102-286        AC K7GIB0.1
#=GS A0A7N6ARK2_ANATE/151-346    AC A0A7N6ARK2.1
#=GS A0A1U7QV55_MESAU/182-369    AC A0A1U7QV55.1
#=GS A0A3Q3RYQ9_9TELE/209-396    AC A0A3Q3RYQ9.1
#=GS A0A6P5A4H1_BRABE/165-348    AC A0A6P5A4H1.1
#=GS A0A1Y2AE01_9TREE/153-335    AC A0A1Y2AE01.1
#=GS A0A183AEZ7_9TREM/23-174     AC A0A183AEZ7.1
#=GS A0A7E6ETM9_OCTVU/451-637    AC A0A7E6ETM9.1
#=GS A0A175W881_9PEZI/133-310    AC A0A175W881.1
#=GS A0A0B7NIP5_9FUNG/228-416    AC A0A0B7NIP5.1
#=GS R1E380_EMIHU/110-298        AC R1E380.1
#=GS A0A6P8GV18_CLUHA/157-352    AC A0A6P8GV18.1
#=GS J3LBN1_ORYBR/127-223        AC J3LBN1.1
#=GS A0A673K711_9TELE/159-343    AC A0A673K711.1
#=GS A0A6J1WTG8_GALME/516-672    AC A0A6J1WTG8.1
#=GS A0A4W5QDW3_9TELE/158-352    AC A0A4W5QDW3.1
#=GS A0A671RBM7_9TELE/136-300    AC A0A671RBM7.1
#=GS A0A015IQY7_RHIIW/309-488    AC A0A015IQY7.1
#=GS A0A553R7A5_9TELE/231-426    AC A0A553R7A5.1
#=GS A0A0G2FW93_9PEZI/153-334    AC A0A0G2FW93.1
#=GS A0A3Q7Y0N9_URSAR/311-428    AC A0A3Q7Y0N9.1
#=GS A0A673SLX9_SURSU/233-425    AC A0A673SLX9.1
#=GS A0A3M6TYG1_POCDA/229-294    AC A0A3M6TYG1.1
#=GS A0A368H0M0_ANCCA/155-334    AC A0A368H0M0.1
#=GS A0A6F9CR43_9TELE/89-175     AC A0A6F9CR43.1
#=GS A0A091GQE3_BUCRH/107-292    AC A0A091GQE3.1
#=GS A0A4V3SFG0_OPIFE/167-346    AC A0A4V3SFG0.1
#=GS A0A2Y9DCW7_TRIMA/167-350    AC A0A2Y9DCW7.1
#=GS A0A091SNN0_PELCR/1-154      AC A0A091SNN0.1
#=GS A0A3Q7S9S4_VULVU/566-755    AC A0A3Q7S9S4.1
#=GS A0A6J0DYE5_PERMB/177-362    AC A0A6J0DYE5.1
#=GS A0A4Y9Z474_9APHY/163-342    AC A0A4Y9Z474.1
#=GS A0A565CSS2_9BRAS/238-416    AC A0A565CSS2.1
#=GS A0A3Q3C5L3_HAPBU/172-355    AC A0A3Q3C5L3.1
#=GS B5DJN9_DROPS/168-355        AC B5DJN9.2
#=GS A0A672FAJ6_SALFA/153-348    AC A0A672FAJ6.1
#=GS A0A139WMQ6_TRICA/519-681    AC A0A139WMQ6.1
#=GS J9F753_9SPIT/224-375        AC J9F753.1
#=GS A0A4D9B8P0_SALSN/232-417    AC A0A4D9B8P0.1
#=GS A0A091TPK9_PELCR/285-476    AC A0A091TPK9.1
#=GS F6QWS2_CIOIN/301-494        AC F6QWS2.2
#=GS A0A0C4EM38_PUCT1/161-345    AC A0A0C4EM38.1
#=GS A0A4U5U2V6_COLLU/207-393    AC A0A4U5U2V6.1
#=GS A0A1Y1UEH5_9TREE/305-479    AC A0A1Y1UEH5.1
#=GS A0A6G0HKW1_LARCR/155-336    AC A0A6G0HKW1.1
#=GS A0A6P8WGI5_DROAB/536-692    AC A0A6P8WGI5.1
#=GS A0A091VHD0_NIPNI/98-293     AC A0A091VHD0.1
#=GS G0PBU6_CAEBE/156-340        AC G0PBU6.1
#=GS A0A498RXJ8_ACAVI/272-468    AC A0A498RXJ8.1
#=GS A0A6P8ZLW4_THRPL/166-363    AC A0A6P8ZLW4.1
#=GS A0A2I3SLQ2_PANTR/112-299    AC A0A2I3SLQ2.1
#=GS G9P5R1_HYPAI/147-318        AC G9P5R1.1
#=GS A0A6A6L5Q1_HEVBR/142-329    AC A0A6A6L5Q1.1
#=GS A0A1X7S6C1_ZYMTR/150-334    AC A0A1X7S6C1.1
#=GS W2RVS6_9EURO/149-329        AC W2RVS6.1
#=GS A0A4R5XF13_9AGAM/163-341    AC A0A4R5XF13.1
#=GS A0A2K5Y3S1_MANLE/140-335    AC A0A2K5Y3S1.1
#=GS A0A093GRR4_STRCA/124-304    AC A0A093GRR4.1
#=GS A0A5F4W457_CALJA/181-361    AC A0A5F4W457.1
#=GS A0A0V1I8R6_9BILA/359-543    AC A0A0V1I8R6.1
#=GS A0A6P8WIA4_DROAB/63-233     AC A0A6P8WIA4.1
#=GS A0A376BCA1_9ASCO/167-340    AC A0A376BCA1.1
#=GS A0A5N5HYV4_9ROSA/178-359    AC A0A5N5HYV4.1
#=GS M3ZA61_NOMLE/118-300        AC M3ZA61.2
#=GS A0A077ZYJ1_STYLE/148-305    AC A0A077ZYJ1.1
#=GS A0A3P7IVX1_STRVU/1-106      AC A0A3P7IVX1.1
#=GS A0A1R1WZD5_9FUNG/559-748    AC A0A1R1WZD5.1
#=GS W5Q897_SHEEP/558-747        AC W5Q897.1
#=GS S9VLI6_9TRYP/153-333        AC S9VLI6.1
#=GS Q5EUD3_MAIZE/181-358        AC Q5EUD3.1
#=GS A0A3M6TC53_POCDA/318-510    AC A0A3M6TC53.1
#=GS A0A2K5PS71_CEBIM/312-504    AC A0A2K5PS71.1
#=GS G3WNM6_SARHA/163-358        AC G3WNM6.1
#=GS G3B0N2_CANTC/35-230         AC G3B0N2.1
#=GS A0A158PB68_ANGCA/159-327    AC A0A158PB68.1
#=GS V8P8K8_OPHHA/166-350        AC V8P8K8.1
#=GS A0A0A0AEH1_CHAVO/193-308    AC A0A0A0AEH1.1
#=GS A0A5J9USD5_9POAL/171-356    AC A0A5J9USD5.1
#=GS A0A091PWA8_HALAL/78-273     AC A0A091PWA8.1
#=GS A0A453KYK1_AEGTS/1-160      AC A0A453KYK1.1
#=GS A0A673JQB2_9TELE/167-350    AC A0A673JQB2.1
#=GS A0A084WN41_ANOSI/156-341    AC A0A084WN41.1
#=GS A0A3Q3VW10_MOLML/115-209    AC A0A3Q3VW10.1
#=GS A0A384A3E7_BALAS/114-301    AC A0A384A3E7.1
#=GS A0A0D2BBR4_9EURO/154-334    AC A0A0D2BBR4.1
#=GS T1EDN0_HELRO/159-344        AC T1EDN0.1
#=GS A0A2P4SVV7_BAMTH/175-361    AC A0A2P4SVV7.1
#=GS H2NWJ2_PONAB/158-336        AC H2NWJ2.1
#=GS A0A663DXN3_AQUCH/152-347    AC A0A663DXN3.1
#=GS A0A154PS83_DUFNO/127-313    AC A0A154PS83.1
#=GS A0A0D2EFK2_9EURO/154-333    AC A0A0D2EFK2.1
#=GS A0A0D3AKQ1_BRAOL/230-410    AC A0A0D3AKQ1.1
#=GS F6W4X0_MACMU/160-355        AC F6W4X0.2
#=GS G3T564_LOXAF/139-334        AC G3T564.1
#=GS A0A3Q7GKL8_SOLLC/460-645    AC A0A3Q7GKL8.1
#=GS A0A6P6P4T6_CARAU/166-350    AC A0A6P6P4T6.1
#=GS A0A2T9XX77_9FUNG/157-335    AC A0A2T9XX77.1
#=GS A0A026VXL5_OOCBI/160-352    AC A0A026VXL5.1
#=GS A0A6I9HG32_GEOFO/198-381    AC A0A6I9HG32.1
#=GS A0A430QG20_SCHBO/118-263    AC A0A430QG20.1
#=GS A0A0L9UNA2_PHAAN/216-395    AC A0A0L9UNA2.1
#=GS A0A6J3DVD5_AYTFU/179-364    AC A0A6J3DVD5.1
#=GS F9XN30_ZYMTI/150-296        AC F9XN30.1
#=GS A0A3B0JX01_DROGU/169-355    AC A0A3B0JX01.1
#=GS A0A2I0TB52_LIMLA/201-269    AC A0A2I0TB52.1
#=GS A0A094KWZ0_ANTCR/78-273     AC A0A094KWZ0.1
#=GS A0A177EH04_9MICR/79-258     AC A0A177EH04.1
#=GS A0A225ASQ4_9EURO/28-207     AC A0A225ASQ4.1
#=GS A0A673JSU2_9TELE/154-349    AC A0A673JSU2.1
#=GS A0A0D1ZUT4_EXOME/155-333    AC A0A0D1ZUT4.1
#=GS A0A091EH80_FUKDA/183-370    AC A0A091EH80.1
#=GS A0A430QEZ6_SCHBO/32-217     AC A0A430QEZ6.1
#=GS A0A2V3IQY8_9FLOR/137-321    AC A0A2V3IQY8.1
#=GS A0A0K0EHL6_STRER/388-567    AC A0A0K0EHL6.1
#=GS A0A1D6EAK0_MAIZE/181-338    AC A0A1D6EAK0.1
#=GS V4B7J2_LOTGI/130-315        AC V4B7J2.1
#=GS A0A0V1P988_9BILA/172-356    AC A0A0V1P988.1
#=GS A0A3M9YE13_9PEZI/163-346    AC A0A3M9YE13.1
#=GS A0A094IAU3_9PEZI/153-334    AC A0A094IAU3.1
#=GS G0QWF9_ICHMG/164-344        AC G0QWF9.1
#=GS A0A1S2YK44_CICAR/238-418    AC A0A1S2YK44.1
#=GS A0A452CMR3_BALAS/17-197     AC A0A452CMR3.1
#=GS A0A0C2H1Q5_9BILA/154-300    AC A0A0C2H1Q5.1
#=GS A0A4W2DLA9_BOBOX/376-563    AC A0A4W2DLA9.1
#=GS A0A072V0J2_MEDTR/171-356    AC A0A072V0J2.1
#=GS A0A671XZ04_SPAAU/155-253    AC A0A671XZ04.1
#=GS A0A2Y9J735_ENHLU/167-350    AC A0A2Y9J735.1
#=GS A0A6A4KID6_APOLU/154-341    AC A0A6A4KID6.1
#=GS A0A1W0W933_HYPDU/203-393    AC A0A1W0W933.1
#=GS A0A1D6PSB9_MAIZE/1-174      AC A0A1D6PSB9.1
#=GS A0A2T7CV45_9POAL/173-357    AC A0A2T7CV45.1
#=GS A0A4W6FX89_LATCA/166-331    AC A0A4W6FX89.1
#=GS A0A0N4TMK8_BRUPA/179-362    AC A0A0N4TMK8.1
#=GS A0A453C0R0_AEGTS/1-93       AC A0A453C0R0.1
#=GS A0A1R2BWK7_9CILI/162-348    AC A0A1R2BWK7.1
#=GS A0A517L6X8_9PEZI/149-330    AC A0A517L6X8.1
#=GS A0A2K6NTF1_RHIRO/119-303    AC A0A2K6NTF1.1
#=GS A0A6G0TXF6_APHGL/724-862    AC A0A6G0TXF6.1
#=GS A0A2K5LL77_CERAT/310-502    AC A0A2K5LL77.1
#=GS A2E3N0_TRIVA/159-277        AC A2E3N0.1
#=GS A0A663DQ65_AQUCH/170-353    AC A0A663DQ65.1
#=GS A0A5N4AFY5_PHOPY/165-348    AC A0A5N4AFY5.1
#=GS A0A2G3CAV8_CAPCH/212-383    AC A0A2G3CAV8.1
#=GS C3YEU5_BRAFL/165-348        AC C3YEU5.1
#=GS A0A5E4QFH3_9NEOP/515-671    AC A0A5E4QFH3.1
#=GS A0A6G0UYX8_9BILA/158-342    AC A0A6G0UYX8.1
#=GS A0A3P8URX0_CYNSE/207-395    AC A0A3P8URX0.1
#=GS A0A0B2RLQ7_GLYSO/170-356    AC A0A0B2RLQ7.1
#=GS A0A368H0I2_ANCCA/333-458    AC A0A368H0I2.1
#=GS A0A139WM70_TRICA/268-444    AC A0A139WM70.1
#=GS A0A669P9G2_PHACC/192-372    AC A0A669P9G2.1
#=GS A0A388KS53_CHABU/543-740    AC A0A388KS53.1
#=GS H3CG96_TETNG/158-367        AC H3CG96.1
#=GS A0A0V0WKG0_9BILA/156-340    AC A0A0V0WKG0.1
#=GS A4ICD5_LEIIN/180-331        AC A4ICD5.1
#=GS A0A151JC51_9HYME/110-303    AC A0A151JC51.1
#=GS A0A0L7RBK1_9HYME/157-341    AC A0A0L7RBK1.1
#=GS A0A2I4F7Q0_JUGRE/106-291    AC A0A2I4F7Q0.1
#=GS A0A671XV39_SPAAU/149-344    AC A0A671XV39.1
#=GS A0A1U7WNF6_NICSY/240-419    AC A0A1U7WNF6.1
#=GS W6MT59_9ASCO/168-352        AC W6MT59.1
#=GS A0A670XV76_PSETE/495-608    AC A0A670XV76.1
#=GS A8XFJ2_CAEBR/154-343        AC A8XFJ2.2
#=GS A0A0S3SCI7_PHAAN/240-421    AC A0A0S3SCI7.1
#=GS A0A6P4XEL6_BRABE/158-342    AC A0A6P4XEL6.1
#=GS A0A443HHR8_BYSSP/157-338    AC A0A443HHR8.1
#=GS A0A0A1T3H9_9HYPO/173-312    AC A0A0A1T3H9.1
#=GS C4R938_KOMPG/159-307        AC C4R938.1
#=GS A0A6P4FVR0_DRORH/520-676    AC A0A6P4FVR0.1
#=GS A0A7E4RZA9_CIMLE/1356-1530  AC A0A7E4RZA9.1
#=GS A0A395MDF3_9HYPO/444-555    AC A0A395MDF3.1
#=GS A0A6P8GK10_CLUHA/153-333    AC A0A6P8GK10.1
#=GS A0A317UTU2_9EURO/156-337    AC A0A317UTU2.1
#=GS A0A5G2R124_PIG/157-338      AC A0A5G2R124.1
#=GS A0A1U7Y8H4_NICSY/206-391    AC A0A1U7Y8H4.1
#=GS A0A099Z0B2_TINGU/105-289    AC A0A099Z0B2.1
#=GS A0A498J5B8_MALDO/169-354    AC A0A498J5B8.1
#=GS A0A0N4Y7Q9_NIPBR/280-462    AC A0A0N4Y7Q9.1
#=GS A0A091DA73_FUKDA/887-1079   AC A0A091DA73.1
#=GS A0A6F9CM41_9TELE/254-446    AC A0A6F9CM41.1
#=GS A0A3Q1AI32_AMPOC/117-290    AC A0A3Q1AI32.1
#=GS A0A6A4V5W3_AMPAM/211-400    AC A0A6A4V5W3.1
#=GS A0A5N4E8V9_CAMDR/49-254     AC A0A5N4E8V9.1
#=GS A0A4Q2DXT2_9AGAR/159-339    AC A0A4Q2DXT2.1
#=GS M4ASR6_XIPMA/48-235         AC M4ASR6.2
#=GS U5FSA3_POPTR/171-347        AC U5FSA3.1
#=GS A0A2K6FJF9_PROCO/163-347    AC A0A2K6FJF9.1
#=GS A0A3Q2ZU64_KRYMA/175-358    AC A0A3Q2ZU64.1
#=GS A0A674ETR0_SALTR/191-376    AC A0A674ETR0.1
#=GS Q6P3G9_DANRE/167-350        AC Q6P3G9.1
#=GS A0A401PWZ3_SCYTO/175-367    AC A0A401PWZ3.1
#=GS A0A3Q4HL07_NEOBR/172-355    AC A0A3Q4HL07.1
#=GS A0A6I9R013_ELAGV/211-395    AC A0A6I9R013.1
#=GS A0A0L6X253_9AGAR/681-864    AC A0A0L6X253.1
#=GS A0A158QE37_HYMDI/159-360    AC A0A158QE37.1
#=GS A0A093NWL4_PYGAD/282-473    AC A0A093NWL4.1
#=GS A0A3P8ZEF8_ESOLU/49-233     AC A0A3P8ZEF8.2
#=GS A0A287TFR7_HORVV/44-152     AC A0A287TFR7.1
#=GS A0A2K5MNJ2_CERAT/158-338    AC A0A2K5MNJ2.1
#=GS A0A7E6DFU6_9CHIR/105-288    AC A0A7E6DFU6.1
#=GS A0A0D9YKX1_9ORYZ/213-400    AC A0A0D9YKX1.1
#=GS A0A0L1IGX2_PLAFA/1-144      AC A0A0L1IGX2.1
#=GS A0A0C2FA46_9BILA/104-226    AC A0A0C2FA46.1
#=GS A0A6P3WRD4_DINQU/555-714    AC A0A6P3WRD4.1
#=GS A0A4T0WX77_9ASCO/172-358    AC A0A4T0WX77.1
#=GS B4IXK8_DROGR/157-341        AC B4IXK8.1
#=GS A0A091JSN6_COLST/148-331    AC A0A091JSN6.1
#=GS A0A2K2BZS8_POPTR/214-399    AC A0A2K2BZS8.1
#=GS A0A6G1PPI4_9TELE/168-351    AC A0A6G1PPI4.1
#=GS A0A3P8XWC7_ESOLU/159-342    AC A0A3P8XWC7.1
#=GS A0A5N3XQ55_MUNRE/530-719    AC A0A5N3XQ55.1
#=GS A0A1D6GXP6_MAIZE/120-301    AC A0A1D6GXP6.1
#=GS A0A6H5GXT3_9HEMI/159-346    AC A0A6H5GXT3.1
#=GS A0A5N5PN27_9PEZI/153-334    AC A0A5N5PN27.1
#=GS A0A183MT79_9TREM/157-340    AC A0A183MT79.1
#=GS A0A0C9UCC4_SPHS4/338-486    AC A0A0C9UCC4.1
#=GS A0A6G1BBS8_CROCR/111-291    AC A0A6G1BBS8.1
#=GS A0A2G9HUP4_9LAMI/169-352    AC A0A2G9HUP4.1
#=GS U3JND9_FICAL/180-366        AC U3JND9.1
#=GS A0A1R1Y183_9FUNG/175-372    AC A0A1R1Y183.1
#=GS A0A6P6JRB1_CARAU/156-335    AC A0A6P6JRB1.1
#=GS A0A7M7G6G1_NASVI/160-344    AC A0A7M7G6G1.1
#=GS A0A663MNX0_ATHCN/111-306    AC A0A663MNX0.1
#=GS A0A6J2J2U8_9PASS/191-377    AC A0A6J2J2U8.1
#=GS A0A6I9HSR7_GEOFO/86-270     AC A0A6I9HSR7.1
#=GS A0A2A4J7L8_HELVI/158-343    AC A0A2A4J7L8.1
#=GS A0A2K5EAB7_AOTNA/256-448    AC A0A2K5EAB7.1
#=GS B4QC45_DROSI/158-343        AC B4QC45.1
#=GS A0A671TLZ6_SPAAU/159-343    AC A0A671TLZ6.1
#=GS A0A4Q4TL44_9PEZI/84-263     AC A0A4Q4TL44.1
#=GS G3ND07_GASAC/159-339        AC G3ND07.1
#=GS A0A212CND6_CEREH/27-124     AC A0A212CND6.1
#=GS A0A6Q2XF62_ESOLU/139-332    AC A0A6Q2XF62.1
#=GS A0A091RIQ2_MERNU/106-291    AC A0A091RIQ2.1
#=GS A0A6Q2Y3M6_ESOLU/178-303    AC A0A6Q2Y3M6.1
#=GS A0A2I2UW53_FELCA/1-150      AC A0A2I2UW53.2
#=GS A0A5D2V2K0_GOSMU/187-368    AC A0A5D2V2K0.1
#=GS A0A674MWI5_TAKRU/152-336    AC A0A674MWI5.1
#=GS A0A498LDJ1_LABRO/744-926    AC A0A498LDJ1.1
#=GS A0A2Y9ES38_PHYMC/63-250     AC A0A2Y9ES38.1
#=GS A0A026WDR3_OOCBI/214-320    AC A0A026WDR3.1
#=GS A0A0D1VX08_9EURO/155-333    AC A0A0D1VX08.1
#=GS A0A1U7YZ81_NELNU/173-358    AC A0A1U7YZ81.1
#=GS A0A453MNT6_AEGTS/44-225     AC A0A453MNT6.1
#=GS A0A091SS34_NESNO/41-225     AC A0A091SS34.1
#=GS A0A3P8STV8_AMPPE/154-335    AC A0A3P8STV8.1
#=GS A0BU64_PARTE/103-293        AC A0BU64.1
#=GS F6WGL8_HORSE/828-1020       AC F6WGL8.3
#=GS A0A0E0KQT9_ORYPU/190-365    AC A0A0E0KQT9.1
#=GS J3LDS5_ORYBR/167-354        AC J3LDS5.1
#=GS F6Q3U2_MONDO/163-347        AC F6Q3U2.1
#=GS A0A3Q7QCK5_CALUR/565-754    AC A0A3Q7QCK5.1
#=GS A0A6P8RQT8_GEOSA/486-675    AC A0A6P8RQT8.1
#=GS A0A2K5IJG5_COLAP/179-366    AC A0A2K5IJG5.1
#=GS H3A1C6_LATCH/161-355        AC H3A1C6.1
#=GS A0A7E5A0H4_PANRE/274-470    AC A0A7E5A0H4.1
#=GS A0A6J1YTS3_ACIJB/163-347    AC A0A6J1YTS3.1
#=GS A0A226P464_COLVI/193-379    AC A0A226P464.1
#=GS F1NPK6_CHICK/73-259         AC F1NPK6.5
#=GS A0A671L1X3_9TELE/147-331    AC A0A671L1X3.1
#=GS A0A0E0FZQ4_ORYNI/284-376    AC A0A0E0FZQ4.1
#=GS A0A665UWN4_ECHNA/156-340    AC A0A665UWN4.1
#=GS A0A0E0CLX1_9ORYZ/165-353    AC A0A0E0CLX1.1
#=GS T0MKD6_CAMFR/64-251         AC T0MKD6.1
#=GS W6UL66_ECHGR/421-567        AC W6UL66.1
#=GS A0A5P1E510_ASPOF/176-361    AC A0A5P1E510.1
#=GS A0A397TX59_9GLOM/298-484    AC A0A397TX59.1
#=GS G2XHB8_VERDV/93-352         AC G2XHB8.1
#=GS A0A1V4KTK4_PATFA/221-407    AC A0A1V4KTK4.1
#=GS A0A5E4AB37_MARMO/117-304    AC A0A5E4AB37.1
#=GS A0A0N4XJT6_NIPBR/51-230     AC A0A0N4XJT6.1
#=GS A0A0V1NB29_9BILA/193-377    AC A0A0V1NB29.1
#=GS PDIA1_HUMAN/161-345         AC P07237.3
#=GS PDIA1_HUMAN/161-345         DR PDB; 6I7S B; 161-345;
#=GS PDIA1_HUMAN/161-345         DR PDB; 3UEM A; 161-345;
#=GS PDIA1_HUMAN/161-345         DR PDB; 3BJ5 A; 219-328;
#=GS PDIA1_HUMAN/161-345         DR PDB; 6I7S A; 161-345;
#=GS PDIA1_HUMAN/161-345         DR PDB; 4EL1 A; 161-345;
#=GS PDIA1_HUMAN/161-345         DR PDB; 1BJX A; 144-228;
#=GS PDIA1_HUMAN/161-345         DR PDB; 2K18 A; 32-216;
#=GS PDIA1_HUMAN/161-345         DR PDB; 4EKZ A; 161-345;
#=GS PDIA1_HUMAN/161-345         DR PDB; 4EL1 B; 161-345;
#=GS PDIA1_HUMAN/161-345         DR PDB; 4JU5 A; 161-345;
#=GS PDIA1_HUMAN/161-345         DR PDB; 2BJX A; 144-228;
#=GS PDIA1_HUMAN/161-345         DR PDB; 4JU5 B; 161-345;
#=GS A0A6J1WLN9_GALME/505-661    AC A0A6J1WLN9.1
#=GS A0A6P7WUJ7_9AMPH/291-408    AC A0A6P7WUJ7.1
#=GS A0A167FDN5_9ASCO/152-341    AC A0A167FDN5.1
#=GS A0A369SAV2_9METZ/158-343    AC A0A369SAV2.1
#=GS A0A5N6Q7L5_9ASTR/217-402    AC A0A5N6Q7L5.1
#=GS A0A091NQ55_APAVI/44-228     AC A0A091NQ55.1
#=GS A0A067QC73_9AGAM/157-341    AC A0A067QC73.1
#=GS G3P7R6_GASAC/155-349        AC G3P7R6.1
#=GS A0A7P0T8C0_HUMAN/134-318    AC A0A7P0T8C0.1
#=GS A0A383VX33_TETOB/263-413    AC A0A383VX33.1
#=GS A0A5N5KTD8_9PEZI/157-339    AC A0A5N5KTD8.1
#=GS A0A0V0RST0_9BILA/543-717    AC A0A0V0RST0.1
#=GS A0A672S0V7_SINGR/152-347    AC A0A672S0V7.1
#=GS A0A1L8HG37_XENLA/287-403    AC A0A1L8HG37.1
#=GS A0A6J1NZI3_BICAN/304-461    AC A0A6J1NZI3.1
#=GS A0A3P8V0B2_CYNSE/170-354    AC A0A3P8V0B2.1
#=GS A0A196SI84_BLAHN/156-333    AC A0A196SI84.1
#=GS A0A663MNL5_ATHCN/112-307    AC A0A663MNL5.1
#=GS A0A2Y9HQQ7_NEOSC/179-364    AC A0A2Y9HQQ7.1
#=GS D0P3I9_PHYIT/177-342        AC D0P3I9.1
#=GS A0A6A5FSA1_PERFL/159-342    AC A0A6A5FSA1.1
#=GS W5JR44_ANODA/550-708        AC W5JR44.1
#=GS M3YYT5_MUSPF/158-338        AC M3YYT5.1
#=GS Q6PST0_ANCCA/157-341        AC Q6PST0.1
#=GS A0A4D9E454_9SAUR/200-395    AC A0A4D9E454.1
#=GS A0A137QTJ2_9AGAR/286-451    AC A0A137QTJ2.1
#=GS A0A0V0RHV7_9BILA/622-812    AC A0A0V0RHV7.1
#=GS A0A0D2XY27_FUSO4/134-314    AC A0A0D2XY27.1
#=GS M4CSC8_BRARP/236-415        AC M4CSC8.1
#=GS A0A1E5W2F4_9POAL/205-390    AC A0A1E5W2F4.1
#=GS A0A7M7L8T6_APIME/565-721    AC A0A7M7L8T6.1
#=GS A0A287AXV2_PIG/539-728      AC A0A287AXV2.2
#=GS A0A3R7FXU3_9STRA/508-681    AC A0A3R7FXU3.1
#=GS A0A4D9E882_9SAUR/538-727    AC A0A4D9E882.1
#=GS A0A0K0D370_ANGCA/129-313    AC A0A0K0D370.1
#=GS A0A1C1CA88_9EURO/153-348    AC A0A1C1CA88.1
#=GS A0A1B9GBS9_9TREE/154-344    AC A0A1B9GBS9.1
#=GS A0A0B1TVF9_OESDE/157-341    AC A0A0B1TVF9.1
#=GS A0A3M7M6U1_9PLEO/147-328    AC A0A3M7M6U1.1
#=GS A0A4Y9YLB8_9AGAM/339-496    AC A0A4Y9YLB8.1
#=GS A0A1V2L9S2_CYBFA/169-346    AC A0A1V2L9S2.1
#=GS A0A452C5L7_BALAS/167-346    AC A0A452C5L7.1
#=GS A0A6J3RXP2_TURTR/313-505    AC A0A6J3RXP2.1
#=GS A0A4W5RCF9_9TELE/149-344    AC A0A4W5RCF9.1
#=GS A0A094KIU2_ANTCR/1-139      AC A0A094KIU2.1
#=GS A0A2K3P665_TRIPR/141-314    AC A0A2K3P665.1
#=GS A0A672KIL7_SINGR/196-313    AC A0A672KIL7.1
#=GS G3SC18_GORGO/38-233         AC G3SC18.2
#=GS A0A1R3GSQ8_COCAP/168-364    AC A0A1R3GSQ8.1
#=GS A0A287TFQ6_HORVV/36-144     AC A0A287TFQ6.1
#=GS X0BZD8_FUSOX/150-330        AC X0BZD8.1
#=GS A0A4W2CAQ4_BOBOX/160-355    AC A0A4W2CAQ4.1
#=GS A0A0K0EZE6_STRVS/268-465    AC A0A0K0EZE6.1
#=GS A0A182H2M9_AEDAL/161-346    AC A0A182H2M9.1
#=GS A0A212DA58_CEREH/46-160     AC A0A212DA58.1
#=GS A0A4W2DKS1_BOBOX/60-175     AC A0A4W2DKS1.1
#=GS A0A0C9Z023_9AGAM/160-345    AC A0A0C9Z023.1
#=GS A0A673NLH8_9TELE/306-498    AC A0A673NLH8.1
#=GS A0A3L8SXR2_CHLGU/318-509    AC A0A3L8SXR2.1
#=GS A0A2I3MI27_PAPAN/4-149      AC A0A2I3MI27.1
#=GS C3ZHE5_BRAFL/273-464        AC C3ZHE5.1
#=GS G1T3Q6_RABIT/533-722        AC G1T3Q6.2
#=GS A0A6J2KNQ0_BOMMA/718-842    AC A0A6J2KNQ0.1
#=GS I1IAF4_BRADI/191-366        AC I1IAF4.1
#=GS R0ING6_9BRAS/169-354        AC R0ING6.1
#=GS A0A672R544_SINGR/164-347    AC A0A672R544.1
#=GS A0A671Q7U2_9TELE/159-345    AC A0A671Q7U2.1
#=GS A0A0V0QFG3_PSEPJ/252-439    AC A0A0V0QFG3.1
#=GS A0A446RWJ2_TRITD/152-337    AC A0A446RWJ2.1
#=GS A0A1L7X6C7_9HELO/149-330    AC A0A1L7X6C7.1
#=GS A0A0B2W5L0_TOXCA/319-471    AC A0A0B2W5L0.1
#=GS A0A6P8B9B7_MAGGR/111-300    AC A0A6P8B9B7.1
#=GS A0A452RQE3_URSAM/180-365    AC A0A452RQE3.1
#=GS A0A673ZQE8_SALTR/133-316    AC A0A673ZQE8.1
#=GS A0A059BYE2_EUCGR/170-355    AC A0A059BYE2.1
#=GS H3DLZ9_TETNG/168-351        AC H3DLZ9.1
#=GS B4GMS2_DROPE/164-351        AC B4GMS2.1
#=GS A0A1A6H707_NEOLE/182-385    AC A0A1A6H707.1
#=GS K1P6B3_CRAGI/132-317        AC K1P6B3.1
#=GS A0A6G1CN29_9ORYZ/205-389    AC A0A6G1CN29.1
#=GS A0A0B1RUU9_OESDE/59-178     AC A0A0B1RUU9.1
#=GS X6NRX3_RETFI/169-324        AC X6NRX3.1
#=GS A0A7M7G183_NASVI/160-349    AC A0A7M7G183.1
#=GS F0ZE15_DICPU/262-371        AC F0ZE15.1
#=GS A0A2T7PXY4_POMCA/164-346    AC A0A2T7PXY4.1
#=GS A0A3Q3X2F3_MOLML/149-343    AC A0A3Q3X2F3.1
#=GS A0A0D0DE12_9AGAM/178-363    AC A0A0D0DE12.1
#=GS A0A6P4FPE1_DRORH/532-689    AC A0A6P4FPE1.1
#=GS A0A674P991_TAKRU/82-259     AC A0A674P991.1
#=GS L5KKW8_PTEAL/64-251         AC L5KKW8.1
#=GS A0A3B1JAG1_ASTMX/159-343    AC A0A3B1JAG1.1
#=GS H0X009_OTOGA/311-504        AC H0X009.1
#=GS E2RAG3_CANLF/509-698        AC E2RAG3.3
#=GS A0A482VRT6_9CUCU/157-344    AC A0A482VRT6.1
#=GS A0A367J8Z4_RHIAZ/152-334    AC A0A367J8Z4.1
#=GS A0A3P7LD33_STRVU/15-213     AC A0A3P7LD33.1
#=GS A0A668STI0_OREAU/160-354    AC A0A668STI0.1
#=GS A0A022PVK2_ERYGU/39-224     AC A0A022PVK2.1
#=GS A0A340YER1_LIPVE/313-505    AC A0A340YER1.1
#=GS A0A0D8XFK9_DICVI/161-340    AC A0A0D8XFK9.1
#=GS A0A1C7LPB0_GRIFR/329-494    AC A0A1C7LPB0.1
#=GS A0A6A1Q0B4_BALPH/104-299    AC A0A6A1Q0B4.1
#=GS A0A091VAG3_NIPNI/107-292    AC A0A091VAG3.1
#=GS A0A0A0ARP2_CHAVO/123-304    AC A0A0A0ARP2.1
#=GS A0A2A4IUM7_HELVI/169-355    AC A0A2A4IUM7.1
#=GS A0A6A4IY46_APOLU/142-330    AC A0A6A4IY46.1
#=GS A0A444UE38_ACIRT/115-210    AC A0A444UE38.1
#=GS A0A5A9NLI9_9TELE/142-330    AC A0A5A9NLI9.1
#=GS A0A2U3X6R4_LEPWE/158-338    AC A0A2U3X6R4.1
#=GS A0A6P4I6Z9_DROKI/534-691    AC A0A6P4I6Z9.1
#=GS A0A2K5DQX4_AOTNA/160-344    AC A0A2K5DQX4.1
#=GS A0A669Q390_PHACC/192-378    AC A0A669Q390.1
#=GS A0A2R9B6U4_PANPA/118-301    AC A0A2R9B6U4.1
#=GS A0A194X6N3_9HELO/149-330    AC A0A194X6N3.1
#=GS A0A3P8YHM6_ESOLU/504-663    AC A0A3P8YHM6.1
#=GS A0A445JX44_GLYSO/198-308    AC A0A445JX44.1
#=GS A0A446UZK3_TRITD/238-417    AC A0A446UZK3.1
#=GS A0A668SX24_OREAU/136-319    AC A0A668SX24.1
#=GS A0A6A6L674_HEVBR/1047-1179  AC A0A6A6L674.1
#=GS A0A074XB55_AURPU/151-331    AC A0A074XB55.1
#=GS R0KQQ5_ANAPL/110-293        AC R0KQQ5.1
#=GS A0A0V0TB42_9BILA/153-341    AC A0A0V0TB42.1
#=GS A0A0V0XZI1_TRIPS/275-472    AC A0A0V0XZI1.1
#=GS A0A1Y2IT35_PYCCO/153-341    AC A0A1Y2IT35.1
#=GS ER442_CAEEL/162-342         AC Q17688.2
#=GS A0A2G5UGF0_9PELO/279-476    AC A0A2G5UGF0.1
#=GS A0A2K6AG19_MANLE/311-503    AC A0A2K6AG19.1
#=GS A0A2P6RWY6_ROSCH/212-397    AC A0A2P6RWY6.1
#=GS A0A087HA10_ARAAL/207-393    AC A0A087HA10.1
#=GS A0A340WEK9_LIPVE/539-728    AC A0A340WEK9.1
#=GS A0A668UMV7_OREAU/89-258     AC A0A668UMV7.1
#=GS A0A093F5Q6_GAVST/513-702    AC A0A093F5Q6.1
#=GS A0A024G9A0_9STRA/173-353    AC A0A024G9A0.1
#=GS H2ZN94_CIOSA/1-127          AC H2ZN94.1
#=GS A0A061FK17_THECC/166-341    AC A0A061FK17.1
#=GS A0A6P4IMH0_DROKI/534-691    AC A0A6P4IMH0.1
#=GS A0A3M6US65_POCDA/168-362    AC A0A3M6US65.1
#=GS A0A1U7WU37_NICSY/179-361    AC A0A1U7WU37.1
#=GS A0A6D2JSH9_9BRAS/235-416    AC A0A6D2JSH9.1
#=GS A0A2K6SY72_SAIBB/64-248     AC A0A2K6SY72.1
#=GS J9IKE9_9SPIT/247-431        AC J9IKE9.1
#=GS A0A091QCN7_MERNU/2-139      AC A0A091QCN7.1
#=GS A0A420S9F1_FUSOX/155-336    AC A0A420S9F1.1
#=GS B4MG91_DROVI/167-353        AC B4MG91.1
#=GS A0A0D2UTD7_GOSRA/169-354    AC A0A0D2UTD7.1
#=GS A0A060WV10_ONCMY/159-338    AC A0A060WV10.1
#=GS E5SKT3_TRISP/153-341        AC E5SKT3.1
#=GS A0A2I0MJY4_COLLI/90-259     AC A0A2I0MJY4.1
#=GS A0A044UZ26_ONCVO/13-137     AC A0A044UZ26.1
#=GS K8ECS1_9CHLO/216-390        AC K8ECS1.1
#=GS A0A6J1JQY3_CUCMA/171-355    AC A0A6J1JQY3.1
#=GS A0A7M7H788_NASVI/1548-1711  AC A0A7M7H788.1
#=GS A0A212CZY3_CEREH/133-343    AC A0A212CZY3.1
#=GS A0A2K5CA35_AOTNA/167-350    AC A0A2K5CA35.1
#=GS A0A087GCI9_ARAAL/243-420    AC A0A087GCI9.1
#=GS A0A6P3FDD8_OCTDE/241-428    AC A0A6P3FDD8.1
#=GS A0A2I4EJG0_JUGRE/225-405    AC A0A2I4EJG0.1
#=GS A0A509AJZ7_PLABA/165-331    AC A0A509AJZ7.1
#=GS A0A078HLV6_BRANA/167-352    AC A0A078HLV6.1
#=GS A0A4D9EDG8_9SAUR/226-411    AC A0A4D9EDG8.1
#=GS A0A6J3H3Y9_SAPAP/224-411    AC A0A6J3H3Y9.1
#=GS A0A139H259_9PEZI/152-335    AC A0A139H259.1
#=GS A0A5E4BMP3_MARMO/160-355    AC A0A5E4BMP3.1
#=GS A0A6J0NL61_RAPSA/163-347    AC A0A6J0NL61.1
#=GS A0A0N8K318_SCLFO/159-343    AC A0A0N8K318.1
#=GS S4RZC7_PETMA/131-312        AC S4RZC7.1
#=GS I1IXX6_BRADI/174-368        AC I1IXX6.1
#=GS A0A3Q7GX88_SOLLC/171-355    AC A0A3Q7GX88.1
#=GS A0A6J0L883_RAPSA/168-353    AC A0A6J0L883.1
#=GS A0A0J7NV70_LASNI/157-343    AC A0A0J7NV70.1
#=GS A0A663LTL7_ATHCN/112-292    AC A0A663LTL7.1
#=GS A0A2R9BNM4_PANPA/64-251     AC A0A2R9BNM4.1
#=GS NXN_HUMAN/233-424           AC Q6DKJ4.2
#=GS A0A6P5Z628_DURZI/106-257    AC A0A6P5Z628.1
#=GS T0KZ70_COLGC/208-379        AC T0KZ70.1
#=GS A0A0L0TEE9_ALLM3/142-322    AC A0A0L0TEE9.1
#=GS A0A2I4F7P9_JUGRE/141-326    AC A0A2I4F7P9.1
#=GS A0A6P6HH21_PUMCO/534-677    AC A0A6P6HH21.1
#=GS G1SQ41_RABIT/64-251         AC G1SQ41.1
#=GS A0A5E4MA94_9HEMI/156-342    AC A0A5E4MA94.1
#=GS A0A0V0ZXI4_9BILA/193-368    AC A0A0V0ZXI4.1
#=GS A0A1X7VCQ9_AMPQE/158-343    AC A0A1X7VCQ9.1
#=GS G3IDT6_CRIGR/309-501        AC G3IDT6.1
#=GS A0A443SS76_9ACAR/158-342    AC A0A443SS76.1
#=GS C0NCH9_AJECG/169-350        AC C0NCH9.1
#=GS A0A1S7UKG8_ROSNE/157-338    AC A0A1S7UKG8.1
#=GS A0A212DB37_CEREH/112-296    AC A0A212DB37.1
#=GS A0A6J3J630_SAPAP/89-269     AC A0A6J3J630.1
#=GS A0A6P5TGG8_PRUAV/183-361    AC A0A6P5TGG8.1
#=GS M2VA21_COCH5/150-331        AC M2VA21.1
#=GS A0A087XBK5_POEFO/156-349    AC A0A087XBK5.1
#=GS A0A445JX41_GLYSO/198-308    AC A0A445JX41.1
#=GS A7SG87_NEMVE/160-344        AC A7SG87.1
#=GS A0A078IDV2_BRANA/202-387    AC A0A078IDV2.1
#=GS Q9N4L6_CAEEL/160-344        AC Q9N4L6.2
#=GS A0A1S4DNJ8_TOBAC/183-360    AC A0A1S4DNJ8.1
#=GS A0A2Y9GX23_NEOSC/158-338    AC A0A2Y9GX23.1
#=GS A0A1J8QE83_9AGAM/165-347    AC A0A1J8QE83.1
#=GS A0A096NE18_PAPAN/287-479    AC A0A096NE18.2
#=GS A0A2Z6QRK9_9GLOM/323-498    AC A0A2Z6QRK9.1
#=GS A0A2K5RIR3_CEBIM/167-350    AC A0A2K5RIR3.1
#=GS A0A445HMH9_GLYSO/234-414    AC A0A445HMH9.1
#=GS A0A7N4P326_SARHA/163-347    AC A0A7N4P326.1
#=GS A0A2J6M9X3_LACSA/171-367    AC A0A2J6M9X3.1
#=GS A0A287II23_HORVV/7-119      AC A0A287II23.1
#=GS A0A6J3KTJ0_9HYME/152-346    AC A0A6J3KTJ0.1
#=GS A0A093BQI0_TAUER/1-154      AC A0A093BQI0.1
#=GS A0A5M6BT20_9TREE/151-337    AC A0A5M6BT20.1
#=GS A0A485NQT8_LYNPA/17-197     AC A0A485NQT8.1
#=GS A0A2K6E9U7_MACNE/180-365    AC A0A2K6E9U7.1
#=GS A0A2K6GRI8_PROCO/142-324    AC A0A2K6GRI8.1
#=GS G1N8M6_MELGA/159-339        AC G1N8M6.1
#=GS A0A1R2ATB7_9CILI/156-335    AC A0A1R2ATB7.1
#=GS A0A315W8A8_GAMAF/616-809    AC A0A315W8A8.1
#=GS A0A4W4FKY5_ELEEL/41-218     AC A0A4W4FKY5.1
#=GS A0A195FV70_9HYME/569-727    AC A0A195FV70.1
#=GS A0A672Q078_SINGR/302-489    AC A0A672Q078.1
#=GS T1LNZ4_TRIUA/73-256         AC T1LNZ4.1
#=GS A0A669Q1Q6_PHACC/510-677    AC A0A669Q1Q6.1
#=GS A0A663N5L3_ATHCN/35-212     AC A0A663N5L3.1
#=GS A0A667XS38_9TELE/155-349    AC A0A667XS38.1
#=GS PDIA2_PONAB/179-366         AC Q5RCH2.1
#=GS A0A3S3Q9L4_9ACAR/348-542    AC A0A3S3Q9L4.1
#=GS A0A341ACI5_NEOAA/160-355    AC A0A341ACI5.1
#=GS A0A1L8EQH7_XENLA/176-361    AC A0A1L8EQH7.1
#=GS A0A6P4FPD1_DRORH/532-688    AC A0A6P4FPD1.1
#=GS A0A446RWJ6_TRITD/176-361    AC A0A446RWJ6.1
#=GS A0A2Y9DWL2_TRIMA/312-504    AC A0A2Y9DWL2.1
#=GS A0A670YXH1_PSETE/155-346    AC A0A670YXH1.1
#=GS L9LCQ8_TUPCH/305-498        AC L9LCQ8.1
#=GS V8PAX9_OPHHA/192-303        AC V8PAX9.1
#=GS A0A3B6B090_WHEAT/178-354    AC A0A3B6B090.1
#=GS A0A452CPU2_BALAS/539-728    AC A0A452CPU2.1
#=GS A0A7N6FJ38_ANATE/131-293    AC A0A7N6FJ38.1
#=GS A0A0D3ED69_BRAOL/281-459    AC A0A0D3ED69.1
#=GS A0A445L4Y0_GLYSO/170-356    AC A0A445L4Y0.1
#=GS A0A4U6X810_9PEZI/183-322    AC A0A4U6X810.1
#=GS A0A3B1IHT1_ASTMX/170-354    AC A0A3B1IHT1.1
#=GS A0A672N5D7_SINGR/154-357    AC A0A672N5D7.1
#=GS R0G2E6_9BRAS/195-305        AC R0G2E6.1
#=GS A0A0A1T1B0_9HYPO/183-319    AC A0A0A1T1B0.1
#=GS U4UNL8_DENPD/141-329        AC U4UNL8.1
#=GS A0A540NHE4_MALBA/227-407    AC A0A540NHE4.1
#=GS A0A427YLV6_9TREE/155-340    AC A0A427YLV6.1
#=GS J8LQX0_SACAR/170-343        AC J8LQX0.1
#=GS A0A0D3E6N6_BRAOL/13-139     AC A0A0D3E6N6.1
#=GS A0A672YYL2_9TELE/25-212     AC A0A672YYL2.1
#=GS A0A2U3XQW7_LEPWE/1-85       AC A0A2U3XQW7.1
#=GS A0A6P6XYV4_DERPT/160-360    AC A0A6P6XYV4.1
#=GS A0A091NQA7_APAVI/107-292    AC A0A091NQA7.1
#=GS A0A1J1IH13_9DIPT/158-343    AC A0A1J1IH13.1
#=GS A0A6J3EWQ7_SAPAP/163-347    AC A0A6J3EWQ7.1
#=GS A0A6I9VY01_9HYME/160-344    AC A0A6I9VY01.1
#=GS A0A4S4L5F7_9AGAM/373-556    AC A0A4S4L5F7.1
#=GS A0A668TEH9_OREAU/306-498    AC A0A668TEH9.1
#=GS A0A287VRY1_HORVV/246-430    AC A0A287VRY1.1
#=GS G1N6U7_MELGA/186-369        AC G1N6U7.2
#=GS A0A397YK57_BRACM/164-348    AC A0A397YK57.1
#=GS A0A091TDK7_PHALP/112-296    AC A0A091TDK7.1
#=GS A0A3Q7PNY0_CALUR/15-202     AC A0A3Q7PNY0.1
#=GS I1LQV6_SOYBN/234-414        AC I1LQV6.1
#=GS A0BSE8_PARTE/156-333        AC A0BSE8.1
#=GS A0A0D8XEK4_DICVI/180-364    AC A0A0D8XEK4.1
#=GS A0A0N4UZ97_ENTVE/1-129      AC A0A0N4UZ97.1
#=GS A0A2I4BGN3_9TELE/202-388    AC A0A2I4BGN3.1
#=GS A0A6P8T636_GYMAC/47-234     AC A0A6P8T636.1
#=GS A0A3S1HY33_ELYCH/197-379    AC A0A3S1HY33.1
#=GS A0A6P6XJ36_COFAR/3-187      AC A0A6P6XJ36.1
#=GS A0A368FN47_ANCCA/302-427    AC A0A368FN47.1
#=GS B4IJE2_DROSE/60-232         AC B4IJE2.1
#=GS A0A024W543_PLAFA/134-313    AC A0A024W543.1
#=GS A0A1A6HKE3_NEOLE/115-308    AC A0A1A6HKE3.1
#=GS A0A5N7B1A2_9EURO/161-342    AC A0A5N7B1A2.1
#=GS A0A553QFD5_9TELE/965-1157   AC A0A553QFD5.1
#=GS A0A671NZ63_9TELE/127-320    AC A0A671NZ63.1
#=GS A0A340WY79_LIPVE/243-358    AC A0A340WY79.1
#=GS A0A151PHF6_ALLMI/167-350    AC A0A151PHF6.1
#=GS A0A6P8YQU2_THRPL/149-341    AC A0A6P8YQU2.1
#=GS A0A673ZK11_SALTR/138-333    AC A0A673ZK11.1
#=GS A0A1S4ATH9_TOBAC/86-264     AC A0A1S4ATH9.1
#=GS A0A452IFU2_9SAUR/60-175     AC A0A452IFU2.1
#=GS A0A078IY55_BRANA/236-415    AC A0A078IY55.1
#=GS G3STY1_LOXAF/536-725        AC G3STY1.1
#=GS B4J9V4_DROGR/158-343        AC B4J9V4.1
#=GS A0A2Y9FS34_PHYMC/167-350    AC A0A2Y9FS34.1
#=GS A0A674CZA0_SALTR/157-354    AC A0A674CZA0.1
#=GS Q0CL25_ASPTN/161-342        AC Q0CL25.1
#=GS C1G9A5_PARBD/161-342        AC C1G9A5.1
#=GS A0A084QJM1_STAC4/155-337    AC A0A084QJM1.1
#=GS A0A319D1M6_9EURO/157-338    AC A0A319D1M6.1
#=GS A0A6P8RR46_GEOSA/466-655    AC A0A6P8RR46.1
#=GS A0A2K6PBN7_RHIRO/59-175     AC A0A2K6PBN7.1
#=GS A0A4R0RNG3_9APHY/336-503    AC A0A4R0RNG3.1
#=GS A0A0N5CM92_THECL/19-135     AC A0A0N5CM92.1
#=GS A0A0V0WGL5_9BILA/276-473    AC A0A0V0WGL5.1
#=GS A0A1J7H8M8_LUPAN/208-388    AC A0A1J7H8M8.1
#=GS A0A261Y6R9_9FUNG/623-803    AC A0A261Y6R9.1
#=GS A0A6P7M5B6_BETSP/166-351    AC A0A6P7M5B6.1
#=GS A0A2G2ZJK3_CAPAN/181-364    AC A0A2G2ZJK3.1
#=GS A0A0J9Y434_BRUMA/162-349    AC A0A0J9Y434.1
#=GS A0A182E5H2_ONCOC/51-239     AC A0A182E5H2.1
#=GS A0A6J3M1U7_9PEZI/157-334    AC A0A6J3M1U7.1
#=GS A0A671PA68_9TELE/150-345    AC A0A671PA68.1
#=GS A0A5B7DU50_PORTR/133-225    AC A0A5B7DU50.1
#=GS C9SLW1_VERA1/197-378        AC C9SLW1.1
#=GS A0A2Y9DEZ6_TRIMA/182-368    AC A0A2Y9DEZ6.1
#=GS A0A1U8MWW2_GOSHI/213-397    AC A0A1U8MWW2.1
#=GS A0A2Y9K9J1_ENHLU/312-504    AC A0A2Y9K9J1.1
#=GS A5K333_PLAVS/198-379        AC A5K333.1
#=GS V7C148_PHAVU/199-384        AC V7C148.1
#=GS A0A671N6X2_9TELE/193-380    AC A0A671N6X2.1
#=GS A0A509AJU7_PLABA/161-340    AC A0A509AJU7.1
#=GS A0A091CSY2_FUKDA/180-363    AC A0A091CSY2.1
#=GS A0A2K5N651_CERAT/217-400    AC A0A2K5N651.1
#=GS A0A0V1CJ41_TRIBR/201-391    AC A0A0V1CJ41.1
#=GS A0BPD1_PARTE/173-351        AC A0BPD1.1
#=GS A0A061IY36_TRYRA/92-268     AC A0A061IY36.1
#=GS A0A3L6RYX9_PANMI/205-394    AC A0A3L6RYX9.1
#=GS W5L2M2_ASTMX/149-344        AC W5L2M2.1
#=GS U3K9V4_FICAL/115-310        AC U3K9V4.1
#=GS M1AE79_SOLTU/234-414        AC M1AE79.1
#=GS A0A3Q4HPE2_NEOBR/140-229    AC A0A3Q4HPE2.1
#=GS A0A165I7D3_9BASI/159-345    AC A0A165I7D3.1
#=GS A0A3Q7Q2G6_CALUR/160-355    AC A0A3Q7Q2G6.1
#=GS A0A674GIF6_TAEGU/152-338    AC A0A674GIF6.1
#=GS K3Y7M6_SETIT/179-357        AC K3Y7M6.1
#=GS A0A2Y9QKN3_DELLE/167-350    AC A0A2Y9QKN3.1
#=GS A0A1J7HYC0_LUPAN/190-304    AC A0A1J7HYC0.1
#=GS W5MK62_LEPOC/148-306        AC W5MK62.1
#=GS A0A1D6J546_MAIZE/66-227     AC A0A1D6J546.1
#=GS A0A6J2HAM5_9PASS/317-508    AC A0A6J2HAM5.1
#=GS A0A6A4JTD5_APOLU/243-451    AC A0A6A4JTD5.1
#=GS A0A672KLP6_SINGR/135-269    AC A0A672KLP6.1
#=GS A0A3P8W3Y4_CYNSE/566-765    AC A0A3P8W3Y4.1
#=GS A0A067H836_CITSI/185-363    AC A0A067H836.1
#=GS A0A6J1MWK6_BICAN/153-332    AC A0A6J1MWK6.1
#=GS A0A3Q0DYB7_CARSF/149-305    AC A0A3Q0DYB7.1
#=GS A0A0D9NUW2_METAN/155-336    AC A0A0D9NUW2.1
#=GS A0A453MNU9_AEGTS/235-419    AC A0A453MNU9.1
#=GS A0A3M7SAI1_BRAPC/284-480    AC A0A3M7SAI1.1
#=GS A0A673ZFZ2_SALTR/149-344    AC A0A673ZFZ2.1
#=GS A0A093BZ86_9AVES/461-650    AC A0A093BZ86.1
#=GS A0A0C3GGR0_PILCF/156-337    AC A0A0C3GGR0.1
#=GS A0A6P6T474_COFAR/196-303    AC A0A6P6T474.1
#=GS A0A1D3PBY3_PLAMA/163-342    AC A0A1D3PBY3.1
#=GS F2U1C9_SALR5/154-328        AC F2U1C9.1
#=GS A0A4W3K8Z0_CALMI/149-333    AC A0A4W3K8Z0.1
#=GS A0A091GC69_9AVES/107-292    AC A0A091GC69.1
#=GS A0A4W6FVQ1_LATCA/149-344    AC A0A4W6FVQ1.1
#=GS A0A315WAH8_GAMAF/262-443    AC A0A315WAH8.1
#=GS A0A672YRG1_9TELE/207-391    AC A0A672YRG1.1
#=GS A0A401SMT0_CHIPU/182-369    AC A0A401SMT0.1
#=GS A3LSL2_PICST/172-366        AC A3LSL2.2
#=GS A0A1U7TT50_CARSF/159-339    AC A0A1U7TT50.1
#=GS A0A1D3KXE0_9APIC/164-331    AC A0A1D3KXE0.1
#=GS A0A6I9Q2I8_9TELE/47-234     AC A0A6I9Q2I8.1
#=GS A0A3Q3NCM6_9LABR/159-353    AC A0A3Q3NCM6.1
#=GS A7UUA2_ANOGA/200-358        AC A7UUA2.1
#=GS A0A1R1XAW8_9FUNG/175-372    AC A0A1R1XAW8.1
#=GS A0A484DNF1_PERFV/159-342    AC A0A484DNF1.1
#=GS A0A154PDL9_DUFNO/159-343    AC A0A154PDL9.1
#=GS A0A195FV70_9HYME/1689-1852  AC A0A195FV70.1
#=GS A0A4W2EYJ0_BOBOX/92-279     AC A0A4W2EYJ0.1
#=GS A0A2C9W3F7_MANES/210-394    AC A0A2C9W3F7.1
#=GS I1M4K9_SOYBN/214-394        AC I1M4K9.1
#=GS A0A6P6CRC8_PTEVA/138-318    AC A0A6P6CRC8.1
#=GS D8LV42_BLAHO/173-369        AC D8LV42.1
#=GS A9SGQ1_PHYPA/211-395        AC A9SGQ1.1
#=GS A0A2I0LMS0_COLLI/74-258     AC A0A2I0LMS0.1
#=GS A0A2U1KXE2_ARTAN/227-418    AC A0A2U1KXE2.1
#=GS G0QMQ2_ICHMG/142-326        AC G0QMQ2.1
#=GS A0A2T7F7J4_9POAL/185-359    AC A0A2T7F7J4.1
#=GS A0A226N0J2_CALSU/168-352    AC A0A226N0J2.1
#=GS A0A0D3DT70_BRAOL/234-413    AC A0A0D3DT70.1
#=GS A0A091JGQ4_EGRGA/513-702    AC A0A091JGQ4.1
#=GS A0A2I0MVV0_COLLI/105-288    AC A0A2I0MVV0.1
#=GS A0A673ZRX3_SALTR/109-291    AC A0A673ZRX3.1
#=GS A0A7E4RXG7_CIMLE/168-355    AC A0A7E4RXG7.1
#=GS A0A6P7MAL4_BETSP/308-499    AC A0A6P7MAL4.1
#=GS A0A3P9NGG9_POERE/67-259     AC A0A3P9NGG9.1
#=GS A0A0N4U780_DRAME/100-290    AC A0A0N4U780.1
#=GS A0A315WBH2_GAMAF/183-367    AC A0A315WBH2.1
#=GS A0A1X0QAZ7_9MICR/244-420    AC A0A1X0QAZ7.1
#=GS A0A6P6IAG0_PUMCO/312-495    AC A0A6P6IAG0.1
#=GS A0A6J1SGP9_FRAOC/152-341    AC A0A6J1SGP9.1
#=GS L9KYF5_TUPCH/224-357        AC L9KYF5.1
#=GS A0A667X5V3_9TELE/168-352    AC A0A667X5V3.1
#=GS A0A6J1U385_9SAUR/166-350    AC A0A6J1U385.1
#=GS A0A2B7WJE5_9EURO/159-340    AC A0A2B7WJE5.1
#=GS A0A4W4GFM5_ELEEL/142-336    AC A0A4W4GFM5.1
#=GS A0A1U7VES0_NICSY/217-394    AC A0A1U7VES0.1
#=GS A0A1S4DPA8_TOBAC/183-347    AC A0A1S4DPA8.1
#=GS M0SFX4_MUSAM/181-359        AC M0SFX4.1
#=GS A0A010QEY5_9PEZI/169-312    AC A0A010QEY5.1
#=GS A0A1R2CC89_9CILI/149-327    AC A0A1R2CC89.1
#=GS A0A1Y2CDA0_9FUNG/13-207     AC A0A1Y2CDA0.1
#=GS M2TIS6_COCSN/150-331        AC M2TIS6.1
#=GS A0A314UKH7_PRUYE/241-425    AC A0A314UKH7.1
#=GS E0VGK5_PEDHC/205-266        AC E0VGK5.1
#=GS A0A4W3KA28_CALMI/127-311    AC A0A4W3KA28.1
#=GS G3THF0_LOXAF/149-304        AC G3THF0.1
#=GS A0A2H5PFN4_CITUN/221-406    AC A0A2H5PFN4.1
#=GS I1HVX3_BRADI/207-391        AC I1HVX3.1
#=GS A0A2P6NCP4_9EUKA/160-338    AC A0A2P6NCP4.1
#=GS A0A341B8U9_NEOAA/311-503    AC A0A341B8U9.1
#=GS W6Z6E8_COCCA/150-331        AC W6Z6E8.1
#=GS K3YRD0_SETIT/231-412        AC K3YRD0.1
#=GS B4H598_DROPE/158-343        AC B4H598.1
#=GS A0A2P7YYV8_9ASCO/178-371    AC A0A2P7YYV8.1
#=GS A0A183SNR7_SCHSO/161-332    AC A0A183SNR7.1
#=GS A0A6P5JIG4_PHACI/311-502    AC A0A6P5JIG4.1
#=GS A0A6H5JBZ0_9PHAE/145-330    AC A0A6H5JBZ0.1
#=GS A0A4W5R8G1_9TELE/142-336    AC A0A4W5R8G1.1
#=GS A0A1W0WMT3_HYPDU/312-515    AC A0A1W0WMT3.1
#=GS A0A287WGD5_HORVV/3-108      AC A0A287WGD5.1
#=GS D8RRZ7_SELML/157-340        AC D8RRZ7.1
#=GS A0A2G5SBP9_9PELO/160-344    AC A0A2G5SBP9.1
#=GS A0A3P6T809_LITSI/63-196     AC A0A3P6T809.1
#=GS H3BFY3_LATCH/291-470        AC H3BFY3.1
#=GS A0A287A897_PIG/553-742      AC A0A287A897.2
#=GS A0A2J7Q711_9NEOP/153-348    AC A0A2J7Q711.1
#=GS A0A4W5RDW7_9TELE/143-322    AC A0A4W5RDW7.1
#=GS A0A6G0IB64_LARCR/168-351    AC A0A6G0IB64.1
#=GS A0A3L6QEC4_PANMI/168-352    AC A0A3L6QEC4.1
#=GS T1KN95_TETUR/165-352        AC T1KN95.1
#=GS A0A6S7LMX2_LACSI/171-367    AC A0A6S7LMX2.1
#=GS A0A674NWY4_TAKRU/159-343    AC A0A674NWY4.1
#=GS A0A2P6QHE0_ROSCH/229-409    AC A0A2P6QHE0.1
#=GS A0A425BJR9_9PEZI/144-329    AC A0A425BJR9.1
#=GS V3ZNZ0_LOTGI/156-339        AC V3ZNZ0.1
#=GS A0A1R0GQS6_9FUNG/163-342    AC A0A1R0GQS6.1
#=GS W5P4L4_SHEEP/158-338        AC W5P4L4.1
#=GS A0A0P7UM35_SCLFO/156-330    AC A0A0P7UM35.1
#=GS A0A151RCP3_CAJCA/210-390    AC A0A151RCP3.1
#=GS A0A2W1BSJ9_HELAM/158-343    AC A0A2W1BSJ9.1
#=GS A0A164X3Y2_DAUCS/176-339    AC A0A164X3Y2.1
#=GS H9JBP6_BOMMO/105-291        AC H9JBP6.1
#=GS A0A183JB22_9BILA/2-114      AC A0A183JB22.1
#=GS A0A091DFA2_FUKDA/334-523    AC A0A091DFA2.1
#=GS A0A6P8NW13_GEOSA/100-293    AC A0A6P8NW13.1
#=GS A0A2Y9FHC2_PHYMC/17-197     AC A0A2Y9FHC2.1
#=GS A0A2P5ESE9_TREOI/215-401    AC A0A2P5ESE9.1
#=GS W2TUL9_NECAM/186-364        AC W2TUL9.1
#=GS A0A5Q4C539_9PEZI/152-333    AC A0A5Q4C539.1
#=GS A0A0P7U1B8_SCLFO/153-251    AC A0A0P7U1B8.1
#=GS A0A672S1C7_SINGR/150-345    AC A0A672S1C7.1
#=GS A0A673Y9R0_SALTR/139-325    AC A0A673Y9R0.1
#=GS A0A665X4S2_ECHNA/154-349    AC A0A665X4S2.1
#=GS A0A1X7V8W7_AMPQE/196-314    AC A0A1X7V8W7.1
#=GS A0A0Q3WQQ2_AMAAE/64-156     AC A0A0Q3WQQ2.1
#=GS A0A672P984_SINGR/95-253     AC A0A672P984.1
#=GS A0A0D9XQ29_9ORYZ/177-362    AC A0A0D9XQ29.1
#=GS A0A673M7Z0_9TELE/36-223     AC A0A673M7Z0.1
#=GS A0A3P8ZS57_ESOLU/159-342    AC A0A3P8ZS57.1
#=GS A0A168P257_MUCCL/262-440    AC A0A168P257.1
#=GS A0A3P6U8Q8_LITSI/209-278    AC A0A3P6U8Q8.1
#=GS A0A0V0V2M2_9BILA/142-331    AC A0A0V0V2M2.1
#=GS A0A422Q717_9TRYP/153-329    AC A0A422Q717.1
#=GS A0A7N4PCI9_SARHA/147-329    AC A0A7N4PCI9.1
#=GS A0A673H920_9TELE/158-352    AC A0A673H920.1
#=GS A0A4U6WAE6_SETVI/189-373    AC A0A4U6WAE6.1
#=GS A0A3P9NV15_POERE/157-337    AC A0A3P9NV15.1
#=GS A0A384BBR4_BALAS/167-350    AC A0A384BBR4.1
#=GS A0A7M7H2L4_NASVI/1560-1723  AC A0A7M7H2L4.1
#=GS B9Q6B8_TOXGV/455-643        AC B9Q6B8.1
#=GS A0A482X8A1_LAOST/535-693    AC A0A482X8A1.1
#=GS A0A081CLM5_PSEA2/430-616    AC A0A081CLM5.1
#=GS H0Y3Z3_HUMAN/57-255         AC H0Y3Z3.2
#=GS A0A022RLN7_ERYGU/221-402    AC A0A022RLN7.1
#=GS G1PM34_MYOLU/160-341        AC G1PM34.1
#=GS W7TES6_9STRA/43-218         AC W7TES6.1
#=GS A0A2A2K6W0_9BILA/158-340    AC A0A2A2K6W0.1
#=GS M3YX59_MUSPF/179-270        AC M3YX59.1
#=GS A0A663EPE4_AQUCH/148-254    AC A0A663EPE4.1
#=GS A0A401SF54_CHIPU/126-307    AC A0A401SF54.1
#=GS F4RMH2_MELLP/356-509        AC F4RMH2.1
#=GS A0A3P4RCW9_GULGU/398-590    AC A0A3P4RCW9.1
#=GS A0A663LT88_ATHCN/101-282    AC A0A663LT88.1
#=GS A0A4W5R708_9TELE/149-344    AC A0A4W5R708.1
#=GS A0A3Q7PZD0_CALUR/1-174      AC A0A3Q7PZD0.1
#=GS A0A3S2P5J2_ORYJA/161-352    AC A0A3S2P5J2.1
#=GS A0A016SLM8_9BILA/405-581    AC A0A016SLM8.1
#=GS A0A6P4ZVW3_BRABE/165-348    AC A0A6P4ZVW3.1
#=GS A0A453C0T1_AEGTS/173-329    AC A0A453C0T1.1
#=GS A0A2G9HRE2_9LAMI/21-134     AC A0A2G9HRE2.1
#=GS I1JZ43_SOYBN/182-367        AC I1JZ43.1
#=GS A4HQL6_LEIBR/152-331        AC A4HQL6.1
#=GS A0A3L6RWX3_PANMI/219-401    AC A0A3L6RWX3.1
#=GS A0A0M4EDS5_DROBS/66-255     AC A0A0M4EDS5.1
#=GS A0A1F8A0A2_9EURO/161-342    AC A0A1F8A0A2.1
#=GS A0A068UDU6_COFCA/196-303    AC A0A068UDU6.1
#=GS A0A093BK72_CHAPE/78-273     AC A0A093BK72.1
#=GS A0A553PBJ6_TIGCA/157-342    AC A0A553PBJ6.1
#=GS A0A6I9VZN0_BACDO/535-691    AC A0A6I9VZN0.1
#=GS M4DGP0_BRARP/168-353        AC M4DGP0.1
#=GS A0A6P4Z9T2_BRABE/164-347    AC A0A6P4Z9T2.1
#=GS A0A3B3IGK5_ORYLA/232-334    AC A0A3B3IGK5.1
#=GS H0ZG87_TAEGU/244-425        AC H0ZG87.2
#=GS A0A6P9BKQ4_PANGU/166-350    AC A0A6P9BKQ4.1
#=GS A0A077ZLF1_TRITR/152-339    AC A0A077ZLF1.1
#=GS PDI15_ORYSJ/202-386         AC Q5WA72.1
#=GS A0A673Y460_SALTR/149-344    AC A0A673Y460.1
#=GS A0A2I3S3Y3_PANTR/533-722    AC A0A2I3S3Y3.1
#=GS A0A1Y2DJJ6_9FUNG/152-333    AC A0A1Y2DJJ6.1
#=GS A0A194QPL7_PAPMA/159-306    AC A0A194QPL7.1
#=GS A0A1U8JFJ2_GOSHI/118-303    AC A0A1U8JFJ2.1
#=GS A0A084VD91_ANOSI/150-347    AC A0A084VD91.1
#=GS A0A4V1J392_9ASCO/213-368    AC A0A4V1J392.1
#=GS A0A3Q7H0A4_SOLLC/212-391    AC A0A3Q7H0A4.1
#=GS A0A4X2KGW3_VOMUR/265-423    AC A0A4X2KGW3.1
#=GS A0A5E4EW30_PRUDU/212-397    AC A0A5E4EW30.1
#=GS A0A0B0NXX6_GOSAR/187-368    AC A0A0B0NXX6.1
#=GS A0A016W0N6_9BILA/154-336    AC A0A016W0N6.1
#=GS A0A453C008_AEGTS/111-266    AC A0A453C008.1
#=GS S9WYY2_CAMFR/155-342        AC S9WYY2.1
#=GS A0A669CKV3_ORENI/190-374    AC A0A669CKV3.1
#=GS A0A0G4P2R3_PENCA/115-295    AC A0A0G4P2R3.1
#=GS A0A3L8T242_CHLGU/151-334    AC A0A3L8T242.1
#=GS A0A2K6D541_MACNE/241-433    AC A0A2K6D541.1
#=GS I3NBW9_ICTTR/163-347        AC I3NBW9.1
#=GS A0A672U2I7_STRHB/161-356    AC A0A672U2I7.1
#=GS G1PS85_MYOLU/536-725        AC G1PS85.1
#=GS A0A341AI47_NEOAA/55-242     AC A0A341AI47.1
#=GS A0A3Q2FTH3_CYPVA/96-266     AC A0A3Q2FTH3.1
#=GS A0A091V5B0_PHORB/78-273     AC A0A091V5B0.1
#=GS A0A1F5LI07_9EURO/165-346    AC A0A1F5LI07.1
#=GS A0A671RBE3_9TELE/119-294    AC A0A671RBE3.1
#=GS A0A1V9Z9J5_9STRA/231-423    AC A0A1V9Z9J5.1
#=GS A0A0H5C3Z6_CYBJN/169-345    AC A0A0H5C3Z6.1
#=GS A0A5J5BUG0_9ASTE/164-326    AC A0A5J5BUG0.1
#=GS W9RV77_9ROSA/234-413        AC W9RV77.1
#=GS A0A5C6MTR6_9TELE/47-234     AC A0A5C6MTR6.1
#=GS A0A3P8WV70_CYNSE/155-335    AC A0A3P8WV70.1
#=GS A0A4W5NA69_9TELE/180-361    AC A0A4W5NA69.1
#=GS A0A6I9IWI6_CHRAS/160-355    AC A0A6I9IWI6.1
#=GS A0A2I3LE28_PAPAN/311-503    AC A0A2I3LE28.1
#=GS A0A672P825_SINGR/466-643    AC A0A672P825.1
#=GS A0A672F940_SALFA/158-353    AC A0A672F940.1
#=GS A0A672GGU4_SALFA/310-502    AC A0A672GGU4.1
#=GS A0A0E0N8D8_ORYRU/211-401    AC A0A0E0N8D8.1
#=GS A0A6P7KX54_BETSP/167-347    AC A0A6P7KX54.1
#=GS A0A673IM70_9TELE/140-324    AC A0A673IM70.1
#=GS A0A7P0TA97_HUMAN/161-345    AC A0A7P0TA97.1
#=GS A0A3N4I618_ASCIM/145-325    AC A0A3N4I618.1
#=GS A0A553P2B1_TIGCA/162-346    AC A0A553P2B1.1
#=GS A0A5A7PRH6_STRAF/182-365    AC A0A5A7PRH6.1
#=GS A0A091HEP0_BUCRH/148-331    AC A0A091HEP0.1
#=GS A0A369RTG6_9METZ/144-328    AC A0A369RTG6.1
#=GS A0A674MAA8_TAKRU/519-715    AC A0A674MAA8.1
#=GS A0A094HM12_9PEZI/153-334    AC A0A094HM12.1
#=GS A0A093HMC6_GAVST/89-284     AC A0A093HMC6.1
#=GS G5BET1_HETGA/310-502        AC G5BET1.1
#=GS A0A5E4QD86_9NEOP/513-671    AC A0A5E4QD86.1
#=GS A0A668SY99_OREAU/170-354    AC A0A668SY99.1
#=GS W5N2V5_LEPOC/162-343        AC W5N2V5.1
#=GS A0A2J6LRH5_LACSA/977-1162   AC A0A2J6LRH5.1
#=GS A0A445HCK2_GLYSO/169-354    AC A0A445HCK2.1
#=GS A0A5F4CT79_CANLF/235-422    AC A0A5F4CT79.1
#=GS A0A314Y680_PRUYE/168-353    AC A0A314Y680.1
#=GS Q1HR78_AEDAE/163-347        AC Q1HR78.1
#=GS A0A446MDK3_TRITD/174-337    AC A0A446MDK3.1
#=GS A0A401PIH5_SCYTO/164-344    AC A0A401PIH5.1
#=GS A0A445ID85_GLYSO/214-394    AC A0A445ID85.1
#=GS A0A671TM38_SPAAU/163-347    AC A0A671TM38.1
#=GS A0A484DMD2_PERFV/168-352    AC A0A484DMD2.1
#=GS A0A4U5V349_COLLU/268-447    AC A0A4U5V349.1
#=GS A0A131ZY42_SARSC/162-346    AC A0A131ZY42.1
#=GS A0A4Q4USI8_9PEZI/33-165     AC A0A4Q4USI8.1
#=GS D4A0M2_RAT/204-358          AC D4A0M2.2
#=GS A0A0B7NI77_9FUNG/157-336    AC A0A0B7NI77.1
#=GS A0A2H5QSR4_CITUN/666-813    AC A0A2H5QSR4.1
#=GS A0A2U4BHS0_TURTR/55-244     AC A0A2U4BHS0.2
#=GS G0NKB1_CAEBE/154-343        AC G0NKB1.1
#=GS A0A5A7T0S1_CUCME/234-415    AC A0A5A7T0S1.1
#=GS A0A5J5DNH6_9PERO/46-226     AC A0A5J5DNH6.1
#=GS A0A672G069_SALFA/174-357    AC A0A672G069.1
#=GS A0A1A8VVK7_9APIC/111-256    AC A0A1A8VVK7.1
#=GS A0A0D9RAM8_CHLSB/160-355    AC A0A0D9RAM8.1
#=GS A0A2N3N2D4_9PEZI/155-337    AC A0A2N3N2D4.1
#=GS A0A5N6YUA1_9EURO/161-342    AC A0A5N6YUA1.1
#=GS PDIA4_HUMAN/312-504         AC P13667.2
#=GS A0A3Q2VGH1_HAPBU/149-343    AC A0A3Q2VGH1.1
#=GS A0A7M7N7R3_STRPU/151-340    AC A0A7M7N7R3.1
#=GS G3UKP1_LOXAF/167-350        AC G3UKP1.1
#=GS F2SP00_TRIRC/170-343        AC F2SP00.1
#=GS A0A498KG50_MALDO/227-407    AC A0A498KG50.1
#=GS A0A1E1L0J5_9HELO/149-329    AC A0A1E1L0J5.1
#=GS A0A183GYK0_9BILA/158-338    AC A0A183GYK0.1
#=GS A0A165JSJ3_9BASI/304-487    AC A0A165JSJ3.1
#=GS A0A673LUS8_9TELE/169-352    AC A0A673LUS8.1
#=GS A0A024G8G3_9STRA/156-329    AC A0A024G8G3.1
#=GS M4AL88_XIPMA/334-475        AC M4AL88.2
#=GS A0A091UMF4_NIPNI/193-308    AC A0A091UMF4.1
#=GS A0A493T5S3_ANAPP/1-120      AC A0A493T5S3.1
#=GS A0A0D0CHF7_9AGAR/338-472    AC A0A0D0CHF7.1
#=GS A0A3Q1H6L2_ANATE/159-343    AC A0A3Q1H6L2.2
#=GS A0A3S1HK73_ELYCH/156-340    AC A0A3S1HK73.1
#=GS A0A6J3LAN4_9HYME/605-761    AC A0A6J3LAN4.1
#=GS A0A6P7YD64_9AMPH/163-346    AC A0A6P7YD64.1
#=GS A0A5C3KSS5_9AGAR/153-338    AC A0A5C3KSS5.1
#=GS A0A136JFF3_9PEZI/154-335    AC A0A136JFF3.1
#=GS A0A287NW75_HORVV/186-371    AC A0A287NW75.1
#=GS H3CIQ9_TETNG/168-354        AC H3CIQ9.1
#=GS M4D733_BRARP/164-348        AC M4D733.1
#=GS A0A4S3JJ68_9EURO/164-345    AC A0A4S3JJ68.1
#=GS A0A5N7A9J4_9EURO/161-342    AC A0A5N7A9J4.1
#=GS A0A6P4CM16_ARADU/246-426    AC A0A6P4CM16.1
#=GS I3MRI4_ICTTR/59-175         AC I3MRI4.2
#=GS A0A6P9DMW8_PANGU/93-278     AC A0A6P9DMW8.1
#=GS A0A6P7LW66_BETSP/434-633    AC A0A6P7LW66.1
#=GS A0A498HSF4_MALDO/180-346    AC A0A498HSF4.1
#=GS A0A1D1VIZ0_RAMVA/163-354    AC A0A1D1VIZ0.1
#=GS A0A1A6A8T6_9TREE/282-481    AC A0A1A6A8T6.1
#=GS A0A674DVV9_SALTR/304-496    AC A0A674DVV9.1
#=GS G1Q730_MYOLU/538-727        AC G1Q730.1
#=GS A0A315V3D7_GAMAF/304-495    AC A0A315V3D7.1
#=GS A0A2R8QHZ9_DANRE/153-334    AC A0A2R8QHZ9.1
#=GS A0A5N5PXP0_PANHP/47-234     AC A0A5N5PXP0.1
#=GS A0A0N4U3P8_DRAME/104-275    AC A0A0N4U3P8.1
#=GS A0A2G5DVB5_AQUCA/171-355    AC A0A2G5DVB5.1
#=GS A0A0D3EZE6_9ORYZ/282-373    AC A0A0D3EZE6.1
#=GS B8AGU2_ORYSI/213-393        AC B8AGU2.1
#=GS A0A673ZTW0_SALTR/131-314    AC A0A673ZTW0.1
#=GS C5LZK6_PERM5/339-502        AC C5LZK6.1
#=GS A0A2H5QSR1_CITUN/641-788    AC A0A2H5QSR1.1
#=GS A0A1C7N5P6_9FUNG/260-439    AC A0A1C7N5P6.1
#=GS A0A3Q7UHJ7_URSAR/163-347    AC A0A3Q7UHJ7.1
#=GS A0A3B1K3K3_ASTMX/153-333    AC A0A3B1K3K3.1
#=GS A0A453P588_AEGTS/66-223     AC A0A453P588.1
#=GS D8L9A7_WHEAT/182-358        AC D8L9A7.1
#=GS A0A074W5S5_9PEZI/132-315    AC A0A074W5S5.1
#=GS A0A2A3ENN8_APICC/164-348    AC A0A2A3ENN8.1
#=GS A0A3P8RQ30_AMPPE/168-351    AC A0A3P8RQ30.1
#=GS A0A091S6C9_NESNO/193-308    AC A0A091S6C9.1
#=GS B4HJ34_DROSE/156-352        AC B4HJ34.1
#=GS G3HBS4_CRIGR/182-362        AC G3HBS4.1
#=GS A0A0L0T0P6_ALLM3/162-339    AC A0A0L0T0P6.1
#=GS A0A6J3QYV0_TURTR/539-728    AC A0A6J3QYV0.1
#=GS L5K1N7_PTEAL/160-355        AC L5K1N7.1
#=GS A0A7N9D0D8_MACFA/193-388    AC A0A7N9D0D8.1
#=GS A0A096P114_PAPAN/175-358    AC A0A096P114.2
#=GS A0A154PEH3_DUFNO/308-468    AC A0A154PEH3.1
#=GS A0A1G4AXE8_9PEZI/455-627    AC A0A1G4AXE8.1
#=GS A0A673L9V8_9TELE/154-331    AC A0A673L9V8.1
#=GS A0A671TW92_SPAAU/70-243     AC A0A671TW92.1
#=GS A0A2H3EFR8_ARMGA/362-502    AC A0A2H3EFR8.1
#=GS A0A2R9C972_PANPA/124-313    AC A0A2R9C972.1
#=GS A0A1Y1X3Z5_9FUNG/66-245     AC A0A1Y1X3Z5.1
#=GS A0A3P4NKS8_GULGU/157-338    AC A0A3P4NKS8.1
#=GS A0A7N9ASK4_9TELE/154-349    AC A0A7N9ASK4.1
#=GS A0A669D1Q2_ORENI/47-234     AC A0A669D1Q2.1
#=GS A0A445IR08_GLYSO/170-349    AC A0A445IR08.1
#=GS A0A6G1B7L3_CROCR/246-429    AC A0A6G1B7L3.1
#=GS A0A445APB3_ARAHY/175-351    AC A0A445APB3.1
#=GS A0A498S6Z6_ACAVI/48-171     AC A0A498S6Z6.1
#=GS A0A3Q4H8J8_NEOBR/90-270     AC A0A3Q4H8J8.1
#=GS A0A3S3NYW7_9ACAR/184-365    AC A0A3S3NYW7.1
#=GS A0A5B8MII4_9CHLO/198-381    AC A0A5B8MII4.1
#=GS A0A6P6DJM1_OCTDE/180-365    AC A0A6P6DJM1.1
#=GS A0A091NPW4_9PASS/148-331    AC A0A091NPW4.1
#=GS A0A6P6IFP0_PUMCO/131-311    AC A0A6P6IFP0.1
#=GS T1HYN9_RHOPR/165-350        AC T1HYN9.1
#=GS A0A6P7ILD1_9TELE/48-234     AC A0A6P7ILD1.1
#=GS A0A665W7L6_ECHNA/201-389    AC A0A665W7L6.1
#=GS A0A1B7NY39_9EURO/171-352    AC A0A1B7NY39.1
#=GS A0A428UQQ7_9HYPO/155-336    AC A0A428UQQ7.1
#=GS Q9XTQ3_CAEBR/157-338        AC Q9XTQ3.1
#=GS A0A4P9WCS3_9FUNG/98-278     AC A0A4P9WCS3.1
#=GS V6LQ05_9EUKA/28-201         AC V6LQ05.1
#=GS T0QA63_SAPDV/169-346        AC T0QA63.1
#=GS A0A6I9MZK0_9TELE/1-177      AC A0A6I9MZK0.1
#=GS A0A4W4GV80_ELEEL/190-373    AC A0A4W4GV80.1
#=GS A0A1S4ATF9_TOBAC/185-363    AC A0A1S4ATF9.1
#=GS A0A2K6NTE6_RHIRO/163-332    AC A0A2K6NTE6.1
#=GS A0A484DJC3_PERFV/18-209     AC A0A484DJC3.1
#=GS A0A5B6V892_9ROSI/169-354    AC A0A5B6V892.1
#=GS A0A3P8RTE0_AMPPE/153-333    AC A0A3P8RTE0.1
#=GS A0A2B4RG71_STYPI/739-926    AC A0A2B4RG71.1
#=GS A0A5G2RDD7_PIG/161-345      AC A0A5G2RDD7.1
#=GS A0A1R2BAE9_9CILI/157-334    AC A0A1R2BAE9.1
#=GS A0A397Y0I0_BRACM/236-415    AC A0A397Y0I0.1
#=GS A0A5B1Q8S6_9AGAM/336-496    AC A0A5B1Q8S6.1
#=GS A0A2U1QK37_ARTAN/252-430    AC A0A2U1QK37.1
#=GS A0A0R3WDI8_TAEAS/391-575    AC A0A0R3WDI8.1
#=GS A0A2S4VTV8_9BASI/7-158      AC A0A2S4VTV8.1
#=GS A0A1S3HV24_LINUN/156-346    AC A0A1S3HV24.1
#=GS A0A673A5T0_9TELE/148-332    AC A0A673A5T0.1
#=GS A0A6P3X350_DINQU/170-356    AC A0A6P3X350.1
#=GS A0A163KTW8_ABSGL/300-467    AC A0A163KTW8.1
#=GS A0A0C2CX54_9BILA/347-480    AC A0A0C2CX54.1
#=GS A0A402ERG7_9SAUR/72-259     AC A0A402ERG7.1
#=GS A0A0K0K040_BRUMA/202-384    AC A0A0K0K040.1
#=GS A0A1J6J738_NICAT/186-364    AC A0A1J6J738.1
#=GS A0A061H086_THECC/234-414    AC A0A061H086.1
#=GS A0A6P8P8F0_GEOSA/162-345    AC A0A6P8P8F0.1
#=GS A0A176WMK6_MARPO/164-347    AC A0A176WMK6.1
#=GS A0A665UXU4_ECHNA/178-362    AC A0A665UXU4.1
#=GS A0A251RIT0_PRUPE/204-381    AC A0A251RIT0.1
#=GS A0A196SEU9_BLAHN/155-335    AC A0A196SEU9.1
#=GS Q6BN93_DEBHA/180-375        AC Q6BN93.1
#=GS A0A3P8SYX3_AMPPE/149-344    AC A0A3P8SYX3.1
#=GS A0A665UY06_ECHNA/178-362    AC A0A665UY06.1
#=GS F1SAD9_PIG/313-505          AC F1SAD9.1
#=GS A0A674DRI7_SALTR/190-373    AC A0A674DRI7.1
#=GS A0A3Q3GWD9_9LABR/46-234     AC A0A3Q3GWD9.1
#=GS A0A6P3J9F5_BISBI/170-350    AC A0A6P3J9F5.1
#=GS A0A2J6M5I7_LACSA/244-423    AC A0A2J6M5I7.1
#=GS A0A6P8SF78_GEOSA/159-343    AC A0A6P8SF78.1
#=GS A0A314KHH3_NICAT/165-350    AC A0A314KHH3.1
#=GS A0A3Q2FYL2_CYPVA/207-393    AC A0A3Q2FYL2.1
#=GS A0A6J2XNL1_SITOR/509-656    AC A0A6J2XNL1.1
#=GS A0A6J1WRG2_GALME/268-454    AC A0A6J1WRG2.1
#=GS A0A0D3HJ84_9ORYZ/179-364    AC A0A0D3HJ84.1
#=GS A0A6J1NUD3_BICAN/151-337    AC A0A6J1NUD3.1
#=GS A0A6A4LJJ1_9ERIC/178-354    AC A0A6A4LJJ1.1
#=GS A0A4V2K9T6_9APHY/321-496    AC A0A4V2K9T6.1
#=GS A0A078GYK0_BRANA/240-418    AC A0A078GYK0.1
#=GS A0A091ECE5_FUKDA/160-355    AC A0A091ECE5.1
#=GS A0A4W4GGI5_ELEEL/158-324    AC A0A4W4GGI5.1
#=GS A0A667ZVA7_9TELE/160-320    AC A0A667ZVA7.1
#=GS A0A4Y7TNC9_9AGAR/156-341    AC A0A4Y7TNC9.1
#=GS A0A0D9P7G0_METAN/35-210     AC A0A0D9P7G0.1
#=GS A0A6J1NY59_BICAN/151-337    AC A0A6J1NY59.1
#=GS A0A663LTL2_ATHCN/129-309    AC A0A663LTL2.1
#=GS F6TRA9_ORNAN/167-350        AC F6TRA9.2
#=GS F4WDD4_ACREC/109-303        AC F4WDD4.1
#=GS A0A6P5JAX5_PHACI/543-732    AC A0A6P5JAX5.1
#=GS A0A6I9YNB1_9SAUR/166-352    AC A0A6I9YNB1.1
#=GS A0A0D9WM85_9ORYZ/207-391    AC A0A0D9WM85.1
#=GS A0A2S7P2Y9_9HELO/146-327    AC A0A2S7P2Y9.1
#=GS B3MG35_DROAN/158-343        AC B3MG35.1
#=GS E2ATP4_CAMFO/153-346        AC E2ATP4.1
#=GS A0A5N6UCY9_9EURO/160-341    AC A0A5N6UCY9.1
#=GS A0A2H0ZKF4_CANAR/184-369    AC A0A2H0ZKF4.1
#=GS A0A063BS64_USTVR/156-337    AC A0A063BS64.1
#=GS A0A091VRH0_NIPNI/513-702    AC A0A091VRH0.1
#=GS A0A6J3LA51_9HYME/605-761    AC A0A6J3LA51.1
#=GS A0A556TNK3_BAGYA/149-343    AC A0A556TNK3.1
#=GS A0A099ZE38_TINGU/511-700    AC A0A099ZE38.1
#=GS A0A087H831_ARAAL/187-301    AC A0A087H831.1
#=GS M0RIA7_MUSAM/210-394        AC M0RIA7.1
#=GS A0A6A5BHK8_NAEFO/178-341    AC A0A6A5BHK8.1
#=GS A0A087XAR6_POEFO/591-790    AC A0A087XAR6.2
#=GS J3NM00_GAET3/139-315        AC J3NM00.1
#=GS A0A674I6I3_TERCA/149-315    AC A0A674I6I3.1
#=GS B4N880_DROWI/107-289        AC B4N880.2
#=GS A0A6S7MCY2_LACSI/220-404    AC A0A6S7MCY2.1
#=GS A0A667ZFZ2_9TELE/155-320    AC A0A667ZFZ2.1
#=GS A0A3B6QB10_WHEAT/240-421    AC A0A3B6QB10.1
#=GS A0A453BZY2_AEGTS/111-287    AC A0A453BZY2.1
#=GS A0A1I8IJ81_9PLAT/155-343    AC A0A1I8IJ81.1
#=GS I1BM75_RHIO9/155-337        AC I1BM75.1
#=GS V9KJR2_CALMI/164-348        AC V9KJR2.1
#=GS A0A2R6QTG4_ACTCC/136-314    AC A0A2R6QTG4.1
#=GS A0A5B8MI31_9CHLO/171-365    AC A0A5B8MI31.1
#=GS B2W8Q8_PYRTR/150-331        AC B2W8Q8.1
#=GS A0A5F8G4M1_MONDO/147-329    AC A0A5F8G4M1.1
#=GS G1RP99_NOMLE/180-365        AC G1RP99.1
#=GS A0A6A5FRZ9_PERFL/168-352    AC A0A6A5FRZ9.1
#=GS A0A0R3W6S7_TAEAS/157-348    AC A0A0R3W6S7.1
#=GS A0A485MRZ0_LYNPA/443-632    AC A0A485MRZ0.1
#=GS A0A673AA27_9TELE/210-405    AC A0A673AA27.1
#=GS A0A1D5R485_MACMU/158-338    AC A0A1D5R485.2
#=GS A0A4S4N4P3_9APHY/154-338    AC A0A4S4N4P3.1
#=GS A0A3P9Q0H1_POERE/168-351    AC A0A3P9Q0H1.1
#=GS A0A182E1A1_ONCOC/187-330    AC A0A182E1A1.1
#=GS A0A7N9ARZ3_9TELE/165-360    AC A0A7N9ARZ3.1
#=GS A0A2I4F7P7_JUGRE/165-350    AC A0A2I4F7P7.1
#=GS A0A423X419_9PEZI/136-314    AC A0A423X419.1
#=GS A0A284R037_ARMOS/130-315    AC A0A284R037.1
#=GS W5MGS0_LEPOC/186-372        AC W5MGS0.1
#=GS A0A671QWN5_9TELE/156-350    AC A0A671QWN5.1
#=GS A0A443SU61_9ACAR/164-274    AC A0A443SU61.1
#=GS A0A0D2UUD7_GOSRA/14-144     AC A0A0D2UUD7.1
#=GS B3LYG2_DROAN/165-352        AC B3LYG2.2
#=GS A0A674MBZ0_TAKRU/162-346    AC A0A674MBZ0.1
#=GS A0A2G5BJW1_COERN/156-336    AC A0A2G5BJW1.1
#=GS A8PVU7_MALGO/161-346        AC A8PVU7.1
#=GS B4MWP1_DROWI/150-337        AC B4MWP1.1
#=GS I3L3P5_HUMAN/125-309        AC I3L3P5.2
#=GS A0A3Q3BI94_KRYMA/47-234     AC A0A3Q3BI94.1
#=GS A0A226MF89_CALSU/191-377    AC A0A226MF89.1
#=GS A0A1S3EUM7_DIPOR/533-722    AC A0A1S3EUM7.1
#=GS A0A452F5G4_CAPHI/180-365    AC A0A452F5G4.1
#=GS A0A016S722_9BILA/412-591    AC A0A016S722.1
#=GS G8BQ74_TETPH/165-342        AC G8BQ74.1
#=GS A0A367YKY6_9ASCO/175-369    AC A0A367YKY6.1
#=GS A0A667ZVI4_9TELE/165-321    AC A0A667ZVI4.1
#=GS A0A6I8VL92_DROPS/161-358    AC A0A6I8VL92.1
#=GS A0A670JKG1_PODMU/185-370    AC A0A670JKG1.1
#=GS A0A6J2UZG9_CHACN/312-504    AC A0A6J2UZG9.1
#=GS A0A427Y4X2_9TREE/149-330    AC A0A427Y4X2.1
#=GS A0A0L9UG89_PHAAN/173-358    AC A0A0L9UG89.1
#=GS A0A1B8C4U5_9PEZI/153-334    AC A0A1B8C4U5.1
#=GS A0A667WMS5_9TELE/158-341    AC A0A667WMS5.1
#=GS A0A398AIG1_BRACM/167-352    AC A0A398AIG1.1
#=GS A0A091T5G5_PHALP/148-235    AC A0A091T5G5.1
#=GS A0A6I8U5S0_AEDAE/530-688    AC A0A6I8U5S0.1
#=GS A0A7F8QG26_LEPWE/64-117     AC A0A7F8QG26.1
#=GS A0A5N5QLS6_9AGAM/348-484    AC A0A5N5QLS6.1
#=GS A0A2K6BT03_MACNE/167-350    AC A0A2K6BT03.1
#=GS K7F5X6_PELSI/158-338        AC K7F5X6.1
#=GS A0A2Y9KJI0_ENHLU/157-338    AC A0A2Y9KJI0.1
#=GS A0A197JVT0_9FUNG/304-479    AC A0A197JVT0.1
#=GS A0A1Y1JEI6_PLAGO/164-331    AC A0A1Y1JEI6.1
#=GS A0A493T921_ANAPP/33-134     AC A0A493T921.1
#=GS U3J5N0_ANAPP/544-733        AC U3J5N0.2
#=GS A0A7N8Y6Z2_9TELE/133-320    AC A0A7N8Y6Z2.1
#=GS A0A367KST1_RHIST/156-336    AC A0A367KST1.1
#=GS A0A3B5QI10_XIPMA/45-232     AC A0A3B5QI10.1
#=GS A0A3Q2GI94_CYPVA/137-316    AC A0A3Q2GI94.1
#=GS Q7Q5G3_ANOGA/317-478        AC Q7Q5G3.2
#=GS A0A0H2RZJ8_9AGAM/342-497    AC A0A0H2RZJ8.1
#=GS A0A1V6QY96_9EURO/162-343    AC A0A1V6QY96.1
#=GS A0A672MAU1_SINGR/160-344    AC A0A672MAU1.1
#=GS A0A2G3C5A9_CAPCH/165-348    AC A0A2G3C5A9.1
#=GS L1J8J8_GUITC/158-231        AC L1J8J8.1
#=GS A0A384BPQ1_URSMA/157-335    AC A0A384BPQ1.1
#=GS A0A452GB70_CAPHI/167-350    AC A0A452GB70.1
#=GS A0A3M6XWI2_HORWE/33-217     AC A0A3M6XWI2.1
#=GS A0A6Q2YZV6_ESOLU/159-342    AC A0A6Q2YZV6.1
#=GS A0A7M7GLE9_APIME/170-356    AC A0A7M7GLE9.1
#=GS A0A2K6RE64_RHIRO/158-338    AC A0A2K6RE64.1
#=GS A0A0C2FBL3_9BILA/175-286    AC A0A0C2FBL3.1
#=GS A0A6P8Z637_THRPL/345-512    AC A0A6P8Z637.1
#=GS M0SZ81_MUSAM/182-361        AC M0SZ81.1
#=GS A0A4W2EST2_BOBOX/311-502    AC A0A4W2EST2.1
#=GS A0A1D5UK07_WHEAT/173-364    AC A0A1D5UK07.1
#=GS A0A540KU40_MALBA/214-399    AC A0A540KU40.1
#=GS A0A0L0VFT1_9BASI/213-397    AC A0A0L0VFT1.1
#=GS L5KQR2_PTEAL/180-365        AC L5KQR2.1
#=GS A0A6J0BUY6_NEOLC/536-690    AC A0A6J0BUY6.1
#=GS G3PTX7_GASAC/55-243         AC G3PTX7.1
#=GS A0A4P6XR67_9ASCO/184-368    AC A0A4P6XR67.1
#=GS A0A0R3PFD7_ANGCS/156-338    AC A0A0R3PFD7.1
#=GS A0A667XJ41_9TELE/159-342    AC A0A667XJ41.1
#=GS A0A0U5G111_9EURO/163-255    AC A0A0U5G111.1
#=GS A0A078HGW2_BRANA/178-348    AC A0A078HGW2.1
#=GS A0A168T348_ABSGL/27-191     AC A0A168T348.1
#=GS A0A158PDC8_ANGCS/152-340    AC A0A158PDC8.1
#=GS A0A1V9XLS3_9ACAR/162-347    AC A0A1V9XLS3.1
#=GS A0A1Y3N9L4_PIRSE/152-332    AC A0A1Y3N9L4.1
#=GS A0A3B6SBW2_WHEAT/204-387    AC A0A3B6SBW2.1
#=GS G8Y4A5_PICSO/180-378        AC G8Y4A5.1
#=GS A0A553MNV4_9TELE/150-345    AC A0A553MNV4.1
#=GS A0A195CIJ3_9HYME/461-619    AC A0A195CIJ3.1
#=GS A0A044TJN4_ONCVO/163-346    AC A0A044TJN4.2
#=GS W5JD33_ANODA/156-341        AC W5JD33.1
#=GS A0A6J1Y4F1_ACIJB/179-267    AC A0A6J1Y4F1.1
#=GS I3L514_HUMAN/161-345        AC I3L514.2
#=GS F6R4Z3_XENTR/218-404        AC F6R4Z3.4
#=GS A0A0Q3R9L1_AMAAE/167-350    AC A0A0Q3R9L1.1
#=GS A0A091RJF1_9GRUI/200-315    AC A0A091RJF1.1
#=GS A0A6J2MLS7_9CHIR/178-365    AC A0A6J2MLS7.1
#=GS A0A212CD16_CEREH/1-132      AC A0A212CD16.1
#=GS X6MF63_RETFI/67-182         AC X6MF63.1
#=GS A0A452F4G8_CAPHI/198-313    AC A0A452F4G8.1
#=GS A0A3M6TYB6_POCDA/157-342    AC A0A3M6TYB6.1
#=GS A0A1M2V878_TRAPU/153-340    AC A0A1M2V878.1
#=GS A0A6A4J519_APOLU/167-375    AC A0A6A4J519.1
#=GS L8Y1B4_TUPCH/62-249         AC L8Y1B4.1
#=GS A0A7M7TGV6_STRPU/301-495    AC A0A7M7TGV6.1
#=GS A0A3S3PL10_9ACAR/106-280    AC A0A3S3PL10.1
#=GS A0A066W2L2_TILAU/393-563    AC A0A066W2L2.1
#=GS A0A6G0JA95_LARCR/1-111      AC A0A6G0JA95.1
#=GS A0A6P8QFJ3_GEOSA/163-346    AC A0A6P8QFJ3.1
#=GS A0A2G3AZ54_CAPCH/166-348    AC A0A2G3AZ54.1
#=GS A0A0V0XIG0_TRIPS/153-341    AC A0A0V0XIG0.1
#=GS A0A6J1UDM2_9SAUR/546-736    AC A0A6J1UDM2.1
#=GS A0A2U9CVP9_SCOMX/307-498    AC A0A2U9CVP9.1
#=GS A0A0K9PGF3_ZOSMR/232-412    AC A0A0K9PGF3.1
#=GS B0CYE0_LACBS/157-342        AC B0CYE0.1
#=GS H0XC73_OTOGA/143-330        AC H0XC73.1
#=GS J4DPR6_THEOR/216-395        AC J4DPR6.1
#=GS G4UC97_NEUT9/153-334        AC G4UC97.1
#=GS A0A091GPW1_BUCRH/507-696    AC A0A091GPW1.1
#=GS F4PHX2_CAVFA/169-352        AC F4PHX2.1
#=GS A0A3N0XZ94_ANAGA/12-191     AC A0A3N0XZ94.1
#=GS A0A4W3IT15_CALMI/155-243    AC A0A4W3IT15.1
#=GS A0A0V0UYF5_9BILA/153-341    AC A0A0V0UYF5.1
#=GS V4SBE1_CITCL/232-410        AC V4SBE1.1
#=GS A0A1L1RZP5_CHICK/198-382    AC A0A1L1RZP5.2
#=GS A0A2T7F7N2_9POAL/168-352    AC A0A2T7F7N2.1
#=GS A0A6I9KZ55_PERMB/126-309    AC A0A6I9KZ55.1
#=GS A0A3P8XUI1_ESOLU/136-319    AC A0A3P8XUI1.2
#=GS A0A0V1CNF4_TRIBR/190-365    AC A0A0V1CNF4.1
#=GS A0A6P4FPZ7_DRORH/520-677    AC A0A6P4FPZ7.1
#=GS A0A6I8TZA2_AEDAE/41-238     AC A0A6I8TZA2.1
#=GS C3YNT9_BRAFL/156-347        AC C3YNT9.1
#=GS A0A3P9D2L0_9CICH/306-497    AC A0A3P9D2L0.1
#=GS A0A6Q2YMT9_ESOLU/142-335    AC A0A6Q2YMT9.1
#=GS A0A2P6TWW4_CHLSO/165-359    AC A0A2P6TWW4.1
#=GS E7FC06_DANRE/530-722        AC E7FC06.1
#=GS A0A4W3JYY2_CALMI/143-327    AC A0A4W3JYY2.1
#=GS A0A1S3RGZ9_SALSA/438-632    AC A0A1S3RGZ9.1
#=GS A0A452GN24_9SAUR/19-121     AC A0A452GN24.1
#=GS R7VJ39_CAPTE/158-342        AC R7VJ39.1
#=GS A0A2K5RWN1_CEBIM/158-338    AC A0A2K5RWN1.1
#=GS A0A341BER4_NEOAA/180-365    AC A0A341BER4.1
#=GS A0A0D2RME6_GOSRA/238-418    AC A0A0D2RME6.1
#=GS A0A2U9CYT2_SCOMX/159-352    AC A0A2U9CYT2.1
#=GS A0A267G5X3_9PLAT/193-374    AC A0A267G5X3.1
#=GS A0A6J2JMZ4_BOMMA/317-503    AC A0A6J2JMZ4.1
#=GS A4L9G4_GOSRA/169-354        AC A4L9G4.1
#=GS A0A194UP09_9PEZI/136-325    AC A0A194UP09.1
#=GS A0A2R6PQ85_ACTCC/233-413    AC A0A2R6PQ85.1
#=GS A0A671LZF4_9TELE/166-349    AC A0A671LZF4.1
#=GS A0A6J3Q2H1_TURTR/256-443    AC A0A6J3Q2H1.1
#=GS A0A210QSX6_MIZYE/158-342    AC A0A210QSX6.1
#=GS A0A164ZCE3_9AGAM/158-335    AC A0A164ZCE3.1
#=GS A0A5D2V0P3_GOSMU/169-354    AC A0A5D2V0P3.1
#=GS A0A2U3XW04_LEPWE/463-652    AC A0A2U3XW04.2
#=GS A9UUM7_MONBE/132-305        AC A9UUM7.1
#=GS A0A210QDW7_MIZYE/151-340    AC A0A210QDW7.1
#=GS A9UWT5_MONBE/158-342        AC A9UWT5.1
#=GS A0A6P4IPF2_DROKI/534-691    AC A0A6P4IPF2.1
#=GS A0A674NQG8_TAKRU/155-324    AC A0A674NQG8.1
#=GS A0A1S3AC67_ERIEU/307-499    AC A0A1S3AC67.1
#=GS G3VE74_SARHA/157-339        AC G3VE74.1
#=GS B4R5S2_DROSI/171-352        AC B4R5S2.1
#=GS A0A6J2KJS9_BOMMA/151-346    AC A0A6J2KJS9.1
#=GS A0A6P4FKP6_DRORH/157-342    AC A0A6P4FKP6.1
#=GS A0A2U1PH77_ARTAN/169-352    AC A0A2U1PH77.1
#=GS A0A368H129_ANCCA/154-336    AC A0A368H129.1
#=GS J9NXW0_CANLF/321-438        AC J9NXW0.1
#=GS A0A2H5P2B3_CITUN/6-164      AC A0A2H5P2B3.1
#=GS A0A1J4L2A5_9EUKA/185-358    AC A0A1J4L2A5.1
#=GS S8F888_FOMPI/336-511        AC S8F888.1
#=GS A0A087Y859_POEFO/47-234     AC A0A087Y859.2
#=GS A0A1Y1KCE9_PHOPY/169-352    AC A0A1Y1KCE9.1
#=GS G3U6E5_LOXAF/160-355        AC G3U6E5.1
#=GS E3NS83_CAERE/167-340        AC E3NS83.1
#=GS A0A200QI58_9MAGN/231-411    AC A0A200QI58.1
#=GS A0A195B1Q4_9HYME/570-729    AC A0A195B1Q4.1
#=GS A0A6P4ZVU2_BRABE/165-348    AC A0A6P4ZVU2.1
#=GS A0A2T4AP85_TRIHA/144-315    AC A0A2T4AP85.1
#=GS A0A091VMJ6_NIPNI/112-296    AC A0A091VMJ6.1
#=GS A0A6P4FM01_DRORH/533-689    AC A0A6P4FM01.1
#=GS A0A6J3CIQ3_AYTFU/314-505    AC A0A6J3CIQ3.1
#=GS W9CTU1_SCLBF/152-333        AC W9CTU1.1
#=GS F1PL97_CANLF/163-347        AC F1PL97.2
#=GS A0A667Z3K2_9TELE/155-320    AC A0A667Z3K2.1
#=GS A0A4S8JPF2_MUSBA/180-283    AC A0A4S8JPF2.1
#=GS A0A340X3F8_LIPVE/184-371    AC A0A340X3F8.1
#=GS A0A4W6EPY6_LATCA/208-394    AC A0A4W6EPY6.1
#=GS A0A158Q3D5_DRAME/92-256     AC A0A158Q3D5.1
#=GS A0A1B8D7Z9_9PEZI/156-334    AC A0A1B8D7Z9.1
#=GS A2FDD9_TRIVA/158-344        AC A2FDD9.1
#=GS A0A2P5X9F6_GOSBA/228-412    AC A0A2P5X9F6.1
#=GS A0A672PBK9_SINGR/105-300    AC A0A672PBK9.1
#=GS A0A670JXR9_PODMU/180-365    AC A0A670JXR9.1
#=GS A0A6P8UEA9_GYMAC/175-356    AC A0A6P8UEA9.1
#=GS A0A0D1YQJ3_9PEZI/150-331    AC A0A0D1YQJ3.1
#=GS A0A5F9C9L9_RABIT/167-350    AC A0A5F9C9L9.1
#=GS A0A162AA29_DAUCS/162-347    AC A0A162AA29.1
#=GS A0A341AKV1_NEOAA/167-350    AC A0A341AKV1.1
#=GS A0A0V0W8D9_9BILA/665-854    AC A0A0V0W8D9.1
#=GS A0A0K0E4T2_STRER/159-338    AC A0A0K0E4T2.1
#=GS A0A093G443_DRYPU/107-292    AC A0A093G443.1
#=GS A0A0D9W569_9ORYZ/172-358    AC A0A0D9W569.1
#=GS A0A0L0DS11_THETB/173-355    AC A0A0L0DS11.1
#=GS A0A0C4DGI2_HUMAN/59-175     AC A0A0C4DGI2.1
#=GS A0A4W5JPZ0_9TELE/296-445    AC A0A4W5JPZ0.1
#=GS A0A668TUR8_OREAU/137-242    AC A0A668TUR8.1
#=GS H1VYS5_COLHI/152-333        AC H1VYS5.1
#=GS A0A212FGT6_DANPL/157-340    AC A0A212FGT6.1
#=GS U5HGR4_USTV1/148-328        AC U5HGR4.1
#=GS A0A6J1APK5_9ROSI/173-350    AC A0A6J1APK5.1
#=GS A0A1B8AN41_FUSPO/448-559    AC A0A1B8AN41.1
#=GS A0A6J2SWH2_DROLE/726-855    AC A0A6J2SWH2.1
#=GS A0A0D9VGY1_9ORYZ/134-298    AC A0A0D9VGY1.1
#=GS B6AGN8_CRYMR/253-409        AC B6AGN8.1
#=GS A0A654GPX7_9CEST/153-339    AC A0A654GPX7.1
#=GS A0A397ZHC9_BRACM/178-348    AC A0A397ZHC9.1
#=GS A0A2R6PLR0_ACTCC/225-404    AC A0A2R6PLR0.1
#=GS A0A6A6L562_HEVBR/179-351    AC A0A6A6L562.1
#=GS A0A2R8ZBN0_PANPA/533-722    AC A0A2R8ZBN0.1
#=GS E2BE86_HARSA/1592-1755      AC E2BE86.1
#=GS A0A671Y2S0_SPAAU/154-327    AC A0A671Y2S0.1
#=GS A0A6P7YD93_9AMPH/164-348    AC A0A6P7YD93.1
#=GS G0VAV1_NAUCC/173-349        AC G0VAV1.1
#=GS A0A267FJZ3_9PLAT/33-225     AC A0A267FJZ3.1
#=GS N4TVM9_FUSC1/155-336        AC N4TVM9.1
#=GS A0A3Q1E9A1_9TELE/166-350    AC A0A3Q1E9A1.1
#=GS A0A1J4JAN8_9EUKA/147-337    AC A0A1J4JAN8.1
#=GS A0A1D6J545_MAIZE/182-339    AC A0A1D6J545.1
#=GS G3RIX5_GORGO/533-722        AC G3RIX5.2
#=GS A0A402FU38_9SAUR/151-346    AC A0A402FU38.1
#=GS A0A3Q1M3Q7_BOVIN/305-496    AC A0A3Q1M3Q7.1
#=GS B9IQI1_POPTR/177-361        AC B9IQI1.2
#=GS F2TXQ7_SALR5/285-483        AC F2TXQ7.1
#=GS A0A093CK96_9AVES/150-265    AC A0A093CK96.1
#=GS A0A0V1L3C2_9BILA/651-840    AC A0A0V1L3C2.1
#=GS A0A7E4UVE4_PANRE/190-374    AC A0A7E4UVE4.1
#=GS K1VVL8_TRIAC/385-558        AC K1VVL8.1
#=GS A0A673AQR6_9TELE/125-303    AC A0A673AQR6.1
#=GS F6R3E0_XENTR/287-403        AC F6R3E0.2
#=GS I7M0B1_TETTS/168-352        AC I7M0B1.1
#=GS A0A3L8SGV0_CHLGU/112-297    AC A0A3L8SGV0.1
#=GS A0A2I2U7B8_FELCA/226-406    AC A0A2I2U7B8.3
#=GS A0A0K0F8J4_STRVS/152-340    AC A0A0K0F8J4.1
#=GS A0A2K6TFG3_SAIBB/167-350    AC A0A2K6TFG3.1
#=GS A0A5C3MEZ4_9AGAR/156-341    AC A0A5C3MEZ4.1
#=GS A0A0J7K3P7_LASNI/178-341    AC A0A0J7K3P7.1
#=GS A0A2I0HL72_PUNGR/57-240     AC A0A2I0HL72.1
#=GS A0A218UM04_9PASE/165-349    AC A0A218UM04.1
#=GS C4JT91_UNCRE/159-340        AC C4JT91.1
#=GS A0A6J1DJJ6_MOMCH/212-397    AC A0A6J1DJJ6.1
#=GS A0A6H5GSL9_9HEMI/704-883    AC A0A6H5GSL9.1
#=GS A0A665UXX0_ECHNA/163-347    AC A0A665UXX0.1
#=GS A0A0D2NRS4_GOSRA/173-339    AC A0A0D2NRS4.1
#=GS A0A2I4AI55_9TELE/155-318    AC A0A2I4AI55.1
#=GS A0A6Q2XCZ7_ESOLU/140-334    AC A0A6Q2XCZ7.1
#=GS N1SBK7_FUSC4/134-314        AC N1SBK7.1
#=GS A0A2A9PMV1_9HYPO/157-337    AC A0A2A9PMV1.1
#=GS A0A672N704_SINGR/154-345    AC A0A672N704.1
#=GS A0A0V1MK21_9BILA/649-839    AC A0A0V1MK21.1
#=GS A0A5J5CKH0_9PERO/155-335    AC A0A5J5CKH0.1
#=GS A0A2G8K739_STIJA/147-285    AC A0A2G8K739.1
#=GS A0A1U7QR70_MESAU/64-251     AC A0A1U7QR70.1
#=GS A0A667Z802_9TELE/155-334    AC A0A667Z802.1
#=GS Q22D05_TETTS/2-169          AC Q22D05.2
#=GS A0A6J3FUZ8_SAPAP/64-251     AC A0A6J3FUZ8.1
#=GS A0A3Q7PHK6_CALUR/163-347    AC A0A3Q7PHK6.1
#=GS A0A674BAK3_SALTR/307-499    AC A0A674BAK3.1
#=GS G1NGY3_MELGA/1-129          AC G1NGY3.1
#=GS A0A6P9DP34_PANGU/221-321    AC A0A6P9DP34.1
#=GS A0A673GJ53_9TELE/150-345    AC A0A673GJ53.1
#=GS A0A166A827_DAUCS/173-370    AC A0A166A827.1
#=GS A0A444SGX9_ARMVU/140-243    AC A0A444SGX9.1
#=GS A0A672SI36_SINGR/139-322    AC A0A672SI36.1
#=GS A0A2K5M2K8_CERAT/175-358    AC A0A2K5M2K8.1
#=GS A0A118JZJ4_CYNCS/141-246    AC A0A118JZJ4.1
#=GS A0A135LYA2_PENPA/161-342    AC A0A135LYA2.1
#=GS V2XQN3_MONRO/163-348        AC V2XQN3.1
#=GS A0A6A3C737_HIBSY/169-354    AC A0A6A3C737.1
#=GS A0A3P8U7Y8_AMPPE/46-231     AC A0A3P8U7Y8.1
#=GS A0A4W5Q4T1_9TELE/108-302    AC A0A4W5Q4T1.1
#=GS A0A2I2Y9W2_GORGO/9-150      AC A0A2I2Y9W2.1
#=GS A0A4S8IX66_MUSBA/210-394    AC A0A4S8IX66.1
#=GS A0A0V1KV49_9BILA/276-473    AC A0A0V1KV49.1
#=GS A0A059LNJ9_9CHLO/155-353    AC A0A059LNJ9.1
#=GS A0A1W0WMP8_HYPDU/291-488    AC A0A1W0WMP8.1
#=GS A0A452GU22_9SAUR/1-58       AC A0A452GU22.1
#=GS A0A665X4Q6_ECHNA/161-356    AC A0A665X4Q6.1
#=GS F6RDS9_HORSE/179-360        AC F6RDS9.2
#=GS G1P6K4_MYOLU/64-251         AC G1P6K4.1
#=GS B0X904_CULQU/227-338        AC B0X904.1
#=GS A0A7M7MGK5_APIME/1525-1688  AC A0A7M7MGK5.1
#=GS A0A6A6LM60_HEVBR/209-393    AC A0A6A6LM60.1
#=GS M1CGM8_SOLTU/271-403        AC M1CGM8.1
#=GS A0A3B1JF10_ASTMX/170-354    AC A0A3B1JF10.1
#=GS H2ZN97_CIOSA/146-290        AC H2ZN97.1
#=GS A0A1X0SBQ6_RHIZD/266-438    AC A0A1X0SBQ6.1
#=GS V5GLG9_KALBG/422-626        AC V5GLG9.1
#=GS H3BX08_TETNG/527-725        AC H3BX08.1
#=GS A0A5D2XXC1_GOSMU/173-341    AC A0A5D2XXC1.1
#=GS A0A1X6NRN7_PORUM/280-413    AC A0A1X6NRN7.1
#=GS PDIA2_MOUSE/182-369         AC D3Z6P0.1
#=GS E0VGL2_PEDHC/109-304        AC E0VGL2.1
#=GS G1NM01_MELGA/130-319        AC G1NM01.2
#=GS H2QEN9_PANTR/158-338        AC H2QEN9.1
#=GS A0A2N5TJ36_9BASI/161-344    AC A0A2N5TJ36.1
#=GS A0A0D2JRD6_9EURO/147-328    AC A0A0D2JRD6.1
#=GS A0A194QEL2_PAPXU/464-620    AC A0A194QEL2.1
#=GS A0A453C0U3_AEGTS/101-257    AC A0A453C0U3.1
#=GS A0A093FRG9_TYTAL/148-331    AC A0A093FRG9.1
#=GS W2SKK6_NECAM/104-286        AC W2SKK6.1
#=GS V4T7K6_CITCL/31-130         AC V4T7K6.1
#=GS A0A024UWT8_9STRA/171-351    AC A0A024UWT8.1
#=GS A0A1S3M1K1_SALSA/113-307    AC A0A1S3M1K1.1
#=GS A0A6J3A9A6_VICPA/179-360    AC A0A6J3A9A6.1
#=GS A0A2K1KWR6_PHYPA/172-355    AC A0A2K1KWR6.1
#=GS A0A5C7GYH0_9ROSI/674-828    AC A0A5C7GYH0.1
#=GS A0A6J2PWJ1_COTGO/149-343    AC A0A6J2PWJ1.1
#=GS A0A672F776_SALFA/167-332    AC A0A672F776.1
#=GS A0A1X0NMX9_9TRYP/151-328    AC A0A1X0NMX9.1
#=GS A0A444SIP9_ARMVU/152-337    AC A0A444SIP9.1
#=GS A0A3Q1CLX7_AMPOC/33-227     AC A0A3Q1CLX7.1
#=GS A0A3P8UH23_CYNSE/148-343    AC A0A3P8UH23.1
#=GS A0A482XJ06_LAOST/167-353    AC A0A482XJ06.1
#=GS A0A6P7H4S0_DIAVI/3-134      AC A0A6P7H4S0.1
#=GS A0A673JW80_9TELE/154-338    AC A0A673JW80.1
#=GS A0A5A8CPM0_CAFRO/159-342    AC A0A5A8CPM0.1
#=GS A0A5C2SG39_9APHY/320-495    AC A0A5C2SG39.1
#=GS A0A6Q2Y658_ESOLU/177-361    AC A0A6Q2Y658.1
#=GS A0A2A9MED0_9APIC/243-442    AC A0A2A9MED0.1
#=GS A0A195B1M2_9HYME/170-372    AC A0A195B1M2.1
#=GS A0A3Q1BS46_AMPOC/307-499    AC A0A3Q1BS46.1
#=GS A0A2H2IDU1_CAEJA/18-204     AC A0A2H2IDU1.1
#=GS A0A087TPG5_STEMI/160-346    AC A0A087TPG5.1
#=GS PID13_ORYSJ/218-406         AC Q69ST6.1
#=GS A0A674JIJ3_TERCA/178-284    AC A0A674JIJ3.1
#=GS G3UCF5_LOXAF/175-361        AC G3UCF5.1
#=GS A0A446QEY2_TRITD/243-422    AC A0A446QEY2.1
#=GS G1SMZ8_RABIT/157-338        AC G1SMZ8.3
#=GS A2XTL5_ORYSI/190-362        AC A2XTL5.1
#=GS A0A1S3NB18_SALSA/302-494    AC A0A1S3NB18.1
#=GS Q0UGY2_PHANO/150-331        AC Q0UGY2.1
#=GS A0A4Y7K6G7_PAPSO/193-352    AC A0A4Y7K6G7.1
#=GS A0A1S3EQ88_DIPOR/160-355    AC A0A1S3EQ88.1
#=GS A0A4U0V485_9PEZI/151-335    AC A0A4U0V485.1
#=GS K3YR67_SETIT/231-412        AC K3YR67.1
#=GS A0A556TKG0_BAGYA/123-303    AC A0A556TKG0.1
#=GS A0A453P570_AEGTS/132-299    AC A0A453P570.1
#=GS A1DG36_NEOFI/161-342        AC A1DG36.1
#=GS A0A4W3JUE0_CALMI/167-350    AC A0A4W3JUE0.1
#=GS A0A6P3S1U3_PTEVA/533-722    AC A0A6P3S1U3.1
#=GS A0A163K2L3_DIDRA/151-332    AC A0A163K2L3.1
#=GS A0A6P7G5Q2_DIAVI/182-343    AC A0A6P7G5Q2.1
#=GS A0A7E4V5V0_PANRE/255-443    AC A0A7E4V5V0.1
#=GS E1BSL7_CHICK/167-350        AC E1BSL7.3
#=GS A0A060YML0_ONCMY/49-232     AC A0A060YML0.1
#=GS A0A3Q3NC75_9TELE/309-501    AC A0A3Q3NC75.1
#=GS A0A060W539_ONCMY/149-344    AC A0A060W539.1
#=GS A0A2G2Y490_CAPAN/166-348    AC A0A2G2Y490.1
#=GS A7TFB1_VANPO/166-341        AC A7TFB1.1
#=GS A0A4W3H468_CALMI/112-301    AC A0A4W3H468.1
#=GS A0A3S2Q1H8_ORYJA/177-361    AC A0A3S2Q1H8.1
#=GS A0A6J0AGB1_VICPA/113-308    AC A0A6J0AGB1.1
#=GS A0A672PG45_SINGR/109-304    AC A0A672PG45.1
#=GS A0A4Q4XMY9_9PEZI/140-319    AC A0A4Q4XMY9.1
#=GS A0A0D8XI57_DICVI/116-233    AC A0A0D8XI57.1
#=GS A0A674DTA2_SALTR/115-298    AC A0A674DTA2.1
#=GS A0A287B5U9_PIG/271-331      AC A0A287B5U9.2
#=GS Q4Q059_LEIMA/185-331        AC Q4Q059.1
#=GS A0A5E4AMT7_MARMO/238-422    AC A0A5E4AMT7.1
#=GS A0A0R4IPV5_DANRE/159-343    AC A0A0R4IPV5.2
#=GS A0A4Y7LFB8_PAPSO/240-420    AC A0A4Y7LFB8.1
#=GS A0A261C7D9_9PELO/154-343    AC A0A261C7D9.1
#=GS A0A6I8Q662_XENTR/64-251     AC A0A6I8Q662.2
#=GS A0A068YGS7_ECHMU/385-569    AC A0A068YGS7.1
#=GS F0X918_GROCL/154-335        AC F0X918.1
#=GS A0A0C9MEB4_9FUNG/157-336    AC A0A0C9MEB4.1
#=GS A0A0V0UBJ0_9BILA/172-356    AC A0A0V0UBJ0.1
#=GS A0A3S3QJD9_9ACAR/174-361    AC A0A3S3QJD9.1
#=GS A0A671P175_9TELE/145-339    AC A0A671P175.1
#=GS A0A6I9M158_PERMB/163-347    AC A0A6I9M158.1
#=GS A0A1L1RVU5_CHICK/73-259     AC A0A1L1RVU5.2
#=GS A0A5E4NLX6_9HEMI/164-350    AC A0A5E4NLX6.1
#=GS A0A0R3QKU1_9BILA/227-397    AC A0A0R3QKU1.1
#=GS A0A1S4D8A6_TOBAC/223-401    AC A0A1S4D8A6.1
#=GS A0A1D8PR99_CANAL/175-368    AC A0A1D8PR99.1
#=GS A0A251UBV3_HELAN/244-421    AC A0A251UBV3.1
#=GS A0A2I3TEM6_PANTR/118-301    AC A0A2I3TEM6.1
#=GS A0A151JWG1_9HYME/109-303    AC A0A151JWG1.1
#=GS J7RMC3_KAZNA/196-378        AC J7RMC3.1
#=GS A0A151P667_ALLMI/194-380    AC A0A151P667.1
#=GS A0A6P5E3T9_BOSIN/376-563    AC A0A6P5E3T9.1
#=GS A0A6H5IWX8_9HYME/143-327    AC A0A6H5IWX8.1
#=GS A0A0V1CG19_TRIBR/279-476    AC A0A0V1CG19.1
#=GS A8XT58_CAEBR/390-559        AC A8XT58.1
#=GS A0A6I8U4L2_AEDAE/144-302    AC A0A6I8U4L2.1
#=GS A0A674PI65_TAKRU/126-292    AC A0A674PI65.1
#=GS B4QU96_DROSI/60-233         AC B4QU96.1
#=GS A0A4W5N643_9TELE/170-353    AC A0A4W5N643.1
#=GS A0A673Y954_SALTR/132-321    AC A0A673Y954.1
#=GS A0A665T4J6_ECHNA/132-303    AC A0A665T4J6.1
#=GS A0A1S3BHM1_CUCME/212-397    AC A0A1S3BHM1.1
#=GS F0VMD9_NEOCL/226-435        AC F0VMD9.1
#=GS A0A2F0B9Y1_ESCRO/44-158     AC A0A2F0B9Y1.1
#=GS A0A446UZJ9_TRITD/238-417    AC A0A446UZJ9.1
#=GS A0A1E3IG62_9TREE/155-341    AC A0A1E3IG62.1
#=GS A0A1V4JDV6_PATFA/156-351    AC A0A1V4JDV6.1
#=GS A0A6J1V0E8_9SAUR/166-349    AC A0A6J1V0E8.1
#=GS A0A0D3F6C8_9ORYZ/165-347    AC A0A0D3F6C8.1
#=GS A0A550CSP5_9AGAR/155-340    AC A0A550CSP5.1
#=GS A0A5D2UVD3_GOSMU/228-412    AC A0A5D2UVD3.1
#=GS A0A6P6JDW2_CARAU/150-345    AC A0A6P6JDW2.1
#=GS A0A154PLS6_DUFNO/157-343    AC A0A154PLS6.1
#=GS A0A010RQ36_9PEZI/152-333    AC A0A010RQ36.1
#=GS A0A0D1E191_USTMA/158-341    AC A0A0D1E191.1
#=GS A0A7P0Z4J0_HUMAN/161-245    AC A0A7P0Z4J0.1
#=GS T0MGG7_CAMFR/234-349        AC T0MGG7.1
#=GS A0A667WUJ1_9TELE/194-380    AC A0A667WUJ1.1
#=GS A0A6F9AQ72_9TELE/14-192     AC A0A6F9AQ72.1
#=GS A0A6J0TDZ9_9SAUR/154-349    AC A0A6J0TDZ9.1
#=GS A0A2N1J9Q2_9BASI/164-340    AC A0A2N1J9Q2.1
#=GS A0A6J1KHH2_CUCMA/236-417    AC A0A6J1KHH2.1
#=GS A0A2Y9QSG6_TRIMA/1-164      AC A0A2Y9QSG6.1
#=GS A0A0G2ECM0_9EURO/170-359    AC A0A0G2ECM0.1
#=GS A0A4W3GNP2_CALMI/149-344    AC A0A4W3GNP2.1
#=GS A0A0M3K5J3_ANISI/300-499    AC A0A0M3K5J3.1
#=GS A0A3L6PFT6_PANMI/172-343    AC A0A3L6PFT6.1
#=GS A0A6J3FNT6_SAPAP/514-703    AC A0A6J3FNT6.1
#=GS Q29GE2_DROPS/169-355        AC Q29GE2.1
#=GS A0A067CJ56_SAPPC/172-346    AC A0A067CJ56.1
#=GS A0A0E0R5B7_ORYRU/177-362    AC A0A0E0R5B7.1
#=GS A0A3P9CSI2_9CICH/155-335    AC A0A3P9CSI2.1
#=GS A0A0L9TYY8_PHAAN/168-348    AC A0A0L9TYY8.1
#=GS A0A6G0V5I1_9BILA/481-671    AC A0A6G0V5I1.1
#=GS A0A6P3EQJ6_OCTDE/311-502    AC A0A6P3EQJ6.1
#=GS A0A4W6FVG8_LATCA/161-356    AC A0A4W6FVG8.1
#=GS A0A4S8MW97_DENBC/342-502    AC A0A4S8MW97.1
#=GS A0A165U4B1_9APHY/155-338    AC A0A165U4B1.1
#=GS A0A2P6VND0_9CHLO/164-358    AC A0A2P6VND0.1
#=GS A0A3Q7PNT9_CALUR/7-152      AC A0A3Q7PNT9.1
#=GS A0A0D2QFC0_HYPSF/153-338    AC A0A0D2QFC0.1
#=GS A0A1S4DPM9_TOBAC/162-345    AC A0A1S4DPM9.1
#=GS PDIA4_BOVIN/311-502         AC Q29RV1.1
#=GS T0ME68_CAMFR/87-282         AC T0ME68.1
#=GS A0A4T0WFB5_9PEZI/152-333    AC A0A4T0WFB5.1
#=GS A0A0L0C0Y9_LUCCU/89-274     AC A0A0L0C0Y9.1
#=GS A0A2G2XLV6_CAPBA/224-403    AC A0A2G2XLV6.1
#=GS A0A0D9RRB1_CHLSB/539-728    AC A0A0D9RRB1.1
#=GS A0A6J1W1A7_9SAUR/63-191     AC A0A6J1W1A7.1
#=GS A0A0L0H9Q8_SPIPD/155-335    AC A0A0L0H9Q8.1
#=GS Q16RV8_AEDAE/461-618        AC Q16RV8.1
#=GS A0A2K6LRQ9_RHIBE/142-326    AC A0A2K6LRQ9.1
#=GS A0A3B6NRV7_WHEAT/182-349    AC A0A3B6NRV7.1
#=GS A0A151X3E7_9HYME/157-343    AC A0A151X3E7.1
#=GS A0A175VSH5_9PEZI/153-334    AC A0A175VSH5.1
#=GS A0A2F0B894_ESCRO/49-233     AC A0A2F0B894.1
#=GS A0A096LVC2_POEFO/166-351    AC A0A096LVC2.1
#=GS H3ALQ8_LATCH/157-339        AC H3ALQ8.1
#=GS A0A0R3QA30_9BILA/161-234    AC A0A0R3QA30.1
#=GS A0A1Z5TRF2_HORWE/818-1002   AC A0A1Z5TRF2.1
#=GS A0A0D9ZL07_9ORYZ/170-354    AC A0A0D9ZL07.1
#=GS A0A091GBA8_9AVES/148-331    AC A0A091GBA8.1
#=GS A0A0F4G6W8_9PEZI/136-321    AC A0A0F4G6W8.1
#=GS A0A3L6RQ69_PANMI/167-342    AC A0A3L6RQ69.1
#=GS T1GC08_MEGSC/112-307        AC T1GC08.1
#=GS A0A0K9QME6_SPIOL/212-396    AC A0A0K9QME6.1
#=GS A0A5N5SIZ6_9CRUS/33-217     AC A0A5N5SIZ6.1
#=GS A0A1E4TBP4_9ASCO/137-317    AC A0A1E4TBP4.1
#=GS A0A158Q2T8_DRAME/305-507    AC A0A158Q2T8.1
#=GS G3QRV9_GORGO/158-338        AC G3QRV9.1
#=GS A0A668SX04_OREAU/155-338    AC A0A668SX04.1
#=GS A0A2K5PS63_CEBIM/304-496    AC A0A2K5PS63.1
#=GS I1IMR6_BRADI/179-364        AC I1IMR6.1
#=GS A0A6P8RR42_GEOSA/542-731    AC A0A6P8RR42.1
#=GS A0A1S3QGG7_SALSA/196-381    AC A0A1S3QGG7.1
#=GS A0A6J1SW56_FRAOC/157-345    AC A0A6J1SW56.1
#=GS A0A341ALX0_NEOAA/539-728    AC A0A341ALX0.1
#=GS A0A199VRU6_ANACO/183-361    AC A0A199VRU6.1
#=GS Q38AE1_TRYB2/151-327        AC Q38AE1.1
#=GS M5XCY9_PRUPE/168-353        AC M5XCY9.1
#=GS A0A3Q3AUT1_KRYMA/309-500    AC A0A3Q3AUT1.1
#=GS A0A673JJ43_9TELE/151-346    AC A0A673JJ43.1
#=GS A0A364NAH8_9PLEO/150-331    AC A0A364NAH8.1
#=GS V4B1I8_LOTGI/263-455        AC V4B1I8.1
#=GS A0A093NLZ5_PYGAD/1-139      AC A0A093NLZ5.1
#=GS A0A6J1QQR2_9HYME/571-727    AC A0A6J1QQR2.1
#=GS A0A1U8D6K3_ALLSI/541-730    AC A0A1U8D6K3.1
#=GS A0A0G4KWI7_9PEZI/155-305    AC A0A0G4KWI7.1
#=GS A0A2U3XKZ7_LEPWE/178-365    AC A0A2U3XKZ7.1
#=GS A0A2K5ZD01_MANLE/533-722    AC A0A2K5ZD01.1
#=GS A0A7E4RLE2_CIMLE/147-331    AC A0A7E4RLE2.1
#=GS A0A0G2HV04_9PEZI/157-346    AC A0A0G2HV04.1
#=GS A0A3Q4HL35_NEOBR/207-401    AC A0A3Q4HL35.1
#=GS A0A6J2T1Z7_DROLE/726-853    AC A0A6J2T1Z7.1
#=GS A0A0N5D214_THECL/290-471    AC A0A0N5D214.1
#=GS A0A433DN22_9FUNG/159-340    AC A0A433DN22.1
#=GS A0A4D8ZWY8_SALSN/225-409    AC A0A4D8ZWY8.1
#=GS TXD16_MOUSE/534-723         AC Q7TN22.1
#=GS M4AWT7_XIPMA/309-500        AC M4AWT7.1
#=GS A0A3Q3LTR7_9TELE/209-396    AC A0A3Q3LTR7.2
#=GS J7RW07_KAZNA/167-348        AC J7RW07.1
#=GS A0A6Q2YUM8_ESOLU/179-362    AC A0A6Q2YUM8.1
#=GS F1PQG3_CANLF/105-198        AC F1PQG3.3
#=GS A0A3M2SV86_9EURO/160-341    AC A0A3M2SV86.1
#=GS A2DC27_TRIVA/147-321        AC A2DC27.1
#=GS A0A024VRS6_PLAFA/30-197     AC A0A024VRS6.1
#=GS A0A2P5AJ09_PARAD/174-346    AC A0A2P5AJ09.1
#=GS A0A178Z978_9EURO/153-333    AC A0A178Z978.1
#=GS E2AH21_CAMFO/560-697        AC E2AH21.1
#=GS ERP44_BOVIN/167-350         AC Q3T0L2.1
#=GS A0A5E4A735_MARMO/185-370    AC A0A5E4A735.1
#=GS A0A1C7NGN7_9FUNG/347-513    AC A0A1C7NGN7.1
#=GS A0A178ADX7_9PLEO/151-330    AC A0A178ADX7.1
#=GS A0A665X4P5_ECHNA/152-347    AC A0A665X4P5.1
#=GS H2YJI4_CIOSA/300-493        AC H2YJI4.1
#=GS A0A068UFZ8_COFCA/225-404    AC A0A068UFZ8.1
#=GS A0A1R3HB32_COCAP/228-413    AC A0A1R3HB32.1
#=GS A0A195DMD9_9HYME/160-344    AC A0A195DMD9.1
#=GS A0A6I8P8J4_ORNAN/192-376    AC A0A6I8P8J4.1
#=GS A0A6J1IQC8_CUCMA/212-396    AC A0A6J1IQC8.1
#=GS A0A0B2WKH4_METAS/159-340    AC A0A0B2WKH4.1
#=GS A0A287II75_HORVV/7-107      AC A0A287II75.1
#=GS A0A672RQH5_SINGR/152-346    AC A0A672RQH5.1
#=GS B3RRE2_TRIAD/134-318        AC B3RRE2.1
#=GS A0A665T374_ECHNA/110-204    AC A0A665T374.1
#=GS A0A7M7TFL1_APIME/157-341    AC A0A7M7TFL1.1
#=GS A0A5E4QBS8_9NEOP/711-886    AC A0A5E4QBS8.1
#=GS L9KIH3_TUPCH/262-399        AC L9KIH3.1
#=GS A0A0N4XYY9_NIPBR/149-333    AC A0A0N4XYY9.1
#=GS A0A287T526_HORVV/284-465    AC A0A287T526.1
#=GS TMX3_PONAB/157-338          AC Q5R875.1
#=GS A0A0C2FEK5_9BILA/157-341    AC A0A0C2FEK5.1
#=GS B4LGU3_DROVI/157-341        AC B4LGU3.1
#=GS Q8IMU2_DROME/4-175          AC Q8IMU2.1
#=GS A0A1J9QYS4_9EURO/159-340    AC A0A1J9QYS4.1
#=GS A0A4S2KZU7_9HYME/2088-2281  AC A0A4S2KZU7.1
#=GS A0A667Y0H5_9TELE/161-344    AC A0A667Y0H5.1
#=GS A0A3Q2HMR7_HORSE/865-1057   AC A0A3Q2HMR7.2
#=GS Q7RIR3_PLAYO/1-128          AC Q7RIR3.1
#=GS A0A6J0UP03_9SAUR/168-351    AC A0A6J0UP03.1
#=GS E3K341_PUCGT/161-345        AC E3K341.1
#=GS A0A673JW39_9TELE/159-343    AC A0A673JW39.1
#=GS A0A091GI69_9AVES/104-299    AC A0A091GI69.1
#=GS A0A0D2TUV2_GOSRA/169-354    AC A0A0D2TUV2.1
#=GS A0A3P9MT68_POERE/201-387    AC A0A3P9MT68.1
#=GS A0A2H2JFF5_CAEJA/360-502    AC A0A2H2JFF5.1
#=GS A0A4Q7JNW7_METCM/157-337    AC A0A4Q7JNW7.1
#=GS A0A183DUC7_9BILA/194-268    AC A0A183DUC7.1
#=GS A0A212EUQ6_DANPL/155-341    AC A0A212EUQ6.1
#=GS M0TRP2_MUSAM/118-297        AC M0TRP2.1
#=GS S7QK31_GLOTA/357-489        AC S7QK31.1
#=GS A0A6A6KPU1_HEVBR/173-345    AC A0A6A6KPU1.1
#=GS A0A0G4FC42_VITBC/170-365    AC A0A0G4FC42.1
#=GS A0A5G2QTP9_PIG/167-345      AC A0A5G2QTP9.1
#=GS S4RTG1_PETMA/157-351        AC S4RTG1.1
#=GS A0A091HND5_CALAN/104-299    AC A0A091HND5.1
#=GS A0A6P5DM88_BOSIN/160-355    AC A0A6P5DM88.1
#=GS A0A6Q2ZHM2_ESOLU/137-327    AC A0A6Q2ZHM2.1
#=GS R0GGP8_9BRAS/198-383        AC R0GGP8.1
#=GS A0A5F9D0M4_RABIT/167-350    AC A0A5F9D0M4.1
#=GS A0A6G0TXF6_APHGL/530-687    AC A0A6G0TXF6.1
#=GS A0A2K5SDA0_CEBIM/64-251     AC A0A2K5SDA0.1
#=GS A0A3P7TH58_9BILA/160-343    AC A0A3P7TH58.1
#=GS A0A671MJW9_9TELE/308-500    AC A0A671MJW9.1
#=GS A0A1X2IJV2_9FUNG/297-487    AC A0A1X2IJV2.1
#=GS A0A5B6X5Y2_9ROSI/229-412    AC A0A5B6X5Y2.1
#=GS A0A5E4NH59_9HEMI/166-350    AC A0A5E4NH59.1
#=GS A0A1E4RD32_9ASCO/174-368    AC A0A1E4RD32.1
#=GS A0A1D6GXP7_MAIZE/226-407    AC A0A1D6GXP7.1
#=GS A0A6G0TE44_APHGL/166-350    AC A0A6G0TE44.1
#=GS A0A673TIK2_SURSU/180-367    AC A0A673TIK2.1
#=GS A0A2J8R2E3_PONAB/179-366    AC A0A2J8R2E3.1
#=GS S4RA11_PETMA/109-297        AC S4RA11.1
#=GS A0A4U5QAP2_POPAL/180-360    AC A0A4U5QAP2.1
#=GS A0A3M0KX34_HIRRU/177-373    AC A0A3M0KX34.1
#=GS A9X1C0_PAPAN/160-355        AC A9X1C0.1
#=GS A0A1U7QAU1_MESAU/163-347    AC A0A1U7QAU1.1
#=GS A0A384ABK2_BALAS/313-505    AC A0A384ABK2.1
#=GS A0A059BVE3_EUCGR/207-392    AC A0A059BVE3.1
#=GS A0A0V1AX26_TRISP/661-850    AC A0A0V1AX26.1
#=GS A0A6J2A8V0_ACIJB/226-406    AC A0A6J2A8V0.1
#=GS A0A151SQ85_CAJCA/167-352    AC A0A151SQ85.1
#=GS A0A0D2RVG5_GOSRA/63-229     AC A0A0D2RVG5.1
#=GS A0A238BJN6_9BILA/163-346    AC A0A238BJN6.1
#=GS A0A3P6VGQ0_LITSI/1-114      AC A0A3P6VGQ0.1
#=GS A0A484BK42_DRONA/154-351    AC A0A484BK42.1
#=GS I3KAI2_ORENI/306-497        AC I3KAI2.2
#=GS L1JSH4_GUITC/240-421        AC L1JSH4.1
#=GS A0A226MHC3_CALSU/300-492    AC A0A226MHC3.1
#=GS PDI1_CAEEL/157-339          AC Q17967.1
#=GS T1J2G5_STRMM/154-339        AC T1J2G5.1
#=GS H3ACC4_LATCH/190-378        AC H3ACC4.1
#=GS A0A194QKC7_PAPMA/475-612    AC A0A194QKC7.1
#=GS A0A3Q3ADK2_KRYMA/205-391    AC A0A3Q3ADK2.1
#=GS A0A3B1JLJ0_ASTMX/548-746    AC A0A3B1JLJ0.1
#=GS A0A3P8UU97_CYNSE/204-352    AC A0A3P8UU97.1
#=GS A0A4W5KLU0_9TELE/150-324    AC A0A4W5KLU0.1
#=GS R0FNS5_9BRAS/229-409        AC R0FNS5.1
#=GS A0A6J8D0S5_MYTCO/157-341    AC A0A6J8D0S5.1
#=GS A0A6F9BXY0_9TELE/305-499    AC A0A6F9BXY0.1
#=GS A0A672G065_SALFA/168-351    AC A0A672G065.1
#=GS L5MKN9_MYODS/151-328        AC L5MKN9.1
#=GS A0A0C9WNW2_9AGAR/309-463    AC A0A0C9WNW2.1
#=GS A0A6J1WLN9_GALME/701-878    AC A0A6J1WLN9.1
#=GS A0A0M0JF83_9EUKA/374-573    AC A0A0M0JF83.1
#=GS A0A1Y3NEK7_PIRSE/101-282    AC A0A1Y3NEK7.1
#=GS A0A2T7CL53_9POAL/171-356    AC A0A2T7CL53.1
#=GS A0A1Q9EHF8_SYMMI/370-541    AC A0A1Q9EHF8.1
#=GS B7Q5J7_IXOSC/556-695        AC B7Q5J7.1
#=GS A0A3B0K9Q7_DROGU/188-380    AC A0A3B0K9Q7.1
#=GS A0A670IA48_PODMU/141-325    AC A0A670IA48.1
#=GS A0A1E1KBD4_9HELO/146-326    AC A0A1E1KBD4.1
#=GS A0A096N180_PAPAN/158-338    AC A0A096N180.2
#=GS A0A1U8L0C9_GOSHI/169-354    AC A0A1U8L0C9.1
#=GS A0A6J0TUS0_9SAUR/158-338    AC A0A6J0TUS0.1
#=GS A0A1X0S9V8_RHIZD/349-528    AC A0A1X0S9V8.1
#=GS A0A4W5MZ22_9TELE/142-336    AC A0A4W5MZ22.1
#=GS A0A669PYH6_PHACC/166-350    AC A0A669PYH6.1
#=GS A0A3Q2CL01_CYPVA/304-495    AC A0A3Q2CL01.1
#=GS A0A167VHE5_9PEZI/154-335    AC A0A167VHE5.1
#=GS F4P4C2_BATDJ/164-342        AC F4P4C2.1
#=GS Q8II88_PLAF7/162-341        AC Q8II88.1
#=GS A0A4Q4Y5X2_9PEZI/84-262     AC A0A4Q4Y5X2.1
#=GS A0A3Q1CTE7_AMPOC/163-346    AC A0A3Q1CTE7.1
#=GS R7VLR0_CAPTE/291-492        AC R7VLR0.1
#=GS A0A673TR76_SURSU/3-150      AC A0A673TR76.1
#=GS U3K6U2_FICAL/257-448        AC U3K6U2.1
#=GS M3JZ42_CANMX/175-369        AC M3JZ42.1
#=GS A0A6J2KN84_BOMMA/520-676    AC A0A6J2KN84.1
#=GS A0A1U8G1Y1_CAPAN/205-390    AC A0A1U8G1Y1.1
#=GS A0A2U3V6D2_TURTR/160-355    AC A0A2U3V6D2.1
#=GS W4IWN2_PLAFP/207-381        AC W4IWN2.1
#=GS S8E1U6_9LAMI/176-364        AC S8E1U6.1
#=GS U6GP49_EIMAC/173-348        AC U6GP49.1
#=GS A0A096NV04_PAPAN/534-723    AC A0A096NV04.2
#=GS A0A1Q9DQS1_SYMMI/26-193     AC A0A1Q9DQS1.1
#=GS A0A452I8P0_9SAUR/312-503    AC A0A452I8P0.1
#=GS A0A6P7YKD3_9AMPH/179-364    AC A0A6P7YKD3.1
#=GS A0A0N0NHT0_9EURO/149-329    AC A0A0N0NHT0.1
#=GS A0A0G4L4D4_9PEZI/148-324    AC A0A0G4L4D4.1
#=GS M5GCX5_DACPD/152-328        AC M5GCX5.1
#=GS A0A3N6S5D7_BRACR/233-412    AC A0A3N6S5D7.1
#=GS A0A3P8W9X1_CYNSE/546-745    AC A0A3P8W9X1.1
#=GS A0A179I3X4_CORDF/148-330    AC A0A179I3X4.1
#=GS A0A663LTT7_ATHCN/89-269     AC A0A663LTT7.1
#=GS A0A1R2CQT9_9CILI/162-351    AC A0A1R2CQT9.1
#=GS A0A0B2NU77_GLYSO/199-384    AC A0A0B2NU77.1
#=GS A0A2I0UCC0_LIMLA/212-397    AC A0A2I0UCC0.1
#=GS K7G541_PELSI/179-364        AC K7G541.1
#=GS A0A2G5CIM3_AQUCA/174-356    AC A0A2G5CIM3.1
#=GS A0A6I9INA1_VICPA/452-643    AC A0A6I9INA1.1
#=GS A0A446MDK0_TRITD/174-358    AC A0A446MDK0.1
#=GS A0A6P3R460_PTEVA/179-366    AC A0A6P3R460.1
#=GS W7M2R0_GIBM7/457-569        AC W7M2R0.1
#=GS A0A7E4VF02_PANRE/167-349    AC A0A7E4VF02.1
#=GS A0A674MPX4_TAKRU/149-343    AC A0A674MPX4.1
#=GS W6KRN7_9TRYP/308-413        AC W6KRN7.1
#=GS A0A6H5H8E8_9HEMI/158-346    AC A0A6H5H8E8.1
#=GS A0A0L0CSU9_PLAFA/165-332    AC A0A0L0CSU9.1
#=GS A0A1J6IJB3_NICAT/183-360    AC A0A1J6IJB3.1
#=GS L1IHE5_GUITC/174-370        AC L1IHE5.1
#=GS H2NL91_PONAB/533-722        AC H2NL91.1
#=GS A0A6J3L9F9_9HYME/592-749    AC A0A6J3L9F9.1
#=GS A0A384B988_BALAS/75-262     AC A0A384B988.1
#=GS A0A2R9A4R3_PANPA/179-366    AC A0A2R9A4R3.1
#=GS A0A1E3B4V0_9EURO/161-342    AC A0A1E3B4V0.1
#=GS A0A452HW24_9SAUR/157-337    AC A0A452HW24.1
#=GS A0A2H3HE63_FUSOX/146-319    AC A0A2H3HE63.1
#=GS A0A5N3X231_MUNRE/213-328    AC A0A5N3X231.1
#=GS A0A2I3RER2_PANTR/175-366    AC A0A2I3RER2.1
#=GS A0A674ETT4_SALTR/148-333    AC A0A674ETT4.1
#=GS A0A428NU08_9HYPO/454-563    AC A0A428NU08.1
#=GS A0A200Q0S0_9MAGN/182-362    AC A0A200Q0S0.1
#=GS A0A183ISB8_9BILA/175-375    AC A0A183ISB8.1
#=GS A0A3P8W9T6_CYNSE/590-789    AC A0A3P8W9T6.1
#=GS A0A093NRQ1_PYGAD/112-296    AC A0A093NRQ1.1
#=GS A0A5N5NSW8_9PEZI/151-327    AC A0A5N5NSW8.1
#=GS A0A671M1C7_9TELE/542-734    AC A0A671M1C7.1
#=GS A0A7N6F5K9_ANATE/168-351    AC A0A7N6F5K9.1
#=GS A0A6P8Z637_THRPL/758-937    AC A0A6P8Z637.1
#=GS K1X203_MARBU/152-333        AC K1X203.1
#=GS A0A2I2YUV2_GORGO/161-332    AC A0A2I2YUV2.1
#=GS A0A1V6NCU5_9EURO/162-343    AC A0A1V6NCU5.1
#=GS A0A091MHZ9_CARIC/514-703    AC A0A091MHZ9.1
#=GS A0A2U3YHD8_LEPWE/163-347    AC A0A2U3YHD8.1
#=GS A0A2Z7BLF6_9LAMI/231-409    AC A0A2Z7BLF6.1
#=GS A0A2C9VYU8_MANES/228-408    AC A0A2C9VYU8.1
#=GS A0A078HVT2_BRANA/167-352    AC A0A078HVT2.1
#=GS A0A6P4YJH3_BRABE/158-344    AC A0A6P4YJH3.1
#=GS A0A093I6U4_DRYPU/124-304    AC A0A093I6U4.1
#=GS A0A493SZ54_ANAPP/235-426    AC A0A493SZ54.1
#=GS A0A6P6LKY3_CARAU/152-344    AC A0A6P6LKY3.1
#=GS A0A7J6J329_COLFN/147-318    AC A0A7J6J329.1
#=GS A0A2K6FJF5_PROCO/121-303    AC A0A2K6FJF5.1
#=GS W5LGI8_ASTMX/167-351        AC W5LGI8.2
#=GS A0A226NWU2_COLVI/172-343    AC A0A226NWU2.1
#=GS A0A4W6CLT9_LATCA/162-254    AC A0A4W6CLT9.1
#=GS A0A177CKA4_9PLEO/90-265     AC A0A177CKA4.1
#=GS A0A0B1T9I0_OESDE/2-159      AC A0A0B1T9I0.1
#=GS A0A6J2L5N7_9CHIR/160-355    AC A0A6J2L5N7.1
#=GS A0A2A3EDP8_APICC/518-677    AC A0A2A3EDP8.1
#=GS A0A2K1JRG7_PHYPA/153-332    AC A0A2K1JRG7.1
#=GS A0A284QXW9_ARMOS/309-449    AC A0A284QXW9.1
#=GS A0A446MDM1_TRITD/174-364    AC A0A446MDM1.1
#=GS A0A4Y7IQR0_PAPSO/1-129      AC A0A4Y7IQR0.1
#=GS A0A067G4G5_CITSI/232-413    AC A0A067G4G5.1
#=GS W9IPC2_FUSOX/457-569        AC W9IPC2.1
#=GS A0A2T7P9K1_POMCA/295-487    AC A0A2T7P9K1.1
#=GS A0A2V1AQX9_9ASCO/211-372    AC A0A2V1AQX9.1
#=GS A0A1E3QTD5_9ASCO/167-344    AC A0A1E3QTD5.1
#=GS H2QXK9_PANTR/167-350        AC H2QXK9.1
#=GS A0A059JAE5_TRIIM/166-343    AC A0A059JAE5.1
#=GS A0A3Q7QJ84_CALUR/158-338    AC A0A3Q7QJ84.1
#=GS A0A100IRZ3_ASPNG/157-338    AC A0A100IRZ3.1
#=GS A0A0K0DFV2_ANGCA/203-272    AC A0A0K0DFV2.1
#=GS A0A3P9DCS6_9CICH/47-234     AC A0A3P9DCS6.1
#=GS W5KW40_ASTMX/158-352        AC W5KW40.2
#=GS A0A669CP63_ORENI/147-330    AC A0A669CP63.1
#=GS A0A7N9CPE5_MACFA/160-355    AC A0A7N9CPE5.1
#=GS A0A6P9EQ72_JUGRE/224-405    AC A0A6P9EQ72.1
#=GS A0A182GG15_AEDAL/165-351    AC A0A182GG15.1
#=GS B9RJ25_RICCO/170-355        AC B9RJ25.1
#=GS A0A314Y7K2_PRUYE/186-364    AC A0A314Y7K2.1
#=GS A0A2Z6SNI5_9GLOM/159-339    AC A0A2Z6SNI5.1
#=GS A2Y9P5_ORYSI/202-386        AC A2Y9P5.1
#=GS A0A6I8VSH8_DROPS/200-357    AC A0A6I8VSH8.1
#=GS G0R4T8_ICHMG/2-186          AC G0R4T8.1
#=GS A0A341CPY2_NEOAA/163-347    AC A0A341CPY2.1
#=GS A0A420Y5N6_9PEZI/149-334    AC A0A420Y5N6.1
#=GS A0A0E0DEI0_9ORYZ/170-354    AC A0A0E0DEI0.1
#=GS A0A446VWY0_TRITD/238-413    AC A0A446VWY0.1
#=GS A0A093FAR7_GAVST/107-292    AC A0A093FAR7.1
#=GS A0A059BZ31_EUCGR/170-355    AC A0A059BZ31.1
#=GS A0A445IR72_GLYSO/78-257     AC A0A445IR72.1
#=GS A0A668SWW8_OREAU/161-268    AC A0A668SWW8.1
#=GS A0A337RYF7_FELCA/225-406    AC A0A337RYF7.2
#=GS A0A674JAV3_TERCA/232-416    AC A0A674JAV3.1
#=GS A0A446VWV8_TRITD/238-410    AC A0A446VWV8.1
#=GS F7W334_SORMK/253-363        AC F7W334.1
#=GS A0A1E3Q5X7_LIPST/139-316    AC A0A1E3Q5X7.1
#=GS A0A2K6QIR8_RHIRO/180-365    AC A0A2K6QIR8.1
#=GS A0A5C3L6D8_9AGAR/304-458    AC A0A5C3L6D8.1
#=GS A0A183E7M1_9BILA/33-241     AC A0A183E7M1.1
#=GS A0A3P4RZE3_GULGU/180-365    AC A0A3P4RZE3.1
#=GS A0A7E6F1P9_OCTVU/182-373    AC A0A7E6F1P9.1
#=GS A0A0V1AVI7_TRISP/645-834    AC A0A0V1AVI7.1
#=GS L8GGX4_ACACA/285-454        AC L8GGX4.1
#=GS A0A6P8Z5K5_THRPL/565-720    AC A0A6P8Z5K5.1
#=GS A0A1U7EQ82_9SACH/165-336    AC A0A1U7EQ82.1
#=GS A0A4W5N7X0_9TELE/141-309    AC A0A4W5N7X0.1
#=GS V5HQP4_BYSSN/123-302        AC V5HQP4.1
#=GS G3P2X2_GASAC/148-331        AC G3P2X2.1
#=GS A0A2T7PZX3_POMCA/168-353    AC A0A2T7PZX3.1
#=GS A0A0M9VR13_9BASI/157-342    AC A0A0M9VR13.1
#=GS A0A6A5PFE5_LUPAL/237-412    AC A0A6A5PFE5.1
#=GS F1R1T5_DANRE/168-352        AC F1R1T5.1
#=GS F6PM38_HORSE/154-325        AC F6PM38.2
#=GS G1SWF9_RABIT/180-365        AC G1SWF9.3
#=GS Q95TL8_DROME/171-357        AC Q95TL8.1
#=GS A0A267E7L5_9PLAT/162-341    AC A0A267E7L5.1
#=GS A0A2Y9HAV2_NEOSC/64-251     AC A0A2Y9HAV2.1
#=GS A0A4W5Q6Y6_9TELE/47-235     AC A0A4W5Q6Y6.1
#=GS A0A261BIP1_9PELO/392-578    AC A0A261BIP1.1
#=GS A0A315WD13_GAMAF/213-396    AC A0A315WD13.1
#=GS A0A093ENN1_TYTAL/513-702    AC A0A093ENN1.1
#=GS Q7Q792_ANOGA/150-347        AC Q7Q792.3
#=GS A0A6P4Z372_BRABE/318-510    AC A0A6P4Z372.1
#=GS A0A267FX16_9PLAT/162-341    AC A0A267FX16.1
#=GS A0A672YRL8_9TELE/162-346    AC A0A672YRL8.1
#=GS A0A5N4D3N3_CAMDR/51-166     AC A0A5N4D3N3.1
#=GS A0A226NJY7_CALSU/129-291    AC A0A226NJY7.1
#=GS A0A1U8DHX5_ALLSI/202-317    AC A0A1U8DHX5.1
#=GS A0A4U5VIG0_COLLU/155-336    AC A0A4U5VIG0.1
#=GS A0A2G9HJM1_9LAMI/232-412    AC A0A2G9HJM1.1
#=GS W5MGU2_LEPOC/261-447        AC W5MGU2.1
#=GS A0A3P9BYX9_9CICH/205-255    AC A0A3P9BYX9.1
#=GS D8M571_BLAHO/167-363        AC D8M571.1
#=GS A0A653DKG8_CALMS/145-302    AC A0A653DKG8.1
#=GS A0A1Y2DC46_9PEZI/146-319    AC A0A1Y2DC46.1
#=GS A0A2K6UP47_SAIBB/158-338    AC A0A2K6UP47.1
#=GS A0A2K6DP36_MACNE/163-347    AC A0A2K6DP36.1
#=GS A0A4Y7PHZ7_9AGAM/343-493    AC A0A4Y7PHZ7.1
#=GS M3Y5Q3_MUSPF/167-350        AC M3Y5Q3.1
#=GS A0A165L5S3_9APHY/308-482    AC A0A165L5S3.1
#=GS B3MJU5_DROAN/168-350        AC B3MJU5.1
#=GS A0A6J0ZEP1_ODOVR/167-350    AC A0A6J0ZEP1.1
#=GS A0A044S4I7_ONCVO/134-301    AC A0A044S4I7.1
#=GS A0A6P7HST3_9TELE/540-739    AC A0A6P7HST3.1
#=GS A0A6J2ILY0_9PASS/295-410    AC A0A6J2ILY0.1
#=GS A0A0D2KE64_9EURO/153-332    AC A0A0D2KE64.1
#=GS A0A0S3SFI1_PHAAN/199-384    AC A0A0S3SFI1.1
#=GS U3J2G5_ANAPP/201-312        AC U3J2G5.2
#=GS A0A125PIA5_9BASI/150-342    AC A0A125PIA5.1
#=GS A0A6J2T0Z7_DROLE/531-687    AC A0A6J2T0Z7.1
#=GS A0A2K5N2A4_CERAT/163-347    AC A0A2K5N2A4.1
#=GS A0A6J2GAZ0_9PASS/167-351    AC A0A6J2GAZ0.1
#=GS A0A094DI45_9PEZI/153-334    AC A0A094DI45.1
#=GS A0A672M5R3_SINGR/159-343    AC A0A672M5R3.1
#=GS A0A6P3YUX8_ZIZJJ/213-397    AC A0A6P3YUX8.1
#=GS A0A0N4VVD0_HAEPC/106-181    AC A0A0N4VVD0.1
#=GS A0A6G0Z447_APHCR/156-342    AC A0A6G0Z447.1
#=GS M3ZE48_XIPMA/202-388        AC M3ZE48.2
#=GS A0A4W5PQ98_9TELE/149-324    AC A0A4W5PQ98.1
#=GS Q961B9_DROME/156-352        AC Q961B9.1
#=GS A0A6P8Z5J4_THRPL/339-500    AC A0A6P8Z5J4.1
#=GS A0A3Q3F5P6_KRYMA/149-343    AC A0A3Q3F5P6.1
#=GS A0A3P4P344_GULGU/245-440    AC A0A3P4P344.1
#=GS A0A5E4N7C1_9HEMI/169-355    AC A0A5E4N7C1.1
#=GS A0A7M7RCN5_STRPU/565-756    AC A0A7M7RCN5.1
#=GS A0A2I3MN10_PAPAN/202-317    AC A0A2I3MN10.1
#=GS A0A6A5DPF1_PERFL/154-335    AC A0A6A5DPF1.1
#=GS A0A314ZG98_PRUYE/170-348    AC A0A314ZG98.1
#=GS A0A3L6PI81_PANMI/173-358    AC A0A3L6PI81.1
#=GS A0A5F8GBB4_MONDO/184-371    AC A0A5F8GBB4.1
#=GS A0A671S299_9TELE/118-295    AC A0A671S299.1
#=GS I7M6P1_TETTS/187-389        AC I7M6P1.2
#=GS A0A671TNP4_SPAAU/159-343    AC A0A671TNP4.1
#=GS A0A2P8XXX8_BLAGE/269-417    AC A0A2P8XXX8.1
#=GS A0A667Y8W3_9TELE/209-314    AC A0A667Y8W3.1
#=GS A0A5C6NAE6_9TELE/599-792    AC A0A5C6NAE6.1
#=GS A0A3Q7HI26_SOLLC/192-387    AC A0A3Q7HI26.1
#=GS A0A6J2T0Z7_DROLE/726-853    AC A0A6J2T0Z7.1
#=GS A0A446L4N7_TRITD/173-266    AC A0A446L4N7.1
#=GS A0A0E0F399_9ORYZ/179-364    AC A0A0E0F399.1
#=GS A0A1U7Z8G8_NELNU/209-394    AC A0A1U7Z8G8.1
#=GS A0A1V4JVJ4_PATFA/314-505    AC A0A1V4JVJ4.1
#=GS A0A091E5K7_CORBR/104-299    AC A0A091E5K7.1
#=GS A0A2S4KVQ1_9HYPO/155-335    AC A0A2S4KVQ1.1
#=GS A0A7E4RGH9_CIMLE/154-339    AC A0A7E4RGH9.1
#=GS A0A4U5UKF2_COLLU/149-344    AC A0A4U5UKF2.1
#=GS A0A2K6NTF7_RHIRO/163-347    AC A0A2K6NTF7.1
#=GS A0A4W5QTU8_9TELE/71-254     AC A0A4W5QTU8.1
#=GS A0A067NPJ6_PLEOS/162-350    AC A0A067NPJ6.1
#=GS F7E1Q7_MACMU/180-365        AC F7E1Q7.2
#=GS A0A6P5BV78_BOSIN/92-279     AC A0A6P5BV78.1
#=GS A0A2I3TU94_PANTR/2-143      AC A0A2I3TU94.1
#=GS A0A653BTI7_CALMS/28-167     AC A0A653BTI7.1
#=GS A0A2U3XHJ0_LEPWE/312-504    AC A0A2U3XHJ0.1
#=GS C4LVA3_ENTHI/144-318        AC C4LVA3.1
#=GS A0A3P8Y0J9_ESOLU/310-501    AC A0A3P8Y0J9.1
#=GS M1CGM9_SOLTU/175-356        AC M1CGM9.1
#=GS A0A151NAK0_ALLMI/203-318    AC A0A151NAK0.1
#=GS A0A1J4J8L9_9EUKA/202-345    AC A0A1J4J8L9.1
#=GS A0A3P7XE95_9BILA/290-488    AC A0A3P7XE95.1
#=GS C0H4Y6_PLAF7/165-332        AC C0H4Y6.1
#=GS A0A6P7YU62_9AMPH/159-339    AC A0A6P7YU62.1
#=GS G3ND88_GASAC/237-429        AC G3ND88.1
#=GS S2JPR9_MUCC1/263-441        AC S2JPR9.1
#=GS A0A2S7P798_9HELO/142-323    AC A0A2S7P798.1
#=GS A0A0D9R7P2_CHLSB/11-171     AC A0A0D9R7P2.1
#=GS A0A1S4AL28_TOBAC/218-397    AC A0A1S4AL28.1
#=GS A0A7M7L8T6_APIME/1540-1702  AC A0A7M7L8T6.1
#=GS A0A077Z5H0_TRITR/274-462    AC A0A077Z5H0.1
#=GS A0A016S7L1_9BILA/171-349    AC A0A016S7L1.1
#=GS A0A1D6F5B9_MAIZE/207-421    AC A0A1D6F5B9.1
#=GS A0A0C9N006_9FUNG/313-491    AC A0A0C9N006.1
#=GS A0A0E0F398_9ORYZ/179-364    AC A0A0E0F398.1
#=GS C7YK79_FUSV7/721-902        AC C7YK79.1
#=GS S4R553_PETMA/306-499        AC S4R553.1
#=GS T0Q0X6_SAPDV/154-329        AC T0Q0X6.1
#=GS A0A2G8KWW0_STIJA/69-261     AC A0A2G8KWW0.1
#=GS M0U9N3_MUSAM/118-297        AC M0U9N3.1
#=GS M7BUN0_CHEMY/167-354        AC M7BUN0.1
#=GS A0A6P6MFY6_CARAU/150-345    AC A0A6P6MFY6.1
#=GS A0A671UG09_SPAAU/168-351    AC A0A671UG09.1
#=GS A0A2P8YI11_BLAGE/145-342    AC A0A2P8YI11.1
#=GS A0A151LZ32_ALLMI/56-243     AC A0A151LZ32.1
#=GS A0A1B8CFH0_9PEZI/381-533    AC A0A1B8CFH0.1
#=GS H2TF58_TAKRU/550-746        AC H2TF58.3
#=GS A0A2R6XKM4_MARPO/181-366    AC A0A2R6XKM4.1
#=GS A0A0N4W0M3_HAEPC/157-341    AC A0A0N4W0M3.1
#=GS A0A6J0WL10_ODOVR/160-355    AC A0A6J0WL10.1
#=GS A0A3Q2LKX4_HORSE/400-592    AC A0A3Q2LKX4.1
#=GS A0A6J3CDY1_AYTFU/167-350    AC A0A6J3CDY1.1
#=GS E1F0H0_GIAIA/144-328        AC E1F0H0.1
#=GS A0A3S2PE27_ORYJA/308-499    AC A0A3S2PE27.1
#=GS H2TAS6_TAKRU/183-364        AC H2TAS6.3
#=GS A0A0R0JFL1_SOYBN/170-356    AC A0A0R0JFL1.1
#=GS A0A287II05_HORVV/1-124      AC A0A287II05.1
#=GS A0A1E4SM69_9ASCO/172-364    AC A0A1E4SM69.1
#=GS D0QEL0_SALSA/149-344        AC D0QEL0.1
#=GS A0A2K6FLW2_PROCO/64-251     AC A0A2K6FLW2.1
#=GS A0A6J1DXG4_MOMCH/240-420    AC A0A6J1DXG4.1
#=GS A0A091FWZ2_CORBR/148-331    AC A0A091FWZ2.1
#=GS A0A6I9IYI7_CHRAS/135-330    AC A0A6I9IYI7.1
#=GS A0A2K6S6J5_SAIBB/35-150     AC A0A2K6S6J5.1
#=GS A0A5N3X875_MUNRE/142-325    AC A0A5N3X875.1
#=GS A0A167EHZ5_9PEZI/152-333    AC A0A167EHZ5.1
#=GS A0A6I8S2P1_XENTR/124-308    AC A0A6I8S2P1.1
#=GS A0A5F4CNF3_CANLF/486-675    AC A0A5F4CNF3.1
#=GS A0A669BXV0_ORENI/159-343    AC A0A669BXV0.1
#=GS A0CRB0_PARTE/167-374        AC A0CRB0.1
#=GS F7INT6_CALJA/64-251         AC F7INT6.1
#=GS U5D3J4_AMBTC/229-409        AC U5D3J4.1
#=GS A1C5W8_ASPCL/161-342        AC A1C5W8.1
#=GS A0A669EG24_ORENI/159-353    AC A0A669EG24.1
#=GS J9LVZ5_ACYPI/152-341        AC J9LVZ5.2
#=GS A0A022Q2V4_ERYGU/176-361    AC A0A022Q2V4.1
#=GS A0A2I4HPN9_JUGRE/175-360    AC A0A2I4HPN9.1
#=GS A0A068S869_9FUNG/155-341    AC A0A068S869.1
#=GS G1SLC0_RABIT/167-350        AC G1SLC0.1
#=GS A0A6P8WTR7_DROAB/536-692    AC A0A6P8WTR7.1
#=GS A0A0E0P9F8_ORYRU/189-339    AC A0A0E0P9F8.1
#=GS M4ASX8_XIPMA/159-352        AC M4ASX8.1
#=GS A0A565B814_9BRAS/209-395    AC A0A565B814.1
#=GS A0A3M0JQL3_HIRRU/38-224     AC A0A3M0JQL3.1
#=GS A0A0V1DH55_TRIBR/389-573    AC A0A0V1DH55.1
#=GS A0A212F401_DANPL/150-346    AC A0A212F401.1
#=GS A0A1S3Q8Y1_SALSA/152-333    AC A0A1S3Q8Y1.1
#=GS G1PDK8_MYOLU/160-355        AC G1PDK8.1
#=GS A0A6P5J8Q4_PHACI/459-648    AC A0A6P5J8Q4.1
#=GS A0A1Y2EM22_9FUNG/316-505    AC A0A1Y2EM22.1
#=GS A0A1S3AAW9_ERIEU/412-601    AC A0A1S3AAW9.1
#=GS A0A182E477_ONCOC/150-332    AC A0A182E477.1
#=GS A0A090L9B3_STRRB/152-340    AC A0A090L9B3.1
#=GS A0A2Y9Q7N6_DELLE/313-428    AC A0A2Y9Q7N6.1
#=GS C5Y8P0_SORBI/181-358        AC C5Y8P0.1
#=GS I3MZ97_ICTTR/64-251         AC I3MZ97.1
#=GS K3Y6Y4_SETIT/176-337        AC K3Y6Y4.1
#=GS C5DK19_LACTC/170-352        AC C5DK19.1
#=GS A0A6J3KX10_9HYME/159-343    AC A0A6J3KX10.1
#=GS A0A6J3B7V2_VICPA/180-365    AC A0A6J3B7V2.1
#=GS A0A5M3MA31_CONPW/157-341    AC A0A5M3MA31.1
#=GS A0A1D5QES2_MACMU/126-306    AC A0A1D5QES2.2
#=GS A0A7R5KQD8_9PASS/549-738    AC A0A7R5KQD8.1
#=GS A0A6P9BQN1_PANGU/166-349    AC A0A6P9BQN1.1
#=GS A0A075AI32_9TREM/180-313    AC A0A075AI32.1
#=GS A0A2I0TJF6_LIMLA/144-259    AC A0A2I0TJF6.1
#=GS A0A165I138_9APHY/159-338    AC A0A165I138.1
#=GS A0A026WI64_OOCBI/43-231     AC A0A026WI64.1
#=GS PDI13_ARATH/235-416         AC Q8VX13.1
#=GS A0A3P6THE2_LITSI/312-508    AC A0A3P6THE2.1
#=GS A0A2K5RG93_CEBIM/151-307    AC A0A2K5RG93.1
#=GS A0A0M3K1E1_ANISI/159-339    AC A0A0M3K1E1.1
#=GS A0A0V1NJV7_9BILA/202-349    AC A0A0V1NJV7.1
#=GS A0A565BWG7_9BRAS/236-416    AC A0A565BWG7.1
#=GS A0A0D9W570_9ORYZ/172-358    AC A0A0D9W570.1
#=GS A0A1L9N9T6_ASPTC/157-338    AC A0A1L9N9T6.1
#=GS A0A6I9XZX0_9SAUR/304-496    AC A0A6I9XZX0.1
#=GS H0V2B9_CAVPO/311-503        AC H0V2B9.2
#=GS D7KIR0_ARALL/211-396        AC D7KIR0.1
#=GS A0A6A4W0I0_AMPAM/155-335    AC A0A6A4W0I0.1
#=GS A0A5D2WAN1_GOSMU/169-354    AC A0A5D2WAN1.1
#=GS A0A4W3K8Z3_CALMI/124-308    AC A0A4W3K8Z3.1
#=GS A0A3P7TQU8_9BILA/1-95       AC A0A3P7TQU8.1
#=GS A0A0Q3UQF0_AMAAE/202-318    AC A0A0Q3UQF0.1
#=GS G1N9T7_MELGA/160-346        AC G1N9T7.2
#=GS A0A3Q4HYD3_NEOBR/107-265    AC A0A3Q4HYD3.1
#=GS A0A4Y7KVX4_PAPSO/197-376    AC A0A4Y7KVX4.1
#=GS A0A6J0KES8_RAPSA/242-422    AC A0A6J0KES8.1
#=GS A0A1D6F5C3_MAIZE/103-320    AC A0A1D6F5C3.1
#=GS A0A369SHI6_9METZ/154-342    AC A0A369SHI6.1
#=GS A0A446R503_TRITD/176-283    AC A0A446R503.1
#=GS A0A6J1NRV1_BICAN/2-59       AC A0A6J1NRV1.1
#=GS A0A168M9F6_MUCCL/157-336    AC A0A168M9F6.1
#=GS B4IRQ0_DROPE/2-133          AC B4IRQ0.1
#=GS A0A2K5J2E2_COLAP/64-251     AC A0A2K5J2E2.1
#=GS A0A0D9ZKY2_9ORYZ/190-362    AC A0A0D9ZKY2.1
#=GS A0A452GN26_9SAUR/1-86       AC A0A452GN26.1
#=GS A0A653BW00_CALMS/30-226     AC A0A653BW00.1
#=GS A0A151MZ81_ALLMI/173-357    AC A0A151MZ81.1
#=GS A0A287WG98_HORVV/2-88       AC A0A287WG98.1
#=GS A0A0F9XL13_TRIHA/154-335    AC A0A0F9XL13.1
#=GS A0A6I8U5R6_AEDAE/518-676    AC A0A6I8U5R6.1
#=GS R0LMN8_ANAPL/193-308        AC R0LMN8.1
#=GS A0A672MER7_SINGR/159-343    AC A0A672MER7.1
#=GS A0A6A4N689_LUPAL/215-390    AC A0A6A4N689.1
#=GS A0A6A3A9M9_HIBSY/181-364    AC A0A6A3A9M9.1
#=GS A0A093BR37_9AVES/148-331    AC A0A093BR37.1
#=GS A0A4U6UYX0_SETVI/206-391    AC A0A4U6UYX0.1
#=GS A0A091P3N1_LEPDC/193-308    AC A0A091P3N1.1
#=GS A0A2H5QTR8_CITUN/192-341    AC A0A2H5QTR8.1
#=GS J9IL38_9SPIT/185-368        AC J9IL38.1
#=GS A0A2G5VGP7_9PELO/154-342    AC A0A2G5VGP7.1
#=GS A0A5N6K8R1_9HELO/206-387    AC A0A5N6K8R1.1
#=GS T0MLF5_9MICR/114-272        AC T0MLF5.1
#=GS A0A2Z7CWT3_9LAMI/175-360    AC A0A2Z7CWT3.1
#=GS M7BK18_CHEMY/120-207        AC M7BK18.1
#=GS A0A067DCR6_CITSI/19-145     AC A0A067DCR6.1
#=GS C1E3Z2_MICCC/5-110          AC C1E3Z2.1
#=GS A0A1Y2AZK3_9TREE/281-480    AC A0A1Y2AZK3.1
#=GS A0A674ERX7_SALTR/147-332    AC A0A674ERX7.1
#=GS A0A1V9XKH6_9ACAR/584-739    AC A0A1V9XKH6.1
#=GS A0A6P4IZ01_DROKI/155-352    AC A0A6P4IZ01.1
#=GS A0A0V0ZAZ6_9BILA/153-341    AC A0A0V0ZAZ6.1
#=GS A0A287TG50_HORVV/1-81       AC A0A287TG50.1
#=GS A0A2I4B7Y2_9TELE/155-335    AC A0A2I4B7Y2.1
#=GS A0A427Y040_9TREE/342-457    AC A0A427Y040.1
#=GS B9HUE8_POPTR/201-387        AC B9HUE8.1
#=GS A0A0A0ALZ4_CHAVO/148-331    AC A0A0A0ALZ4.1
#=GS A0A4Y9XW01_9APHY/332-507    AC A0A4Y9XW01.1
#=GS A0A4U1FT62_MONMO/163-347    AC A0A4U1FT62.1
#=GS A0A3P9BB84_9CICH/137-320    AC A0A3P9BB84.1
#=GS A0A430Q3L5_SCHBO/157-340    AC A0A430Q3L5.1
#=GS A0A673UYA8_SURSU/514-703    AC A0A673UYA8.1
#=GS A0A0K0FC49_STRVS/163-347    AC A0A0K0FC49.1
#=GS A0A0V0TVH4_9BILA/279-476    AC A0A0V0TVH4.1
#=GS K8FHP9_9CHLO/210-402        AC K8FHP9.1
#=GS A0A2G2WKD0_CAPBA/194-376    AC A0A2G2WKD0.1
#=GS H3EIU0_PRIPA/153-341        AC H3EIU0.1
#=GS A9CSQ4_ENTBH/268-444        AC A9CSQ4.1
#=GS A0A2K5XNJ6_MANLE/167-350    AC A0A2K5XNJ6.1
#=GS A0A7I4FNM7_PHYPA/175-331    AC A0A7I4FNM7.1
#=GS A0A6P7MJF0_BETSP/209-395    AC A0A6P7MJF0.1
#=GS L8G5P5_PSED2/153-334        AC L8G5P5.1
#=GS A0A6J2RRM4_COTGO/176-357    AC A0A6J2RRM4.1
#=GS S7PUU6_MYOBR/122-317        AC S7PUU6.1
#=GS A0A0V0ZWE4_9BILA/662-851    AC A0A0V0ZWE4.1
#=GS A0A087HJ42_ARAAL/166-351    AC A0A087HJ42.1
#=GS A0A1Y2ILI7_PYCCO/333-501    AC A0A1Y2ILI7.1
#=GS A0A507EHF1_9FUNG/315-509    AC A0A507EHF1.1
#=GS G3RHL8_GORGO/124-313        AC G3RHL8.2
#=GS A0A0G4LPQ4_9PEZI/167-350    AC A0A0G4LPQ4.1
#=GS A0A2U4CGF4_TURTR/105-288    AC A0A2U4CGF4.1
#=GS A0A6S7MXG8_LACSI/329-513    AC A0A6S7MXG8.1
#=GS Q9V9A9_DROME/533-690        AC Q9V9A9.2
#=GS D8M304_BLAHO/155-333        AC D8M304.1
#=GS A0A2J6MBU6_LACSA/204-388    AC A0A2J6MBU6.1
#=GS A0A0L0FY15_9EUKA/172-361    AC A0A0L0FY15.1
#=GS D8LM96_ECTSI/109-308        AC D8LM96.1
#=GS A0A6J1NKW0_BICAN/269-455    AC A0A6J1NKW0.1
#=GS A0A6P5M9Q1_PHACI/163-358    AC A0A6P5M9Q1.1
#=GS A0A671XF97_SPAAU/208-393    AC A0A671XF97.1
#=GS A0A5A9N053_9TELE/151-347    AC A0A5A9N053.1
#=GS A0A135UZ33_9PEZI/148-321    AC A0A135UZ33.1
#=GS A0A2A4IT93_HELVI/237-397    AC A0A2A4IT93.1
#=GS A0A6P8WFV4_GYMAC/159-342    AC A0A6P8WFV4.1
#=GS A0A6J2VXG1_CHACN/193-379    AC A0A6J2VXG1.1
#=GS A0A059BUJ9_EUCGR/207-392    AC A0A059BUJ9.1
#=GS A0A6Q2ZH17_ESOLU/174-359    AC A0A6Q2ZH17.1
#=GS S7NLU4_MYOBR/245-383        AC S7NLU4.1
#=GS A0A3Q3LWJ4_9TELE/172-279    AC A0A3Q3LWJ4.2
#=GS A0A4W5N260_9TELE/164-347    AC A0A4W5N260.1
#=GS A0A0V0ZX17_9BILA/6-156      AC A0A0V0ZX17.1
#=GS L5KNR2_PTEAL/126-309        AC L5KNR2.1
#=GS A0A0D9RFC8_CHLSB/167-350    AC A0A0D9RFC8.1
#=GS A0A2N3N9J3_9PEZI/419-568    AC A0A2N3N9J3.1
#=GS R0LZB0_ANAPL/44-228         AC R0LZB0.1
#=GS A0A0C2FR11_9BILA/44-140     AC A0A0C2FR11.1
#=GS A0A2K6U883_SAIBB/180-367    AC A0A2K6U883.1
#=GS H3CYG0_TETNG/159-354        AC H3CYG0.1
#=GS A0A6I9UEX2_SESIN/187-363    AC A0A6I9UEX2.1
#=GS W5Q9H2_SHEEP/163-347        AC W5Q9H2.1
#=GS A0A226F2C1_FOLCA/157-346    AC A0A226F2C1.1
#=GS A0A5N4E2F0_CAMDR/164-359    AC A0A5N4E2F0.1
#=GS A0A059EKZ2_9MICR/2-137      AC A0A059EKZ2.1
#=GS I1BQ62_RHIO9/210-334        AC I1BQ62.1
#=GS A0A4D8YGJ5_SALSN/169-354    AC A0A4D8YGJ5.1
#=GS L8GNC0_ACACA/109-290        AC L8GNC0.1
#=GS A0A507B8D3_9PEZI/155-336    AC A0A507B8D3.1
#=GS A0A6P8VYC5_GYMAC/159-342    AC A0A6P8VYC5.1
#=GS A0A6P9DN44_PANGU/174-359    AC A0A6P9DN44.1
#=GS A0A226N5D1_CALSU/152-347    AC A0A226N5D1.1
#=GS A0A6I9SQI9_SESIN/217-402    AC A0A6I9SQI9.1
#=GS A0A673ZGQ8_SALTR/151-345    AC A0A673ZGQ8.1
#=GS A0A1I8HRX2_9PLAT/160-346    AC A0A1I8HRX2.1
#=GS D7L5K4_ARALL/212-403        AC D7L5K4.1
#=GS A0A402FRW6_9SAUR/196-387    AC A0A402FRW6.1
#=GS A0A2G5D1J8_AQUCA/234-413    AC A0A2G5D1J8.1
#=GS A0A6P3QI55_PTEVA/167-350    AC A0A6P3QI55.1
#=GS A0A445C9Y8_ARAHY/172-357    AC A0A445C9Y8.1
#=GS A0A3Q2V6Y4_HAPBU/48-235     AC A0A3Q2V6Y4.1
#=GS A0A673GIJ1_9TELE/150-345    AC A0A673GIJ1.1
#=GS A0A2K5N1Y7_CERAT/222-406    AC A0A2K5N1Y7.1
#=GS A0A5F8HGB9_MONDO/515-704    AC A0A5F8HGB9.1
#=GS A0A182Y0S3_ANOST/88-285     AC A0A182Y0S3.1
#=GS A0A4Z2H138_9TELE/310-508    AC A0A4Z2H138.1
#=GS A0A2Y9HNC2_NEOSC/160-355    AC A0A2Y9HNC2.1
#=GS A0A1D6J740_MAIZE/225-409    AC A0A1D6J740.1
#=GS A0A674E556_SALTR/166-349    AC A0A674E556.1
#=GS A0A388JYF0_CHABU/245-430    AC A0A388JYF0.1
#=GS A0A6J3LAN4_9HYME/1596-1759  AC A0A6J3LAN4.1
#=GS A0A5E4AYZ5_MARMO/240-427    AC A0A5E4AYZ5.1
#=GS A0A1D3TI42_9APIC/160-339    AC A0A1D3TI42.1
#=GS A0A1D1V7Z9_RAMVA/169-354    AC A0A1D1V7Z9.1
#=GS A0A315VE67_GAMAF/97-283     AC A0A315VE67.1
#=GS R0KP95_ANAPL/144-321        AC R0KP95.1
#=GS A0A4W2FDK5_BOBOX/92-279     AC A0A4W2FDK5.1
#=GS A0A5N4D3R6_CAMDR/67-181     AC A0A5N4D3R6.1
#=GS G3R1S3_GORGO/64-251         AC G3R1S3.1
#=GS A0A267GTL1_9PLAT/152-344    AC A0A267GTL1.1
#=GS A0A6P6LLE0_CARAU/208-391    AC A0A6P6LLE0.1
#=GS A0A670ZEM0_PSETE/172-262    AC A0A670ZEM0.1
#=GS V3ZVV8_LOTGI/77-239         AC V3ZVV8.1
#=GS A0A0L1I5Q8_PLAFA/165-332    AC A0A0L1I5Q8.1
#=GS A0A067NR11_PLEOS/157-341    AC A0A067NR11.1
#=GS D8LNL3_ECTSI/240-379        AC D8LNL3.1
#=GS A0A2K5DYV9_AOTNA/64-251     AC A0A2K5DYV9.1
#=GS A0A2K6FJH9_PROCO/163-347    AC A0A2K6FJH9.1
#=GS A0A6I9X1L2_9HYME/157-343    AC A0A6I9X1L2.1
#=GS A0A6P6UQB2_COFAR/175-360    AC A0A6P6UQB2.1
#=GS A0A165P738_9AGAM/370-504    AC A0A165P738.1
#=GS A0A6P8BAZ2_MAGGR/155-327    AC A0A6P8BAZ2.1
#=GS A0A668SY87_OREAU/190-374    AC A0A668SY87.1
#=GS A0A6G1BH27_CROCR/112-296    AC A0A6G1BH27.1
#=GS A0A6P8BAS8_MAGGR/168-349    AC A0A6P8BAS8.1
#=GS A0A3Q7IT96_SOLLC/208-355    AC A0A3Q7IT96.1
#=GS A0A2Y9RZ30_TRIMA/64-251     AC A0A2Y9RZ30.1
#=GS A0A4X2LVM1_VOMUR/148-329    AC A0A4X2LVM1.1
#=GS A0A384L791_PLAKH/164-331    AC A0A384L791.1
#=GS A0A1R3I7N6_9ROSI/168-362    AC A0A1R3I7N6.1
#=GS A0A0D2QF72_GOSRA/213-397    AC A0A0D2QF72.1
#=GS A0A091RKV2_9GRUI/123-304    AC A0A091RKV2.1
#=GS A0A395SLX7_FUSSP/449-559    AC A0A395SLX7.1
#=GS R6NB95_9FIRM/32-130         AC R6NB95.1
#=GS A0A261AHF1_9PELO/290-487    AC A0A261AHF1.1
#=GS A0A183E0M4_9BILA/179-363    AC A0A183E0M4.1
#=GS A0A3N0YEG3_ANAGA/150-329    AC A0A3N0YEG3.1
#=GS A0A5N6L9E0_9ASTR/200-384    AC A0A5N6L9E0.1
#=GS A0A7E5WP10_TRINI/267-453    AC A0A7E5WP10.1
#=GS A0A2S4PNS1_9PEZI/153-339    AC A0A2S4PNS1.1
#=GS A0A2H5P2A6_CITUN/1175-1309  AC A0A2H5P2A6.1
#=GS A0A6P8Y0Y6_DROAB/536-693    AC A0A6P8Y0Y6.1
#=GS A0A1U8KC77_GOSHI/172-352    AC A0A1U8KC77.1
#=GS A0A4W5Q205_9TELE/13-192     AC A0A4W5Q205.1
#=GS A0A2I2Z1R6_GORGO/127-316    AC A0A2I2Z1R6.1
#=GS A0A0D9R3W5_CHLSB/312-504    AC A0A0D9R3W5.1
#=GS A0A151PJB0_ALLMI/104-299    AC A0A151PJB0.1
#=GS A0A7M7QAX4_NASVI/170-372    AC A0A7M7QAX4.1
#=GS A0A4D9EQK4_9SAUR/226-341    AC A0A4D9EQK4.1
#=GS A0A3Q7PJ84_CALUR/180-367    AC A0A3Q7PJ84.1
#=GS A0A1U7SAE1_ALLSI/155-335    AC A0A1U7SAE1.1
#=GS A0A2C5YCL4_9HYPO/154-335    AC A0A2C5YCL4.1
#=GS F6GU04_VITVI/232-412        AC F6GU04.1
#=GS A0A096P113_PAPAN/167-350    AC A0A096P113.1
#=GS I1C6R9_RHIO9/165-333        AC I1C6R9.1
#=GS A0A4C1WWD6_EUMVA/105-251    AC A0A4C1WWD6.1
#=GS J3N6N4_ORYBR/1-174          AC J3N6N4.1
#=GS A0A016TXX3_9BILA/154-341    AC A0A016TXX3.1
#=GS A0A673JJI9_9TELE/161-344    AC A0A673JJI9.1
#=GS A0A3Q4AKY4_MOLML/169-353    AC A0A3Q4AKY4.1
#=GS A0A4W3KK60_CALMI/143-327    AC A0A4W3KK60.1
#=GS A0A6P7ISF8_9TELE/196-382    AC A0A6P7ISF8.1
#=GS A0A444UBB6_ACIRT/184-367    AC A0A444UBB6.1
#=GS A0A093E7P0_TAUER/106-291    AC A0A093E7P0.1
#=GS A0A5C6NEJ9_9TELE/159-353    AC A0A5C6NEJ9.1
#=GS A0A446UZQ4_TRITD/5-184      AC A0A446UZQ4.1
#=GS A0A2G5D1L7_AQUCA/234-413    AC A0A2G5D1L7.1
#=GS A0A5A9NXQ8_9TELE/159-343    AC A0A5A9NXQ8.1
#=GS A0A5J4YYM8_PORPP/199-348    AC A0A5J4YYM8.1
#=GS A0A6A1Q2I3_BALPH/212-314    AC A0A6A1Q2I3.1
#=GS A0A0M3QWD0_DROBS/155-352    AC A0A0M3QWD0.1
#=GS D7KUJ9_ARALL/167-351        AC D7KUJ9.1
#=GS A0A6P5JHE1_PHACI/543-732    AC A0A6P5JHE1.1
#=GS A0A1B9HSC2_9TREE/155-342    AC A0A1B9HSC2.1
#=GS B4QM88_DROSI/145-342        AC B4QM88.1
#=GS A0A7N6A5A1_ANATE/167-335    AC A0A7N6A5A1.1
#=GS A0A667Z8V6_9TELE/167-328    AC A0A667Z8V6.1
#=GS A0A091UF49_PHALP/78-273     AC A0A091UF49.1
#=GS A0A2P5I7P7_9PEZI/164-353    AC A0A2P5I7P7.1
#=GS H9G9P8_ANOCA/126-352        AC H9G9P8.1
#=GS T1HPT4_RHOPR/580-742        AC T1HPT4.1
#=GS G1XG88_ARTOA/153-333        AC G1XG88.1
#=GS A0A5N4AG07_PHOPY/162-345    AC A0A5N4AG07.1
#=GS A0A6I9JKG0_CHRAS/235-426    AC A0A6I9JKG0.1
#=GS A0A673GFX2_9TELE/157-352    AC A0A673GFX2.1
#=GS A0A1S4DNK2_TOBAC/189-367    AC A0A1S4DNK2.1
#=GS A0A446R562_TRITD/154-299    AC A0A446R562.1
#=GS V4AX97_LOTGI/52-241         AC V4AX97.1
#=GS V4A6R2_LOTGI/153-342        AC V4A6R2.1
#=GS L8HYQ8_9CETA/163-347        AC L8HYQ8.1
#=GS A0A6I9WJS1_9HYME/155-349    AC A0A6I9WJS1.1
#=GS A0A6P8VAV6_GYMAC/207-393    AC A0A6P8VAV6.1
#=GS A0A1I7VN20_LOALO/109-291    AC A0A1I7VN20.1
#=GS J9JPW0_ACYPI/724-862        AC J9JPW0.2
#=GS J6EHM2_SACK1/169-341        AC J6EHM2.1
#=GS A0A0D2S8N8_GOSRA/4-182      AC A0A0D2S8N8.1
#=GS A0A1U7X8R1_NICSY/189-367    AC A0A1U7X8R1.1
#=GS A0A6I9NE84_9TELE/169-353    AC A0A6I9NE84.1
#=GS A0A507CD51_9FUNG/361-537    AC A0A507CD51.1
#=GS A0A067GW94_CITSI/184-345    AC A0A067GW94.1
#=GS A0A1L9S833_9EURO/158-339    AC A0A1L9S833.1
#=GS A0A177B4F5_9BILA/267-465    AC A0A177B4F5.1
#=GS G7JPD1_MEDTR/237-417        AC G7JPD1.1
#=GS A0A091I5S0_CALAN/148-331    AC A0A091I5S0.1
#=GS A0A667ZLN1_9TELE/149-344    AC A0A667ZLN1.1
#=GS A0A4W6DAU7_LATCA/159-342    AC A0A4W6DAU7.1
#=GS A0A3N0YHX9_ANAGA/43-229     AC A0A3N0YHX9.1
#=GS A0A7N4V284_SARHA/163-347    AC A0A7N4V284.1
#=GS A0A4W6E1A0_LATCA/154-331    AC A0A4W6E1A0.1
#=GS A0A6G0UZP6_9BILA/158-341    AC A0A6G0UZP6.1
#=GS Q0UJI3_PHANO/38-215         AC Q0UJI3.1
#=GS A0A5D2Z9X8_GOSMU/171-352    AC A0A5D2Z9X8.1
#=GS A0A0A0LUQ2_CUCSA/234-415    AC A0A0A0LUQ2.1
#=GS A0A2P5XTH0_GOSBA/156-336    AC A0A2P5XTH0.1
#=GS A0A6P5WGF2_DURZI/215-400    AC A0A6P5WGF2.1
#=GS A0A095EQF8_CRYGR/154-340    AC A0A095EQF8.1
#=GS A0A674NB77_TAKRU/158-352    AC A0A674NB77.1
#=GS A0A267ES47_9PLAT/162-308    AC A0A267ES47.1
#=GS A0A1Y2VDG2_9PEZI/145-323    AC A0A1Y2VDG2.1
#=GS I1MA56_SOYBN/106-291        AC I1MA56.1
#=GS R0KQ91_NOSB1/161-311        AC R0KQ91.1
#=GS A0A7N6A7H8_ANATE/150-345    AC A0A7N6A7H8.1
#=GS A0A402F6F1_9SAUR/177-362    AC A0A402F6F1.1
#=GS A0A482SA20_9ARCH/223-430    AC A0A482SA20.1
#=GS A0A2H3B433_9AGAR/306-446    AC A0A2H3B433.1
#=GS A0A6J1DGB2_MOMCH/173-355    AC A0A6J1DGB2.1
#=GS A0A1A6HR10_NEOLE/130-315    AC A0A1A6HR10.1
#=GS A0A3Q0EIH7_CARSF/6-150      AC A0A3Q0EIH7.1
#=GS A0A3B5QEE0_XIPMA/187-380    AC A0A3B5QEE0.1
#=GS A0A4Q4YVS0_9PEZI/157-338    AC A0A4Q4YVS0.1
#=GS A0A0M8N6F9_9HYPO/154-335    AC A0A0M8N6F9.1
#=GS A0A2P5VX63_GOSBA/169-354    AC A0A2P5VX63.1
#=GS A0A2P5DIR6_PARAD/178-363    AC A0A2P5DIR6.1
#=GS A0A5M9JLN1_MONFR/1-93       AC A0A5M9JLN1.1
#=GS A0A2K5YQ07_MANLE/64-251     AC A0A2K5YQ07.1
#=GS D8S6E4_SELML/140-323        AC D8S6E4.1
#=GS A0A2U3WMU1_ODORO/180-365    AC A0A2U3WMU1.1
#=GS A0A059D5F7_EUCGR/231-416    AC A0A059D5F7.1
#=GS A0A674BBG8_SALTR/307-499    AC A0A674BBG8.1
#=GS A0A139WM79_TRICA/280-456    AC A0A139WM79.1
#=GS A0A3Q3ADN4_KRYMA/168-352    AC A0A3Q3ADN4.1
#=GS A0A094L8A0_PODCR/107-292    AC A0A094L8A0.1
#=GS A0A2K6LBV4_RHIBE/158-341    AC A0A2K6LBV4.1
#=GS A0A4W4HBG3_ELEEL/173-332    AC A0A4W4HBG3.1
#=GS A0A093YMR4_9PEZI/226-407    AC A0A093YMR4.1
#=GS A0A2R8Z5M9_PANPA/518-707    AC A0A2R8Z5M9.1
#=GS E3NBU5_CAERE/154-342        AC E3NBU5.1
#=GS A0A158QLB5_HAEPC/149-281    AC A0A158QLB5.1
#=GS H0WKL1_OTOGA/163-347        AC H0WKL1.1
#=GS A0A328D7S2_9ASTE/207-392    AC A0A328D7S2.1
#=GS A0A6P8WI53_DROAB/205-362    AC A0A6P8WI53.1
#=GS A0A0C2MRH0_THEKT/157-337    AC A0A0C2MRH0.1
#=GS A0A7N6A9X8_ANATE/175-355    AC A0A7N6A9X8.1
#=GS A0A5C6MV59_9TELE/161-345    AC A0A5C6MV59.1
#=GS K7FSP3_PELSI/86-191         AC K7FSP3.1
#=GS I4Y7V8_WALMC/157-340        AC I4Y7V8.1
#=GS A0A099ZQT7_TINGU/106-291    AC A0A099ZQT7.1
#=GS A0A4D8YHQ5_SALSN/169-354    AC A0A4D8YHQ5.1
#=GS Q7Q5G3_ANOGA/530-688        AC Q7Q5G3.2
#=GS A0A1D6F5C0_MAIZE/170-386    AC A0A1D6F5C0.1
#=GS R9P1H4_PSEHS/445-628        AC R9P1H4.1
#=GS A0A673URB5_SURSU/167-350    AC A0A673URB5.1
#=GS T1FVQ2_HELRO/163-348        AC T1FVQ2.1
#=GS A0A384DEP5_URSMA/64-251     AC A0A384DEP5.1
#=GS A0A399GE39_9PLEO/150-331    AC A0A399GE39.1
#=GS A0A091CPF8_FUKDA/146-329    AC A0A091CPF8.1
#=GS A0A1S3ADV1_ERIEU/135-330    AC A0A1S3ADV1.1
#=GS H2T9Y7_TAKRU/161-345        AC H2T9Y7.3
#=GS A0A093IRW2_DRYPU/193-308    AC A0A093IRW2.1
#=GS A0A4P9XAI5_9FUNG/66-314     AC A0A4P9XAI5.1
#=GS A0A6F9C8U4_9TELE/159-342    AC A0A6F9C8U4.1
#=GS E5A315_LEPMJ/150-331        AC E5A315.1
#=GS A0A6Q2Z6N5_ESOLU/128-300    AC A0A6Q2Z6N5.1
#=GS A0A163LNT8_ABSGL/254-424    AC A0A163LNT8.1
#=GS A0A2R9BNM8_PANPA/9-150      AC A0A2R9BNM8.1
#=GS A0A672SI17_SINGR/167-350    AC A0A672SI17.1
#=GS A0A2A4JU63_HELVI/150-346    AC A0A2A4JU63.1
#=GS H0XI72_OTOGA/535-724        AC H0XI72.1
#=GS A0A6J3EZJ3_SAPAP/111-294    AC A0A6J3EZJ3.1
#=GS L5M6C8_MYODS/228-411        AC L5M6C8.1
#=GS A0A401SNV8_CHIPU/159-343    AC A0A401SNV8.1
#=GS A0A673A2H7_9TELE/181-364    AC A0A673A2H7.1
#=GS A0A367JQ22_RHIST/157-338    AC A0A367JQ22.1
#=GS A0A267DMS3_9PLAT/295-481    AC A0A267DMS3.1
#=GS A0A0V1MNZ2_9BILA/200-368    AC A0A0V1MNZ2.1
#=GS A0A166QQ57_9PEZI/152-333    AC A0A166QQ57.1
#=GS A8XRI3_CAEBR/161-341        AC A8XRI3.1
#=GS A0A022QHQ1_ERYGU/190-355    AC A0A022QHQ1.1
#=GS A0A384CYE9_URSMA/562-751    AC A0A384CYE9.1
#=GS A0A4W2EHY1_BOBOX/160-355    AC A0A4W2EHY1.1
#=GS A0A0D2P184_GOSRA/238-418    AC A0A0D2P184.1
#=GS A0A671RAZ5_9TELE/136-313    AC A0A671RAZ5.1
#=GS A0A2I3M9U8_PAPAN/296-488    AC A0A2I3M9U8.1
#=GS A0A672MVZ1_SINGR/196-383    AC A0A672MVZ1.1
#=GS A0A3P8VRD5_CYNSE/318-510    AC A0A3P8VRD5.1
#=GS G3TCL5_LOXAF/124-304        AC G3TCL5.1
#=GS A0A6J2XPS4_SITOR/523-668    AC A0A6J2XPS4.1
#=GS A0A0V0QD04_PSEPJ/158-341    AC A0A0V0QD04.1
#=GS A0A671WKI0_SPAAU/307-498    AC A0A671WKI0.1
#=GS A0A6J3AEY8_VICPA/135-319    AC A0A6J3AEY8.1
#=GS A0A1D6QVG6_MAIZE/226-407    AC A0A1D6QVG6.1
#=GS A0A6I8ST10_XENTR/300-492    AC A0A6I8ST10.2
#=GS E3M6M9_CAERE/167-340        AC E3M6M9.1
#=GS A2DYY1_TRIVA/148-321        AC A2DYY1.1
#=GS A0A2Y9F4N7_PHYMC/180-365    AC A0A2Y9F4N7.1
#=GS A0A091EY55_CORBR/512-701    AC A0A091EY55.1
#=GS A0CJP9_PARTE/140-309        AC A0CJP9.1
#=GS D6WGR3_TRICA/148-349        AC D6WGR3.1
#=GS A0A4U5PBP6_STECR/124-315    AC A0A4U5PBP6.1
#=GS A0A4R8RR85_COLTR/152-333    AC A0A4R8RR85.1
#=GS A0A1U8BXY2_MESAU/177-362    AC A0A1U8BXY2.1
#=GS A0A1D6HAA2_MAIZE/189-363    AC A0A1D6HAA2.1
#=GS W1PAX2_AMBTC/181-366        AC W1PAX2.1
#=GS A0A6P6N6G8_CARAU/150-276    AC A0A6P6N6G8.1
#=GS A0A3P9NG48_POERE/72-264     AC A0A3P9NG48.1
#=GS A0A0L0C1B1_LUCCU/256-442    AC A0A0L0C1B1.1
#=GS A0A2G2WJM1_CAPBA/168-355    AC A0A2G2WJM1.1
#=GS A0A667WT11_9TELE/53-241     AC A0A667WT11.1
#=GS A0A167XIV3_9AGAM/320-496    AC A0A167XIV3.1
#=GS A0A3P8RS75_AMPPE/165-349    AC A0A3P8RS75.1
#=GS A0A7N5KLP9_AILME/166-350    AC A0A7N5KLP9.1
#=GS A0A0M4EA28_DROBS/43-234     AC A0A0M4EA28.1
#=GS A0A6A1Q2U6_BALPH/245-319    AC A0A6A1Q2U6.1
#=GS A0A453QTC8_AEGTS/204-387    AC A0A453QTC8.1
#=GS A8WJL5_CAEBR/157-341        AC A8WJL5.1
#=GS M0S0K5_MUSAM/179-364        AC M0S0K5.1
#=GS H2NWJ3_PONAB/159-335        AC H2NWJ3.1
#=GS A0A485L574_9STRA/164-347    AC A0A485L574.1
#=GS H0V0B1_CAVPO/233-424        AC H0V0B1.1
#=GS A0A093J3E7_EURHL/107-292    AC A0A093J3E7.1
#=GS A0A674DST7_SALTR/159-342    AC A0A674DST7.1
#=GS A0A453P555_AEGTS/2-123      AC A0A453P555.1
#=GS A0A6J3QPC1_TURTR/313-428    AC A0A6J3QPC1.1
#=GS A0A5C6MWK8_9TELE/218-402    AC A0A5C6MWK8.1
#=GS A0A0V0UQQ7_9BILA/276-473    AC A0A0V0UQQ7.1
#=GS A0A6P9DAR0_PANGU/549-739    AC A0A6P9DAR0.1
#=GS G3THX0_LOXAF/167-350        AC G3THX0.1
#=GS G1P323_MYOLU/309-501        AC G1P323.1
#=GS A0A0B2QF04_GLYSO/170-355    AC A0A0B2QF04.1
#=GS A0A445IEZ8_GLYSO/196-381    AC A0A445IEZ8.1
#=GS A0A4W5PDB9_9TELE/22-235     AC A0A4W5PDB9.1
#=GS B3M946_DROAN/155-352        AC B3M946.1
#=GS A0A6I9PMB5_9TELE/175-356    AC A0A6I9PMB5.1
#=GS A0A1B9GDB8_9TREE/309-485    AC A0A1B9GDB8.1
#=GS G1LSQ1_AILME/64-251         AC G1LSQ1.1
#=GS A0A665W7C2_ECHNA/156-340    AC A0A665W7C2.1
#=GS A0A2K5TWQ7_MACFA/539-728    AC A0A2K5TWQ7.2
#=GS A0A093SP20_9PASS/107-292    AC A0A093SP20.1
#=GS A0A0B0NWB8_GOSAR/238-418    AC A0A0B0NWB8.1
#=GS A0A179HMG4_PURLI/154-335    AC A0A179HMG4.1
#=GS A0A2Y9K6Y9_ENHLU/17-197     AC A0A2Y9K6Y9.1
#=GS A0A368GWF6_ANCCA/285-482    AC A0A368GWF6.1
#=GS A0A6J2QCN5_COTGO/168-352    AC A0A6J2QCN5.1
#=GS A0A2K5RWV8_CEBIM/158-338    AC A0A2K5RWV8.1
#=GS A0A2K6LBV3_RHIBE/167-350    AC A0A2K6LBV3.1
#=GS A0A3Q2HZB4_HORSE/535-724    AC A0A3Q2HZB4.1
#=GS A0A6P9EFD1_JUGRE/224-405    AC A0A6P9EFD1.1
#=GS A0A663N9B5_ATHCN/84-265     AC A0A663N9B5.1
#=GS A0A177AWT6_9BILA/164-357    AC A0A177AWT6.1
#=GS G5EFF8_CAEEL/154-343        AC G5EFF8.1
#=GS A0A1Y2C725_9FUNG/163-339    AC A0A1Y2C725.1
#=GS A0A090L4S5_STRRB/155-337    AC A0A090L4S5.1
#=GS A0A0V1A0T3_9BILA/276-473    AC A0A0V1A0T3.1
#=GS A0A1B7TCH4_9ASCO/175-364    AC A0A1B7TCH4.1
#=GS A0A2I3RIB2_PANTR/160-355    AC A0A2I3RIB2.1
#=GS A0A446RWH4_TRITD/176-274    AC A0A446RWH4.1
#=GS A0A4U5P7Q5_POPAL/237-417    AC A0A4U5P7Q5.1
#=GS J9IK99_9SPIT/178-370        AC J9IK99.1
#=GS W5JI51_ANODA/150-347        AC W5JI51.1
#=GS A0A4W3GPB2_CALMI/143-338    AC A0A4W3GPB2.1
#=GS A0A2Y9HVJ8_NEOSC/178-365    AC A0A2Y9HVJ8.1
#=GS A0A0J8BF08_BETVV/234-419    AC A0A0J8BF08.1
#=GS H0ZFZ7_TAEGU/196-382        AC H0ZFZ7.2
#=GS A0A6Q2XD66_ESOLU/159-342    AC A0A6Q2XD66.1
#=GS U3KBV5_FICAL/167-351        AC U3KBV5.1
#=GS I1RQ38_GIBZE/448-556        AC I1RQ38.1
#=GS R7T249_DICSQ/154-342        AC R7T249.1
#=GS A0A368GWV8_ANCCA/167-346    AC A0A368GWV8.1
#=GS C7ZHX7_FUSV7/141-316        AC C7ZHX7.1
#=GS A0A158NWU6_ATTCE/157-343    AC A0A158NWU6.1
#=GS A0A6A6YP14_9PEZI/146-327    AC A0A6A6YP14.1
#=GS A0A0P7U1B8_SCLFO/27-135     AC A0A0P7U1B8.1
#=GS A0A7N6AC98_ANATE/295-486    AC A0A7N6AC98.1
#=GS A0A6J2T1Z7_DROLE/531-687    AC A0A6J2T1Z7.1
#=GS A0A3Q1LTD5_BOVIN/4-165      AC A0A3Q1LTD5.1
#=GS A0A2I0XH65_9ASPA/172-281    AC A0A2I0XH65.1
#=GS A0A068RKG3_9FUNG/303-480    AC A0A068RKG3.1
#=GS A0A1I7VXV2_LOALO/169-353    AC A0A1I7VXV2.1
#=GS A0A7N5JD89_AILME/682-874    AC A0A7N5JD89.1
#=GS Q0E9N2_DROME/521-678        AC Q0E9N2.3
#=GS A0A3Q3BNJ0_HAPBU/47-234     AC A0A3Q3BNJ0.1
#=GS A0A5E4EX86_PRUDU/180-358    AC A0A5E4EX86.1
#=GS A0A6J2GUB1_9PASS/158-339    AC A0A6J2GUB1.1
#=GS A0A0J8QMC2_COCIT/159-340    AC A0A0J8QMC2.1
#=GS A0A2K5LL75_CERAT/311-503    AC A0A2K5LL75.1
#=GS A0A1U7TZY7_CARSF/163-347    AC A0A1U7TZY7.1
#=GS A0CBV2_PARTE/163-321        AC A0CBV2.1
#=GS A0A6J2T152_DROLE/396-522    AC A0A6J2T152.1
#=GS A0A367KMU4_RHIST/261-439    AC A0A367KMU4.1
#=GS A0A669PA03_PHACC/167-350    AC A0A669PA03.1
#=GS A0A3P7R5I8_9BILA/105-251    AC A0A3P7R5I8.1
#=GS A0A1Y1WQ62_9FUNG/150-332    AC A0A1Y1WQ62.1
#=GS A0A6J1PHG1_9HYME/154-346    AC A0A6J1PHG1.1
#=GS A0A553PJ28_9TELE/894-1077   AC A0A553PJ28.1
#=GS A0A4Z1NEY9_9PEZI/149-330    AC A0A4Z1NEY9.1
#=GS A0A484G1C4_COLOR/232-413    AC A0A484G1C4.1
#=GS A5D7E8_BOVIN/160-355        AC A5D7E8.1
#=GS A0A665W7D7_ECHNA/154-340    AC A0A665W7D7.1
#=GS A0A6P6IAF6_PUMCO/246-429    AC A0A6P6IAF6.1
#=GS A0A091UR40_NIPNI/141-327    AC A0A091UR40.1
#=GS A0A015IYZ3_RHIIW/309-488    AC A0A015IYZ3.1
#=GS A0A173DWT3_9APIC/160-329    AC A0A173DWT3.1
#=GS A0A067GYQ8_CITSI/110-295    AC A0A067GYQ8.1
#=GS A0A0E0K123_ORYPU/469-649    AC A0A0E0K123.1
#=GS A0A4W6CEZ9_LATCA/168-351    AC A0A4W6CEZ9.1
#=GS A0A4U8UW73_STECR/209-393    AC A0A4U8UW73.1
#=GS A0A6P5XHN0_DURZI/183-360    AC A0A6P5XHN0.1
#=GS A0A5S6PH04_BRUMA/272-468    AC A0A5S6PH04.1
#=GS A0A1J6I4L9_NICAT/218-397    AC A0A1J6I4L9.1
#=GS A0A2S4UQU4_9BASI/222-406    AC A0A2S4UQU4.1
#=GS D8L9A3_WHEAT/201-384        AC D8L9A3.1
#=GS A0A5E4QD86_9NEOP/713-843    AC A0A5E4QD86.1
#=GS A0A4D9ARE4_SALSN/239-422    AC A0A4D9ARE4.1
#=GS A0A669F7T8_ORENI/160-354    AC A0A669F7T8.1
#=GS A0A1V9Y3F5_9ACAR/130-315    AC A0A1V9Y3F5.1
#=GS A0A4W2CB69_BOBOX/218-402    AC A0A4W2CB69.1
#=GS A0A445I338_GLYSO/241-421    AC A0A445I338.1
#=GS A0A671G3H7_RHIFE/179-366    AC A0A671G3H7.1
#=GS D3ZQK4_RAT/533-722          AC D3ZQK4.3
#=GS PDI_ASPOR/161-342           AC Q00248.1
#=GS A0A0A0A0M2_CHAVO/1-139      AC A0A0A0A0M2.1
#=GS A0A4W5P4N2_9TELE/108-291    AC A0A4W5P4N2.1
#=GS A0A0P6E5T3_9CRUS/156-343    AC A0A0P6E5T3.1
#=GS A0A094LAT2_PODCR/124-304    AC A0A094LAT2.1
#=GS F6VRC1_MACMU/237-424        AC F6VRC1.2
#=GS A0A3Q7SLW2_VULVU/518-707    AC A0A3Q7SLW2.1
#=GS A0A484FI51_COLOR/145-317    AC A0A484FI51.1
#=GS A0A1B8GCX8_9PEZI/383-534    AC A0A1B8GCX8.2
#=GS A0A4V6ASQ3_COLLU/113-307    AC A0A4V6ASQ3.1
#=GS A0A0D2Q970_GOSRA/13-142     AC A0A0D2Q970.1
#=GS A0A6J5WBJ2_PRUAR/168-353    AC A0A6J5WBJ2.1
#=GS A0A6P4FVQ3_DRORH/532-688    AC A0A6P4FVQ3.1
#=GS A2ZCE6_ORYSI/178-363        AC A2ZCE6.1
#=GS A0A3S2PE32_ORYJA/148-343    AC A0A3S2PE32.1
#=GS A0A388LIZ8_CHABU/317-499    AC A0A388LIZ8.1
#=GS A0A1S3QWX1_SALSA/167-350    AC A0A1S3QWX1.1
#=GS G3H4P3_CRIGR/49-236         AC G3H4P3.1
#=GS A0A5N6EAY6_9EURO/161-342    AC A0A5N6EAY6.1
#=GS A0A6S7LJL5_LACSI/165-349    AC A0A6S7LJL5.1
#=GS A0A485LN41_9STRA/229-421    AC A0A485LN41.1
#=GS A0A453QTT5_AEGTS/134-267    AC A0A453QTT5.1
#=GS A0A016UT30_9BILA/308-505    AC A0A016UT30.1
#=GS A0A5N4CW34_CAMDR/148-333    AC A0A5N4CW34.1
#=GS A0A0R0HDA3_SOYBN/260-440    AC A0A0R0HDA3.1
#=GS W2SWI1_NECAM/301-484        AC W2SWI1.1
#=GS A0A4U1FQI4_MONMO/436-623    AC A0A4U1FQI4.1
#=GS A0A673ZFZ7_SALTR/159-344    AC A0A673ZFZ7.1
#=GS A0A1Y1WQL2_9FUNG/316-511    AC A0A1Y1WQL2.1
#=GS A0A671XWM1_SPAAU/174-355    AC A0A671XWM1.1
#=GS A0A665UYA3_ECHNA/126-310    AC A0A665UYA3.1
#=GS A0A674J9D3_TERCA/171-355    AC A0A674J9D3.1
#=GS W5N712_LEPOC/309-501        AC W5N712.1
#=GS A0A421JNV6_9ASCO/175-367    AC A0A421JNV6.1
#=GS A0A0D3CC72_BRAOL/166-350    AC A0A0D3CC72.1
#=GS A0A4S2LWQ1_OPIFE/166-338    AC A0A4S2LWQ1.1
#=GS L5LSN1_MYODS/283-392        AC L5LSN1.1
#=GS A0A2P4SSH7_BAMTH/1-107      AC A0A2P4SSH7.1
#=GS A0A6G1B0H2_CROCR/139-326    AC A0A6G1B0H2.1
#=GS A0A4S8JX04_MUSBA/307-483    AC A0A4S8JX04.1
#=GS W9IPX4_FUSOX/155-336        AC W9IPX4.1
#=GS A0A0T6B7U3_9SCAR/103-289    AC A0A0T6B7U3.1
#=GS A0A2I0W595_9ASPA/182-360    AC A0A2I0W595.1
#=GS A0A672S0T8_SINGR/149-344    AC A0A672S0T8.1
#=GS M3WNT8_FELCA/180-365        AC M3WNT8.1
#=GS A0A3S2PW46_ORYJA/168-351    AC A0A3S2PW46.1
#=GS A0A0C3DDY0_9AGAM/162-280    AC A0A0C3DDY0.1
#=GS A0A672YUY1_9TELE/155-335    AC A0A672YUY1.1
#=GS A0A397Y6Z5_BRACM/202-387    AC A0A397Y6Z5.1
#=GS A0A0F8XLF9_9EURO/161-342    AC A0A0F8XLF9.1
#=GS A0A084GFZ7_PSEDA/155-330    AC A0A084GFZ7.1
#=GS A0A6J2XEI8_SITOR/150-347    AC A0A6J2XEI8.1
#=GS A0A0V0RI25_9BILA/645-834    AC A0A0V0RI25.1
#=GS A0A668SD94_OREAU/164-348    AC A0A668SD94.1
#=GS A0A384ALZ6_BALAS/147-316    AC A0A384ALZ6.1
#=GS A0A1S3ANY1_ERIEU/163-347    AC A0A1S3ANY1.1
#=GS A0A0D2X5K2_CAPO3/160-347    AC A0A0D2X5K2.1
#=GS E2AFC4_CAMFO/516-702        AC E2AFC4.1
#=GS E3S8N2_PYRTT/150-331        AC E3S8N2.1
#=GS T1ITB5_STRMM/185-374        AC T1ITB5.1
#=GS I1MMP3_SOYBN/62-172         AC I1MMP3.2
#=GS A0A6J0C7X9_NEOLC/156-342    AC A0A6J0C7X9.1
#=GS A0A1Q3B923_CEPFO/204-389    AC A0A1Q3B923.1
#=GS A0A5A7U8R9_CUCME/212-397    AC A0A5A7U8R9.1
#=GS A0A6P6MP79_CARAU/502-694    AC A0A6P6MP79.1
#=GS A0A668UMV1_OREAU/155-318    AC A0A668UMV1.1
#=GS A2E1U8_TRIVA/146-331        AC A2E1U8.1
#=GS A0A1U8JGA6_GOSHI/169-354    AC A0A1U8JGA6.1
#=GS A0A218ZCP5_9HELO/152-333    AC A0A218ZCP5.1
#=GS A0A0P1BRI1_9BASI/161-344    AC A0A0P1BRI1.1
#=GS A9V4Q6_MONBE/143-328        AC A9V4Q6.1
#=GS A0A0C4E152_MAGP6/149-324    AC A0A0C4E152.1
#=GS A0A2G4SQG6_RHIZD/260-432    AC A0A2G4SQG6.1
#=GS A0A1V4JAR0_PATFA/57-241     AC A0A1V4JAR0.1
#=GS A0A3P8ZRR3_ESOLU/160-353    AC A0A3P8ZRR3.2
#=GS A0A0D3AR90_BRAOL/1-84       AC A0A0D3AR90.1
#=GS A0A6A5N634_LUPAL/172-351    AC A0A6A5N634.1
#=GS A0A6J3H4X5_SAPAP/224-359    AC A0A6J3H4X5.1
#=GS A0A6I9WRE5_9HYME/569-727    AC A0A6I9WRE5.1
#=GS J9DS31_EDHAE/255-436        AC J9DS31.1
#=GS A0A3P6RAB8_CYLGO/120-317    AC A0A3P6RAB8.1
#=GS Q4MZU0_THEPA/181-386        AC Q4MZU0.1
#=GS A0A0L0CB27_LUCCU/160-357    AC A0A0L0CB27.1
#=GS A0A3P7LTT2_DIBLA/33-218     AC A0A3P7LTT2.1
#=GS A0A3N6RPN3_BRACR/118-303    AC A0A3N6RPN3.1
#=GS A0A4S4DQL2_CAMSI/173-357    AC A0A4S4DQL2.1
#=GS A0A1U7R8B0_ALLSI/162-345    AC A0A1U7R8B0.1
#=GS E9HCE8_DAPPU/156-343        AC E9HCE8.1
#=GS A0A212C6M2_CEREH/127-222    AC A0A212C6M2.1
#=GS B6ABP7_CRYMR/166-338        AC B6ABP7.1
#=GS A0A1Y2AHX4_9FUNG/153-333    AC A0A1Y2AHX4.1
#=GS A0A670IFF1_PODMU/293-485    AC A0A670IFF1.1
#=GS A0A132B6F7_9HELO/144-329    AC A0A132B6F7.1
#=GS A0A6J1APC7_9ROSI/174-350    AC A0A6J1APC7.1
#=GS G1QIF5_NOMLE/191-307        AC G1QIF5.3
#=GS A0A091HQD3_CALAN/124-304    AC A0A091HQD3.1
#=GS A0A1D1VIF5_RAMVA/161-346    AC A0A1D1VIF5.1
#=GS A0A507B3J2_9PEZI/151-332    AC A0A507B3J2.1
#=GS A0A6J2SWH6_DROLE/726-853    AC A0A6J2SWH6.1
#=GS A0A670Y584_PSETE/166-350    AC A0A670Y584.1
#=GS A0A2I4BEJ5_9TELE/544-737    AC A0A2I4BEJ5.1
#=GS A0A016S7K3_9BILA/155-334    AC A0A016S7K3.1
#=GS A0A2H1C347_FASHE/152-337    AC A0A2H1C347.1
#=GS A0A395NSV6_TRIAR/154-335    AC A0A395NSV6.1
#=GS A0A667XJ43_9TELE/159-342    AC A0A667XJ43.1
#=GS G1KKJ4_ANOCA/58-245         AC G1KKJ4.2
#=GS A0A087UMV3_STEMI/137-299    AC A0A087UMV3.1
#=GS A0A1Y2AUI3_9FUNG/153-333    AC A0A1Y2AUI3.1
#=GS A0A672NTU2_SINGR/307-499    AC A0A672NTU2.1
#=GS A0A673JH47_9TELE/157-352    AC A0A673JH47.1
#=GS A0A3P9NUZ4_POERE/204-384    AC A0A3P9NUZ4.1
#=GS A0A2J6R2N2_9HELO/173-356    AC A0A2J6R2N2.1
#=GS A0A060VRD3_ONCMY/134-328    AC A0A060VRD3.1
#=GS A0A099Z4R6_TINGU/29-216     AC A0A099Z4R6.1
#=GS A0A067KYC7_JATCU/238-422    AC A0A067KYC7.1
#=GS A0A093G423_DRYPU/78-273     AC A0A093G423.1
#=GS D5GF75_TUBMM/164-343        AC D5GF75.1
#=GS E4XYM6_OIKDI/158-335        AC E4XYM6.1
#=GS A0A6A2XIS1_HIBSY/106-248    AC A0A6A2XIS1.1
#=GS G4VFC2_SCHMA/152-337        AC G4VFC2.1
#=GS I1JZ42_SOYBN/182-368        AC I1JZ42.1
#=GS A0A177U3Y1_9BASI/171-356    AC A0A177U3Y1.1
#=GS PDIA2_HUMAN/179-366         AC Q13087.2
#=GS A0A665WIT0_ECHNA/160-343    AC A0A665WIT0.1
#=GS A0A5N5JVR5_PANHP/380-566    AC A0A5N5JVR5.1
#=GS A0A4W4GBT6_ELEEL/143-309    AC A0A4W4GBT6.1
#=GS B4J0B1_DROGR/155-351        AC B4J0B1.1
#=GS A0A6A4KQX3_9ERIC/172-357    AC A0A6A4KQX3.1
#=GS A0A1S3QX72_SALSA/159-339    AC A0A1S3QX72.1
#=GS A0A2K6SWF5_SAIBB/502-691    AC A0A2K6SWF5.1
#=GS A0A498M105_LABRO/205-266    AC A0A498M105.1
#=GS A0A6A4JQM5_APOLU/203-387    AC A0A6A4JQM5.1
#=GS R7TUV8_CAPTE/156-344        AC R7TUV8.1
#=GS H2Q5I8_PANTR/64-251         AC H2Q5I8.1
#=GS A0A328D6A4_9ASTE/168-378    AC A0A328D6A4.1
#=GS A0A1E5S157_HANUV/167-360    AC A0A1E5S157.1
#=GS A0A3Q3E7F4_9LABR/152-335    AC A0A3Q3E7F4.1
#=GS A0A151P658_ALLMI/116-302    AC A0A151P658.1
#=GS A0A0N4Y9M6_NIPBR/182-369    AC A0A0N4Y9M6.2
#=GS A0A093QA78_PHACA/1-139      AC A0A093QA78.1
#=GS A0A0K0DT41_STRER/267-464    AC A0A0K0DT41.1
#=GS U3JPP9_FICAL/89-269         AC U3JPP9.1
#=GS A0A310SGF8_9HYME/148-332    AC A0A310SGF8.1
#=GS A0A2P6PEB4_ROSCH/182-354    AC A0A2P6PEB4.1
#=GS C5GDB9_AJEDR/159-340        AC C5GDB9.1
#=GS A0A226NC95_CALSU/64-250     AC A0A226NC95.1
#=GS A0A093R3L2_PHACA/124-304    AC A0A093R3L2.1
#=GS A0A093J530_FULGA/106-301    AC A0A093J530.1
#=GS A0A672GLN1_SALFA/200-386    AC A0A672GLN1.1
#=GS W7IC84_9PEZI/155-335        AC W7IC84.1
#=GS A0A392MW27_9FABA/31-176     AC A0A392MW27.1
#=GS A0A139AGV2_GONPJ/162-344    AC A0A139AGV2.1
#=GS A0A0R3QK40_9BILA/1-162      AC A0A0R3QK40.1
#=GS A0A3B5QWF8_XIPMA/168-351    AC A0A3B5QWF8.1
#=GS G2X024_VERDV/155-336        AC G2X024.1
#=GS A0A3Q7R4T6_CALUR/64-196     AC A0A3Q7R4T6.1
#=GS A0A0D2SA04_GOSRA/187-368    AC A0A0D2SA04.1
#=GS A0A654I2F2_9CEST/723-905    AC A0A654I2F2.1
#=GS A0A6P8YZ57_THRPL/193-379    AC A0A6P8YZ57.1
#=GS A0A091VEX5_OPIHO/78-273     AC A0A091VEX5.1
#=GS A0A6P4FVR7_DRORH/200-358    AC A0A6P4FVR7.1
#=GS F4WXX7_ACREC/461-618        AC F4WXX7.1
#=GS A0A6P6R217_CARAU/152-346    AC A0A6P6R217.1
#=GS A0A3B5Q3Y0_XIPMA/154-335    AC A0A3B5Q3Y0.1
#=GS A0A2I0LYI2_COLLI/214-329    AC A0A2I0LYI2.1
#=GS A0A6G1PAE4_9TELE/159-342    AC A0A6G1PAE4.1
#=GS N1PCP4_DOTSN/150-334        AC N1PCP4.1
#=GS A0A7M7MNZ1_APIME/155-349    AC A0A7M7MNZ1.1
#=GS A0A0H3V2Z7_APIME/155-349    AC A0A0H3V2Z7.1
#=GS A0A067ESM8_CITSI/24-209     AC A0A067ESM8.1
#=GS R9ATZ3_WALI9/157-340        AC R9ATZ3.1
#=GS A0A0C2C558_9BILA/1-120      AC A0A0C2C558.1
#=GS A0A2G9TYJ7_TELCI/93-189     AC A0A2G9TYJ7.1
#=GS A0A3P8YNR2_ESOLU/159-339    AC A0A3P8YNR2.1
#=GS A0A672S1V6_SINGR/158-353    AC A0A672S1V6.1
#=GS A0A2R6XRV3_MARPO/177-365    AC A0A2R6XRV3.1
#=GS W7K5Y5_PLAFO/165-332        AC W7K5Y5.1
#=GS A0A101MF30_9EURO/162-343    AC A0A101MF30.1
#=GS A0A1U7RUP4_ALLSI/90-277     AC A0A1U7RUP4.1
#=GS A0A653CZD4_CALMS/230-415    AC A0A653CZD4.1
#=GS A0A3S2PUA6_ORYJA/159-343    AC A0A3S2PUA6.1
#=GS A0A3D8SH04_9HELO/153-334    AC A0A3D8SH04.1
#=GS G0N5S8_CAEBE/156-338        AC G0N5S8.1
#=GS A0A498I1Z9_MALDO/169-354    AC A0A498I1Z9.1
#=GS A0A1D6QVF9_MAIZE/221-410    AC A0A1D6QVF9.1
#=GS A0A316ULP7_9BASI/156-338    AC A0A316ULP7.1
#=GS W2TFE1_NECAM/36-210         AC W2TFE1.1
#=GS A0A5D2ZSI9_GOSMU/238-418    AC A0A5D2ZSI9.1
#=GS K3YTS3_SETIT/116-290        AC K3YTS3.1
#=GS A0A455B5B7_PHYMC/1-182      AC A0A455B5B7.1
#=GS A0A6P4Y592_BRABE/566-753    AC A0A6P4Y592.1
#=GS F6PGL7_MONDO/167-351        AC F6PGL7.2
#=GS A0A3Q1M5Q1_BOVIN/180-363    AC A0A3Q1M5Q1.1
#=GS A0A6G0UMJ9_9BILA/154-343    AC A0A6G0UMJ9.1
#=GS G3RY30_GORGO/312-504        AC G3RY30.2
#=GS A0A6P3J045_BISBI/92-279     AC A0A6P3J045.1
#=GS D7MTW1_ARALL/241-420        AC D7MTW1.1
#=GS A0A0P0VKA0_ORYSJ/192-366    AC A0A0P0VKA0.1
#=GS Q27780_STRPU/159-339        AC Q27780.1
#=GS A0A5F9CK97_RABIT/64-251     AC A0A5F9CK97.1
#=GS A0A0C2X8F7_9AGAM/155-340    AC A0A0C2X8F7.1
#=GS A0A0K9QRX8_SPIOL/172-357    AC A0A0K9QRX8.1
#=GS A0A1Y2WYJ8_9PEZI/149-322    AC A0A1Y2WYJ8.1
#=GS A0A2T4C2P8_TRILO/120-291    AC A0A2T4C2P8.1
#=GS A0A0V0SMH1_9BILA/173-357    AC A0A0V0SMH1.1
#=GS EUG1_YEAST/171-337          AC P32474.1
#=GS A0A4U1FD06_MONMO/54-168     AC A0A4U1FD06.1
#=GS A0A6P8U825_GYMAC/549-748    AC A0A6P8U825.1
#=GS A0A446Y2H9_TRITD/204-387    AC A0A446Y2H9.1
#=GS A0A669PDC0_PHACC/157-352    AC A0A669PDC0.1
#=GS G5BLP2_HETGA/530-719        AC G5BLP2.1
#=GS A0A433PTE2_9FUNG/257-450    AC A0A433PTE2.1
#=GS A0A6A4KPI2_9ERIC/174-281    AC A0A6A4KPI2.1
#=GS A0A6P4Y1C5_BRABE/155-346    AC A0A6P4Y1C5.1
#=GS A0A194XM23_9HELO/151-341    AC A0A194XM23.1
#=GS TMX3_MOUSE/161-341          AC Q8BXZ1.2
#=GS A0A061FHE6_THECC/168-353    AC A0A061FHE6.1
#=GS A0A2I3TNH1_PANTR/129-318    AC A0A2I3TNH1.1
#=GS W5LGK0_ASTMX/152-345        AC W5LGK0.2
#=GS A0A5D2V1G1_GOSMU/171-352    AC A0A5D2V1G1.1
#=GS A0A0V1BKZ8_TRISP/175-359    AC A0A0V1BKZ8.1
#=GS A0A1Y2AT02_9FUNG/176-368    AC A0A1Y2AT02.1
#=GS A0A445I2Z1_GLYSO/241-421    AC A0A445I2Z1.1
#=GS A0A2T6ZNM7_TUBBO/163-343    AC A0A2T6ZNM7.1
#=GS A0A446RWP5_TRITD/157-342    AC A0A446RWP5.1
#=GS V5ELJ8_KALBG/161-342        AC V5ELJ8.1
#=GS A0A091UYN7_NIPNI/1-139      AC A0A091UYN7.1
#=GS A0A016W046_9BILA/154-336    AC A0A016W046.1
#=GS A0A6A5F7U8_PERFL/149-344    AC A0A6A5F7U8.1
#=GS G7PRU4_MACFA/130-313        AC G7PRU4.2
#=GS A0A4W3I1Z3_CALMI/282-473    AC A0A4W3I1Z3.1
#=GS A0A2V0PFK0_9CHLO/39-226     AC A0A2V0PFK0.1
#=GS A0A6P5DYH6_BOSIN/291-471    AC A0A6P5DYH6.1
#=GS A0A671TNP2_SPAAU/159-343    AC A0A671TNP2.1
#=GS A0A452GYM9_9SAUR/167-350    AC A0A452GYM9.1
#=GS M7BKA0_CHEMY/126-310        AC M7BKA0.1
#=GS A0A670JH76_PODMU/138-326    AC A0A670JH76.1
#=GS A0A6P8IN64_ACTTE/717-904    AC A0A6P8IN64.1
#=GS A0A218UEA6_9PASE/161-356    AC A0A218UEA6.1
#=GS A0A2K6FTR7_PROCO/160-355    AC A0A2K6FTR7.1
#=GS A0A3Q2LUJ9_HORSE/117-302    AC A0A3Q2LUJ9.2
#=GS A0A453HJU4_AEGTS/190-284    AC A0A453HJU4.1
#=GS A0A2V5HD71_ASPV1/160-341    AC A0A2V5HD71.1
#=GS A0A482XFL6_LAOST/167-352    AC A0A482XFL6.1
#=GS F6X2T1_ORNAN/316-508        AC F6X2T1.2
#=GS A0A286ULW6_9AGAM/345-496    AC A0A286ULW6.1
#=GS A0A016S7X2_9BILA/171-349    AC A0A016S7X2.1
#=GS A0A672RS13_SINGR/157-315    AC A0A672RS13.1
#=GS A0A316YEV9_9BASI/113-296    AC A0A316YEV9.1
#=GS G2R6V6_THETT/127-275        AC G2R6V6.1
#=GS A0A452DL27_CAPHI/149-329    AC A0A452DL27.1
#=GS A0A061GXZ8_THECC/234-414    AC A0A061GXZ8.1
#=GS A0A093IVD6_FULGA/513-702    AC A0A093IVD6.1
#=GS A0A671XF93_SPAAU/208-393    AC A0A671XF93.1
#=GS A0A158PIS9_ANGCS/181-352    AC A0A158PIS9.1
#=GS A0A6I9JTE6_CHRAS/64-196     AC A0A6I9JTE6.1
#=GS A0A482VST5_9CUCU/114-298    AC A0A482VST5.1
#=GS A0A044SLK9_ONCVO/176-358    AC A0A044SLK9.1
#=GS A0A087QHS4_APTFO/283-474    AC A0A087QHS4.1
#=GS A0A4W2BMQ8_BOBOX/376-563    AC A0A4W2BMQ8.1
#=GS A0A0D2TN20_GOSRA/228-412    AC A0A0D2TN20.1
#=GS A0A061GAB2_THECC/213-398    AC A0A061GAB2.1
#=GS A0A2K3NG11_TRIPR/198-383    AC A0A2K3NG11.1
#=GS W9R743_9ROSA/167-352        AC W9R743.1
#=GS A0A4Z0Z9X8_9PEZI/157-338    AC A0A4Z0Z9X8.1
#=GS ERP27_MOUSE/64-251          AC Q9D8U3.1
#=GS A0A6P6MDN6_CARAU/168-348    AC A0A6P6MDN6.1
#=GS A0A3Q7PNT4_CALUR/64-251     AC A0A3Q7PNT4.1
#=GS A0A1L8FSL5_XENLA/158-338    AC A0A1L8FSL5.1
#=GS A0A091LQZ6_CARIC/112-296    AC A0A091LQZ6.1
#=GS A0A2I0KH83_PUNGR/217-398    AC A0A2I0KH83.1
#=GS A0A091MFX7_9PASS/513-703    AC A0A091MFX7.1
#=GS G1LAK0_AILME/59-175         AC G1LAK0.2
#=GS A0A2K5W0A7_MACFA/180-365    AC A0A2K5W0A7.2
#=GS A0A4D9AJ25_SALSN/218-403    AC A0A4D9AJ25.1
#=GS A0A367JIN9_RHIST/361-545    AC A0A367JIN9.1
#=GS A0A1L8FX09_XENLA/167-350    AC A0A1L8FX09.1
#=GS A0A2P6PXC0_ROSCH/168-353    AC A0A2P6PXC0.1
#=GS A0A093PMC7_9PASS/375-564    AC A0A093PMC7.1
#=GS A0A091HN69_BUCRH/84-279     AC A0A091HN69.1
#=GS A0A1U8AG69_NELNU/228-409    AC A0A1U8AG69.1
#=GS A0A1Y2FTS9_9FUNG/307-496    AC A0A1Y2FTS9.1
#=GS W1NSD6_AMBTC/209-393        AC W1NSD6.1
#=GS A0A096NKD8_PAPAN/147-334    AC A0A096NKD8.2
#=GS A2F3V0_TRIVA/150-322        AC A2F3V0.1
#=GS A0A6I9MAN5_PERMB/310-502    AC A0A6I9MAN5.1
#=GS A0A1W0WMM5_HYPDU/306-496    AC A0A1W0WMM5.1
#=GS A0A4W5MZ50_9TELE/142-336    AC A0A4W5MZ50.1
#=GS A0A6J3Q3T2_TURTR/180-365    AC A0A6J3Q3T2.1
#=GS A0A1Q3BEE2_CEPFO/234-413    AC A0A1Q3BEE2.1
#=GS A0A078JLX9_BRANA/13-161     AC A0A078JLX9.1
#=GS A0A1I8FZN1_9PLAT/163-351    AC A0A1I8FZN1.1
#=GS A0A674DW82_SALTR/288-480    AC A0A674DW82.1
#=GS A0A6J2UUW8_CHACN/151-331    AC A0A6J2UUW8.1
#=GS A0A452QB48_URSAM/64-251     AC A0A452QB48.1
#=GS A0A3A2ZRB3_9EURO/161-342    AC A0A3A2ZRB3.1
#=GS I2GWP0_TETBL/170-348        AC I2GWP0.1
#=GS B4LUI6_DROVI/147-336        AC B4LUI6.2
#=GS A0A3L8SQ82_CHLGU/32-218     AC A0A3L8SQ82.1
#=GS A0A2G4SH67_RHIZD/151-333    AC A0A2G4SH67.1
#=GS G7XB83_ASPKW/157-338        AC G7XB83.1
#=GS A0A3P9BB69_9CICH/172-355    AC A0A3P9BB69.1
#=GS A0A1Y2H6T7_9FUNG/162-347    AC A0A1Y2H6T7.1
#=GS A0A2R8M8L7_CALJA/141-321    AC A0A2R8M8L7.1
#=GS A0A4Z1HNM1_9HELO/152-333    AC A0A4Z1HNM1.1
#=GS G0SGS2_CHATD/153-334        AC G0SGS2.1
#=GS A0A2I2U0T8_FELCA/119-303    AC A0A2I2U0T8.2
#=GS A0A673JH62_9TELE/154-349    AC A0A673JH62.1
#=GS G3ND86_GASAC/292-484        AC G3ND86.1
#=GS A0A368GG51_ANCCA/100-288    AC A0A368GG51.1
#=GS A0A2X0ML21_9BASI/281-461    AC A0A2X0ML21.1
#=GS A0A3Q1GT23_9TELE/152-333    AC A0A3Q1GT23.1
#=GS A0A671F828_RHIFE/167-350    AC A0A671F828.1
#=GS A0A3P8BLW7_9BILA/145-333    AC A0A3P8BLW7.1
#=GS G3V6T7_RAT/310-502          AC G3V6T7.1
#=GS A0A3Q7G4E2_SOLLC/215-399    AC A0A3Q7G4E2.1
#=GS A0A7M7SQD3_APIME/159-343    AC A0A7M7SQD3.1
#=GS A0A672RH83_SINGR/158-338    AC A0A672RH83.1
#=GS A0A2I3N0F6_PAPAN/163-332    AC A0A2I3N0F6.1
#=GS A0A0B0NC34_GOSAR/173-341    AC A0A0B0NC34.1
#=GS G0M853_CAEBE/157-341        AC G0M853.1
#=GS A0A2G5VJP6_9PELO/154-343    AC A0A2G5VJP6.1
#=GS A0A0L7QZG3_9HYME/126-309    AC A0A0L7QZG3.1
#=GS A0A0F4GSE1_9PEZI/150-334    AC A0A0F4GSE1.1
#=GS A0A074S0A9_9AGAM/152-338    AC A0A074S0A9.1
#=GS A0A6H5KUL3_9PHAE/108-308    AC A0A6H5KUL3.1
#=GS A0A6J8EGB2_MYTCO/551-738    AC A0A6J8EGB2.1
#=GS A0A667Y1T1_9TELE/162-356    AC A0A667Y1T1.1
#=GS A0A158P932_ANGCA/152-340    AC A0A158P932.1
#=GS A0A6P3ETX8_OCTDE/160-355    AC A0A6P3ETX8.1
#=GS A0A1U8DLZ9_ALLSI/220-415    AC A0A1U8DLZ9.2
#=GS A0A6J2SYD5_DROLE/200-357    AC A0A6J2SYD5.1
#=GS A0A1J9SEY6_9PEZI/153-334    AC A0A1J9SEY6.1
#=GS A0A6P8QRE3_GEOSA/158-338    AC A0A6P8QRE3.1
#=GS A0A4W6ETD6_LATCA/168-352    AC A0A4W6ETD6.1
#=GS A0A0D7BFP2_9AGAR/296-474    AC A0A0D7BFP2.1
#=GS K3XW92_SETIT/206-391        AC K3XW92.1
#=GS A0A287VS39_HORVV/166-350    AC A0A287VS39.1
#=GS A0A2K5ILJ4_COLAP/533-722    AC A0A2K5ILJ4.1
#=GS A0A3Q1E9F7_9TELE/156-335    AC A0A3Q1E9F7.1
#=GS V4A0E4_LOTGI/1-85           AC V4A0E4.1
#=GS A0A6P4I967_DROKI/522-678    AC A0A6P4I967.1
#=GS A0A1J1I589_9DIPT/158-342    AC A0A1J1I589.1
#=GS W9Z530_9EURO/153-333        AC W9Z530.1
#=GS A0A287VSC6_HORVV/49-232     AC A0A287VSC6.1
#=GS U5D269_AMBTC/136-319        AC U5D269.1
#=GS A0A6P3W3B4_CLUHA/309-501    AC A0A6P3W3B4.1
#=GS A0A668USS0_OREAU/132-300    AC A0A668USS0.1
#=GS A0A671Y1K0_SPAAU/149-328    AC A0A671Y1K0.1
#=GS A0A0V0RQL1_9BILA/177-361    AC A0A0V0RQL1.1
#=GS A0A7M7M1X1_NASVI/563-701    AC A0A7M7M1X1.1
#=GS G8JM34_ERECY/170-349        AC G8JM34.1
#=GS A0A093BQ97_CHAPE/70-220     AC A0A093BQ97.1
#=GS A0A384DGF1_URSMA/250-433    AC A0A384DGF1.1
#=GS A0A673VA41_SURSU/160-355    AC A0A673VA41.1
#=GS A0A6P8SYW3_GYMAC/306-498    AC A0A6P8SYW3.1
#=GS A0A3Q2GEX1_CYPVA/153-335    AC A0A3Q2GEX1.1
#=GS A0A499FI48_HUMAN/312-505    AC A0A499FI48.1
#=GS A0A674PKV0_TAKRU/159-343    AC A0A674PKV0.1
#=GS G3Y367_ASPNA/157-338        AC G3Y367.1
#=GS A0A3Q7U2F8_VULVU/306-423    AC A0A3Q7U2F8.1
#=GS A0A6J8AHK1_MYTCO/268-459    AC A0A6J8AHK1.1
#=GS A0A1D6QVG7_MAIZE/120-301    AC A0A1D6QVG7.1
#=GS A0A0D9S041_CHLSB/158-338    AC A0A0D9S041.1
#=GS E1JGY6_DROME/533-691        AC E1JGY6.1
#=GS A0A6J3MAF8_9PEZI/150-334    AC A0A6J3MAF8.1
#=GS A0A6Q2WVI5_ESOLU/121-304    AC A0A6Q2WVI5.1
#=GS A0A1L8FYC9_XENLA/206-386    AC A0A1L8FYC9.1
#=GS A0A672P9F6_SINGR/125-320    AC A0A672P9F6.1
#=GS A0A6I9Z3C0_9SAUR/203-318    AC A0A6I9Z3C0.1
#=GS A0A0T6AVS7_9SCAR/150-347    AC A0A0T6AVS7.1
#=GS A0A1J7J6Z4_9PEZI/153-334    AC A0A1J7J6Z4.1
#=GS A0A0N4UWS3_ENTVE/284-480    AC A0A0N4UWS3.1
#=GS A0A1E3NS06_9ASCO/172-358    AC A0A1E3NS06.1
#=GS A0A0N4V9V9_ENTVE/159-347    AC A0A0N4V9V9.2
#=GS A0A0S3SGK8_PHAAN/216-395    AC A0A0S3SGK8.1
#=GS A0A2Y9QV66_TRIMA/105-288    AC A0A2Y9QV66.1
#=GS M4DN61_BRARP/166-350        AC M4DN61.1
#=GS A0A287TFS5_HORVV/150-258    AC A0A287TFS5.1
#=GS B8A5M6_DANRE/193-380        AC B8A5M6.1
#=GS A0A6J1NY59_BICAN/523-706    AC A0A6J1NY59.1
#=GS G1QU05_NOMLE/282-474        AC G1QU05.2
#=GS A0A672YR54_9TELE/159-343    AC A0A672YR54.1
#=GS F6VQ57_ORNAN/482-671        AC F6VQ57.2
#=GS A0A669DHU7_ORENI/155-318    AC A0A669DHU7.1
#=GS A0A6P5K751_PHACI/158-339    AC A0A6P5K751.1
#=GS A0A5N6DHK8_ASPPA/161-342    AC A0A5N6DHK8.1
#=GS A0A1Z5RN17_SORBI/258-431    AC A0A1Z5RN17.1
#=GS A0A059BUF9_EUCGR/207-392    AC A0A059BUF9.1
#=GS A0A151TN87_CAJCA/229-415    AC A0A151TN87.1
#=GS G3SBE9_GORGO/161-345        AC G3SBE9.2
#=GS G1NVR9_MYOLU/188-305        AC G1NVR9.1
#=GS A0A2G5SC40_9PELO/157-341    AC A0A2G5SC40.1
#=GS M0R402_RAT/161-344          AC M0R402.2
#=GS F6WTQ0_ORNAN/165-349        AC F6WTQ0.3
#=GS A0A367JV00_RHIAZ/260-432    AC A0A367JV00.1
#=GS A0A6P6NUB4_CARAU/158-352    AC A0A6P6NUB4.1
#=GS A0A286XWW8_CAVPO/167-350    AC A0A286XWW8.1
#=GS A0A4U5PCN6_STECR/152-339    AC A0A4U5PCN6.1
#=GS A0A673ZGF3_SALTR/149-347    AC A0A673ZGF3.1
#=GS A0A371CWQ8_9APHY/320-496    AC A0A371CWQ8.1
#=GS A0A287TFS3_HORVV/38-150     AC A0A287TFS3.1
#=GS A0A168Q291_MUCCL/168-337    AC A0A168Q291.1
#=GS A0A672K553_SINGR/71-258     AC A0A672K553.1
#=GS A0A673V501_SURSU/158-338    AC A0A673V501.1
#=GS A0A402EM88_9SAUR/205-320    AC A0A402EM88.1
#=GS A0A2K1KNJ7_PHYPA/175-349    AC A0A2K1KNJ7.1
#=GS A0A6G0UK64_9BILA/161-341    AC A0A6G0UK64.1
#=GS A0A2H5QSW8_CITUN/641-803    AC A0A2H5QSW8.1
#=GS A0A5J5CKL8_9PERO/307-499    AC A0A5J5CKL8.1
#=GS A0A446QEY3_TRITD/242-421    AC A0A446QEY3.1
#=GS A0A2Y9P1C9_DELLE/17-197     AC A0A2Y9P1C9.1
#=GS I3L0S0_HUMAN/161-245        AC I3L0S0.2
#=GS A0A6J3FMK1_SAPAP/534-723    AC A0A6J3FMK1.1
#=GS A0A087XGV1_POEFO/309-500    AC A0A087XGV1.2
#=GS A0A674DTA4_SALTR/162-345    AC A0A674DTA4.1
#=GS A0A5D2Z6Y3_GOSMU/213-397    AC A0A5D2Z6Y3.1
#=GS A0A0L7LLK1_9NEOP/1-58       AC A0A0L7LLK1.1
#=GS A0A287II80_HORVV/173-364    AC A0A287II80.1
#=GS A0A091GYS7_BUCRH/123-304    AC A0A091GYS7.1
#=GS A0A3Q0EZG2_VIGRR/199-389    AC A0A3Q0EZG2.1
#=GS G1KIB7_ANOCA/153-336        AC G1KIB7.2
#=GS A0A452F658_CAPHI/171-358    AC A0A452F658.1
#=GS A0A6P3ZA03_ZIZJJ/231-410    AC A0A6P3ZA03.1
#=GS A0A067GCR5_CITSI/78-258     AC A0A067GCR5.1
#=GS A0A6P5JG06_PHACI/311-502    AC A0A6P5JG06.1
#=GS W2TXM0_NECAM/58-204         AC W2TXM0.1
#=GS A0A1S3ADT4_ERIEU/160-355    AC A0A1S3ADT4.1
#=GS A0A3Q1I7S4_ANATE/210-396    AC A0A3Q1I7S4.1
#=GS A0A1I8IDA5_9PLAT/295-481    AC A0A1I8IDA5.1
#=GS A0A6J0SE55_9SAUR/35-225     AC A0A6J0SE55.1
#=GS A0A183WSQ6_TRIRE/152-337    AC A0A183WSQ6.1
#=GS A0A671TK70_SPAAU/159-343    AC A0A671TK70.1
#=GS A0A1X2GCR8_9FUNG/157-339    AC A0A1X2GCR8.1
#=GS A0A671UG78_SPAAU/146-329    AC A0A671UG78.1
#=GS A0A6I9ZFN2_ACIJB/64-251     AC A0A6I9ZFN2.1
#=GS A0A0J7K579_LASNI/6-192      AC A0A0J7K579.1
#=GS A0A2K0W202_GIBNY/457-569    AC A0A2K0W202.1
#=GS I7MHY7_TETTS/162-346        AC I7MHY7.1
#=GS A0A5C3NRF9_9AGAM/364-503    AC A0A5C3NRF9.1
#=GS A0A2B4RL32_STYPI/154-341    AC A0A2B4RL32.1
#=GS A0A2G9UMC4_TELCI/165-344    AC A0A2G9UMC4.1
#=GS A0A6J2W223_CHACN/159-343    AC A0A6J2W223.1
#=GS A0A6P4IY40_DROKI/158-343    AC A0A6P4IY40.1
#=GS A0A6A2YSA6_HIBSY/169-354    AC A0A6A2YSA6.1
#=GS A0A1J1IIL6_9DIPT/151-347    AC A0A1J1IIL6.1
#=GS A0A0Q3PK55_AMAAE/544-733    AC A0A0Q3PK55.1
#=GS A0A6I8VRE4_DROPS/531-688    AC A0A6I8VRE4.1
#=GS A0A218U956_9PASE/191-377    AC A0A218U956.1
#=GS A0A6J0ZC10_ODOVR/309-424    AC A0A6J0ZC10.1
#=GS A0A2G3D0B1_CAPCH/205-390    AC A0A2G3D0B1.1
#=GS A0A016X2B2_9BILA/122-310    AC A0A016X2B2.1
#=GS A0A2P5HRH2_9PEZI/29-204     AC A0A2P5HRH2.1
#=GS A0A3Q1H9U4_9TELE/141-336    AC A0A3Q1H9U4.1
#=GS A0A3B6PMB0_WHEAT/185-354    AC A0A3B6PMB0.1
#=GS A0A6J3GNI2_SAPAP/266-426    AC A0A6J3GNI2.1
#=GS A0A3Q0KNS8_SCHMA/167-347    AC A0A3Q0KNS8.1
#=GS A0A2I0K235_PUNGR/226-406    AC A0A2I0K235.1
#=GS A0A672NLF5_SINGR/144-241    AC A0A672NLF5.1
#=GS A0A176W9K9_MARPO/177-365    AC A0A176W9K9.1
#=GS A0A553N7B4_TIGCA/163-376    AC A0A553N7B4.1
#=GS A0A1S4BKR7_TOBAC/181-364    AC A0A1S4BKR7.1
#=GS A0A3P7DNN1_WUCBA/279-428    AC A0A3P7DNN1.1
#=GS TMX3_HUMAN/158-338          AC Q96JJ7.2
#=GS A0A670KM40_PODMU/315-430    AC A0A670KM40.1
#=GS A0A4W2DQ44_BOBOX/506-695    AC A0A4W2DQ44.1
#=GS A0A6J3H5J1_SAPAP/224-411    AC A0A6J3H5J1.1
#=GS A0A0C9W3X5_9AGAM/332-510    AC A0A0C9W3X5.1
#=GS A0A2T7NEV5_POMCA/152-341    AC A0A2T7NEV5.1
#=GS M4DCV2_BRARP/202-351        AC M4DCV2.1
#=GS A0A084VVB5_ANOSI/162-348    AC A0A084VVB5.1
#=GS A0A2I4BGL5_9TELE/168-352    AC A0A2I4BGL5.1
#=GS A0A453HK00_AEGTS/176-361    AC A0A453HK00.1
#=GS A0A183KRP4_9TREM/153-337    AC A0A183KRP4.1
#=GS A0A6P3IRF0_BISBI/163-347    AC A0A6P3IRF0.1
#=GS A0A0P0WAJ0_ORYSJ/170-263    AC A0A0P0WAJ0.1
#=GS M3XI22_LATCH/153-334        AC M3XI22.1
#=GS A0A2R8ZMB5_PANPA/180-365    AC A0A2R8ZMB5.1
#=GS A0A653HCL6_9APIC/201-381    AC A0A653HCL6.1
#=GS S9VYB4_SCHCR/154-335        AC S9VYB4.1
#=GS B8NPF9_ASPFN/161-342        AC B8NPF9.1
#=GS A0A507DQP5_9FUNG/358-540    AC A0A507DQP5.1
#=GS H2Q8B3_PANTR/533-722        AC H2Q8B3.2
#=GS A0A3D8QK74_9HELO/54-236     AC A0A3D8QK74.1
#=GS A0A4S2L8C4_OPIFE/157-344    AC A0A4S2L8C4.1
#=GS A0A6H5GSL9_9HEMI/523-668    AC A0A6H5GSL9.1
#=GS D2I1N2_AILME/180-365        AC D2I1N2.1
#=GS A0A6P8EUD4_CLUHA/52-239     AC A0A6P8EUD4.1
#=GS A0A395J337_9HELO/152-333    AC A0A395J337.1
#=GS A0A7P0T8J3_HUMAN/248-325    AC A0A7P0T8J3.1
#=GS A0A2G9HC51_9LAMI/231-411    AC A0A2G9HC51.1
#=GS A0A091PXD6_HALAL/1-139      AC A0A091PXD6.1
#=GS A0A653DT26_CALMS/162-341    AC A0A653DT26.1
#=GS A0A453C019_AEGTS/67-243     AC A0A453C019.1
#=GS A0A0B1P2E6_UNCNE/163-344    AC A0A0B1P2E6.1
#=GS A0A4W5NB20_9TELE/188-382    AC A0A4W5NB20.1
#=GS K2MST0_TRYCR/81-258         AC K2MST0.1
#=GS A0A1J6HW36_NICAT/240-419    AC A0A1J6HW36.1
#=GS A0A1A6GXT3_NEOLE/163-347    AC A0A1A6GXT3.1
#=GS A0A6I9I258_VICPA/64-251     AC A0A6I9I258.1
#=GS A0A6P7KWZ4_BETSP/148-321    AC A0A6P7KWZ4.1
#=GS A0A3P8WZ57_CYNSE/155-283    AC A0A3P8WZ57.1
#=GS A0A3M0KBT2_HIRRU/295-410    AC A0A3M0KBT2.1
#=GS A0A7J6JMS0_COLFN/162-343    AC A0A7J6JMS0.1
#=GS A0A384CFY7_URSMA/213-328    AC A0A384CFY7.1
#=GS A0A453QTK6_AEGTS/204-387    AC A0A453QTK6.1
#=GS A0A397YFI6_BRACM/169-353    AC A0A397YFI6.1
#=GS A0A671MGJ6_9TELE/168-352    AC A0A671MGJ6.1
#=GS A0A0D2BBV3_9EURO/153-333    AC A0A0D2BBV3.1
#=GS A9VDI0_MONBE/182-358        AC A9VDI0.1
#=GS F6QYR2_HORSE/185-372        AC F6QYR2.2
#=GS A0A674IK84_TERCA/241-432    AC A0A674IK84.1
#=GS H9J250_BOMMO/157-314        AC H9J250.1
#=GS A0A087R009_APTFO/193-308    AC A0A087R009.1
#=GS A0A6J1NN92_BICAN/169-355    AC A0A6J1NN92.1
#=GS A0CLM8_PARTE/155-332        AC A0CLM8.1
#=GS Q5CSY8_CRYPI/309-455        AC Q5CSY8.1
#=GS A0A091NBM6_9PASS/78-273     AC A0A091NBM6.1
#=GS A0A6P3J6Y8_BISBI/222-337    AC A0A6P3J6Y8.1
#=GS A0A1Y1X3D3_9FUNG/156-336    AC A0A1Y1X3D3.1
#=GS A0A0B2URC6_TOXCA/166-348    AC A0A0B2URC6.1
#=GS A0A673L8S3_9TELE/149-329    AC A0A673L8S3.1
#=GS G1Q0H7_MYOLU/166-350        AC G1Q0H7.1
#=GS A0A2I4C2I5_9TELE/305-496    AC A0A2I4C2I5.1
#=GS A0A498LMW8_LABRO/153-347    AC A0A498LMW8.1
#=GS B4KSD0_DROMO/157-342        AC B4KSD0.1
#=GS A0A672UNP4_STRHB/294-410    AC A0A672UNP4.1
#=GS A0A1U7LST4_NEOID/190-367    AC A0A1U7LST4.1
#=GS A0A0A0LQ17_CUCSA/173-355    AC A0A0A0LQ17.1
#=GS A0A1D5PKM6_CHICK/192-378    AC A0A1D5PKM6.2
#=GS A0A080WN84_TRIRC/34-213     AC A0A080WN84.1
#=GS A0A091EIZ8_CORBR/124-304    AC A0A091EIZ8.1
#=GS G3VF54_SARHA/541-730        AC G3VF54.2
#=GS A0A4U5VHR0_COLLU/309-501    AC A0A4U5VHR0.1
#=GS A0A445BVW9_ARAHY/233-413    AC A0A445BVW9.1
#=GS A0A2G9TQ19_TELCI/13-108     AC A0A2G9TQ19.1
#=GS R7Q3U2_CHOCR/155-335        AC R7Q3U2.1
#=GS A0A3Q3E738_9LABR/168-351    AC A0A3Q3E738.1
#=GS A0A4X2LAC4_VOMUR/167-350    AC A0A4X2LAC4.1
#=GS A0A1D1VBK9_RAMVA/192-343    AC A0A1D1VBK9.1
#=GS A0A673L8V4_9TELE/143-325    AC A0A673L8V4.1
#=GS A0A1X2HXD6_9FUNG/256-440    AC A0A1X2HXD6.1
#=GS A0A6P9CLF6_PANGU/127-308    AC A0A6P9CLF6.1
#=GS M9MGJ3_PSEA3/444-631        AC M9MGJ3.1
#=GS A0A176VIG9_MARPO/160-345    AC A0A176VIG9.1
#=GS A0A674CZ57_SALTR/154-348    AC A0A674CZ57.1
#=GS A0A1S2XEK6_CICAR/197-382    AC A0A1S2XEK6.1
#=GS A0A1Y2VMZ7_9PEZI/154-335    AC A0A1Y2VMZ7.1
#=GS S7N036_MYOBR/49-233         AC S7N036.1
#=GS A0A6P8WWB0_DROAB/202-362    AC A0A6P8WWB0.1
#=GS A0A4W5Q4Q2_9TELE/122-316    AC A0A4W5Q4Q2.1
#=GS A0A6I9XS21_9SAUR/166-350    AC A0A6I9XS21.1
#=GS A0A078I4X3_BRANA/1-84       AC A0A078I4X3.1
#=GS A0A6A2WK05_HIBSY/209-393    AC A0A6A2WK05.1
#=GS A0A1D6J547_MAIZE/182-356    AC A0A1D6J547.1
#=GS A0A0P0XZP3_ORYSJ/81-266     AC A0A0P0XZP3.1
#=GS A0A6Q2YGL5_ESOLU/152-324    AC A0A6Q2YGL5.1
#=GS A0A671QYK2_9TELE/159-354    AC A0A671QYK2.1
#=GS A0A6J2KNQ0_BOMMA/311-468    AC A0A6J2KNQ0.1
#=GS U6KFU8_9EIME/193-405        AC U6KFU8.1
#=GS A0A2P4TCT5_BAMTH/166-364    AC A0A2P4TCT5.1
#=GS W6U707_ECHGR/159-350        AC W6U707.1
#=GS A0A0F9XMU1_TRIHA/112-283    AC A0A0F9XMU1.1
#=GS A0A4P9VWY9_9FUNG/250-387    AC A0A4P9VWY9.1
#=GS A0A674DWT3_SALTR/291-483    AC A0A674DWT3.1
#=GS A0A3Q8IS34_LEIDO/179-331    AC A0A3Q8IS34.1
#=GS G3AV65_SPAPN/175-367        AC G3AV65.1
#=GS E9DSE8_METAQ/156-337        AC E9DSE8.1
#=GS A0A6P3ZX36_ZIZJJ/189-363    AC A0A6P3ZX36.1
#=GS M3ZE50_XIPMA/169-353        AC M3ZE50.2
#=GS A0A565CDD3_9BRAS/163-329    AC A0A565CDD3.1
#=GS A0A553R7B3_9TELE/243-429    AC A0A553R7B3.1
#=GS H2LHD8_ORYLA/47-234         AC H2LHD8.1
#=GS T1HJ96_RHOPR/107-295        AC T1HJ96.1
#=GS A0A6P4JRE3_DROKI/164-351    AC A0A6P4JRE3.1
#=GS A0A673ZQE3_SALTR/114-297    AC A0A673ZQE3.1
#=GS A0A016SRG9_9BILA/191-375    AC A0A016SRG9.1
#=GS A0A0K0EV84_STRVS/159-338    AC A0A0K0EV84.1
#=GS A0A673A555_9TELE/135-321    AC A0A673A555.1
#=GS H7BZ94_HUMAN/117-301        AC H7BZ94.2
#=GS A0A2I0MNG1_COLLI/545-734    AC A0A2I0MNG1.1
#=GS A0A671P267_9TELE/150-345    AC A0A671P267.1
#=GS A0A3M6VAH0_9STRA/169-345    AC A0A3M6VAH0.1
#=GS A0A287NWJ5_HORVV/222-407    AC A0A287NWJ5.1
#=GS A0A5C7IIE7_9ROSI/213-398    AC A0A5C7IIE7.1
#=GS A0A6P4ES16_DRORH/161-345    AC A0A6P4ES16.1
#=GS A0A6G0IGM1_LARCR/157-337    AC A0A6G0IGM1.1
#=GS A0A7N6A3S5_ANATE/126-224    AC A0A7N6A3S5.1
#=GS A0A061GWX0_THECC/234-411    AC A0A061GWX0.1
#=GS A0A507BYP2_9FUNG/150-324    AC A0A507BYP2.1
#=GS A0A455C6W6_PHYMC/563-752    AC A0A455C6W6.1
#=GS A0A2G2ZB95_CAPAN/56-240     AC A0A2G2ZB95.1
#=GS B4HQB3_DROSE/533-689        AC B4HQB3.1
#=GS B6ACB1_CRYMR/169-371        AC B6ACB1.1
#=GS H3DYK5_PRIPA/276-473        AC H3DYK5.1
#=GS A0A665UYE9_ECHNA/159-343    AC A0A665UYE9.1
#=GS A0A401PGJ3_SCYTO/159-343    AC A0A401PGJ3.1
#=GS A0A671XWU6_SPAAU/152-317    AC A0A671XWU6.1
#=GS A0A6P3H5Q3_BISBI/160-355    AC A0A6P3H5Q3.1
#=GS E3QC42_COLGM/146-318        AC E3QC42.1
#=GS A0A2Z7CDA5_9LAMI/171-354    AC A0A2Z7CDA5.1
#=GS I3K1Q6_ORENI/557-754        AC I3K1Q6.2
#=GS A0A5B6UIH6_9ROSI/238-418    AC A0A5B6UIH6.1
#=GS A0A091S8V6_NESNO/1-139      AC A0A091S8V6.1
#=GS A0A372RIZ7_9GLOM/304-485    AC A0A372RIZ7.1
#=GS A0A2R9B5A5_PANPA/161-345    AC A0A2R9B5A5.1
#=GS A0A437ABS4_9PEZI/153-333    AC A0A437ABS4.1
#=GS A0A2R9AGP1_PANPA/299-491    AC A0A2R9AGP1.1
#=GS A0A7M7SQK5_APIME/152-346    AC A0A7M7SQK5.1
#=GS A0A3Q0E4P9_CARSF/113-290    AC A0A3Q0E4P9.1
#=GS A0A2K6W3P1_ONCVO/158-338    AC A0A2K6W3P1.1
#=GS U3IRY5_ANAPP/185-365        AC U3IRY5.2
#=GS A0A091EJE1_CORBR/193-308    AC A0A091EJE1.1
#=GS A0A673N4J5_9TELE/157-351    AC A0A673N4J5.1
#=GS A0A6J0BVV0_NEOLC/547-703    AC A0A6J0BVV0.1
#=GS M0WGB3_HORVV/178-354        AC M0WGB3.1
#=GS G5BV46_HETGA/66-253         AC G5BV46.1
#=GS A0A5N5L1T8_9PEZI/153-334    AC A0A5N5L1T8.1
#=GS A0A0P7VKF1_SCLFO/167-350    AC A0A0P7VKF1.1
#=GS A0A2R6XKJ2_MARPO/199-382    AC A0A2R6XKJ2.1
#=GS A0A2T3A3P9_9PEZI/154-342    AC A0A2T3A3P9.1
#=GS A0A671N347_9TELE/128-307    AC A0A671N347.1
#=GS H0X2W5_OTOGA/64-251         AC H0X2W5.1
#=GS A0A670IA30_PODMU/168-352    AC A0A670IA30.1
#=GS A0A671NY09_9TELE/158-352    AC A0A671NY09.1
#=GS A0A199VJ37_ANACO/233-413    AC A0A199VJ37.1
#=GS G3S5E0_GORGO/303-495        AC G3S5E0.2
#=GS A0A087QLG5_APTFO/513-702    AC A0A087QLG5.1
#=GS A0A0N4YMF8_NIPBR/81-263     AC A0A0N4YMF8.1
#=GS A0A2P5DU41_PARAD/216-394    AC A0A2P5DU41.1
#=GS A0A4U5U504_COLLU/159-342    AC A0A4U5U504.1
#=GS A0A0D2TJ66_GOSRA/213-397    AC A0A0D2TJ66.1
#=GS A0A2G2WY33_CAPBA/175-352    AC A0A2G2WY33.1
#=GS A0A444GBL5_ENSVE/67-233     AC A0A444GBL5.1
#=GS A0A091VNR6_NIPNI/124-304    AC A0A091VNR6.1
#=GS A0A3Q3W0E7_MOLML/198-384    AC A0A3Q3W0E7.1
#=GS A0A151P337_ALLMI/336-528    AC A0A151P337.1
#=GS A0A1Y1UWN5_9FUNG/168-341    AC A0A1Y1UWN5.1
#=GS L5K0I9_PTEAL/306-498        AC L5K0I9.1
#=GS A0A2G5DVC5_AQUCA/171-355    AC A0A2G5DVC5.1
#=GS A2EMN7_TRIVA/137-324        AC A2EMN7.1
#=GS A0A2K5D5F9_AOTNA/145-336    AC A0A2K5D5F9.1
#=GS A0A2R5GZE2_9STRA/225-384    AC A0A2R5GZE2.1
#=GS A0A1S3QQT5_SALSA/1-50       AC A0A1S3QQT5.1
#=GS A0A1R3H8W9_9ROSI/214-399    AC A0A1R3H8W9.1
#=GS A0A6J1ADF9_9ROSI/168-353    AC A0A6J1ADF9.1
#=GS F6SUD7_ORNAN/159-354        AC F6SUD7.3
#=GS A0A498HHX4_MALDO/214-399    AC A0A498HHX4.1
#=GS A0A0E0HLJ8_ORYNI/202-386    AC A0A0E0HLJ8.1
#=GS F8PP41_SERL3/157-341        AC F8PP41.1
#=GS A0A0V1DHX3_TRIBR/389-573    AC A0A0V1DHX3.1
#=GS A0A1Y1JU28_PHOPY/156-340    AC A0A1Y1JU28.1
#=GS I1KKH5_SOYBN/175-285        AC I1KKH5.1
#=GS A0A4Z2IRN5_9TELE/151-345    AC A0A4Z2IRN5.1
#=GS A0A135UIZ1_9PEZI/162-310    AC A0A135UIZ1.1
#=GS A0A2K5W8F2_MACFA/167-351    AC A0A2K5W8F2.2
#=GS A0A151SQ13_CAJCA/184-369    AC A0A151SQ13.1
#=GS M4CE33_BRARP/240-418        AC M4CE33.1
#=GS A0A0P7V9E7_SCLFO/149-344    AC A0A0P7V9E7.1
#=GS A0A6P3I0Y5_BISBI/167-350    AC A0A6P3I0Y5.1
#=GS A0A4D9E4H4_9SAUR/63-250     AC A0A4D9E4H4.1
#=GS A0A0V1MN58_9BILA/199-374    AC A0A0V1MN58.1
#=GS A0A158PSL8_BRUPA/193-375    AC A0A158PSL8.1
#=GS A0A2G2V1G5_CAPBA/212-383    AC A0A2G2V1G5.1
#=GS A0A437BK29_CHISP/158-343    AC A0A437BK29.1
#=GS A0BUK5_PARTE/166-330        AC A0BUK5.1
#=GS A0A455ASK2_PHYMC/60-175     AC A0A455ASK2.1
#=GS A0A663DXY5_AQUCH/152-347    AC A0A663DXY5.1
#=GS A0A6J2PXY1_COTGO/159-342    AC A0A6J2PXY1.1
#=GS A0A4W6DBR0_LATCA/159-342    AC A0A4W6DBR0.1
#=GS A0A2R8Z5M2_PANPA/533-722    AC A0A2R8Z5M2.1
#=GS H3CRT7_TETNG/315-506        AC H3CRT7.1
#=GS A0A1S3PZN5_SALSA/158-352    AC A0A1S3PZN5.1
#=GS A0A5C3EYG9_9BASI/158-340    AC A0A5C3EYG9.1
#=GS A0A545A4Q9_9PEZI/200-381    AC A0A545A4Q9.1
#=GS A0A2K6JYD1_RHIBE/180-365    AC A0A2K6JYD1.1
#=GS A0A151XCT2_9HYME/160-344    AC A0A151XCT2.1
#=GS A0A0G2GTT3_9PEZI/153-334    AC A0A0G2GTT3.1
#=GS A0A226MPP7_CALSU/151-334    AC A0A226MPP7.1
#=GS A0A3L6PSL6_PANMI/181-358    AC A0A3L6PSL6.1
#=GS A0A0L8GH69_OCTBM/53-186     AC A0A0L8GH69.1
#=GS A0A2H2I0K1_CAEJA/160-340    AC A0A2H2I0K1.1
#=GS A0A5M6BS37_9TREE/276-478    AC A0A5M6BS37.1
#=GS PDI14_ORYSJ/213-393         AC Q67IX6.1
#=GS A0A5F4CQ51_CANLF/309-501    AC A0A5F4CQ51.1
#=GS A0A3Q3L9M9_9LABR/245-309    AC A0A3Q3L9M9.1
#=GS S9WX38_SCHCR/443-567        AC S9WX38.1
#=GS A0A6I9XE35_9HYME/152-346    AC A0A6I9XE35.1
#=GS A0A1S3HPF8_LINUN/133-318    AC A0A1S3HPF8.1
#=GS F1MEN8_BOVIN/311-502        AC F1MEN8.1
#=GS E3NVQ0_CAERE/161-342        AC E3NVQ0.1
#=GS A0A553NIH5_9TELE/512-704    AC A0A553NIH5.1
#=GS A0A445H5S3_GLYSO/106-291    AC A0A445H5S3.1
#=GS A0A267GJK0_9PLAT/295-481    AC A0A267GJK0.1
#=GS A0A4X2L8X1_VOMUR/313-504    AC A0A4X2L8X1.1
#=GS A2X5Y0_ORYSI/192-367        AC A2X5Y0.1
#=GS M7BBE1_CHEMY/186-372        AC M7BBE1.1
#=GS F7D8T1_HORSE/180-365        AC F7D8T1.2
#=GS D1MGT5_COCPS/159-340        AC D1MGT5.1
#=GS A0A6P3X4M7_DINQU/160-344    AC A0A6P3X4M7.1
#=GS V6LFY9_9EUKA/116-292        AC V6LFY9.1
#=GS A0A671XUZ1_SPAAU/152-347    AC A0A671XUZ1.1
#=GS D3BHC0_POLPP/538-732        AC D3BHC0.1
#=GS A0A3D8RLB2_9EURO/161-342    AC A0A3D8RLB2.1
#=GS A0A178DTL8_9PLEO/226-370    AC A0A178DTL8.1
#=GS A0A3Q0GX82_ALLSI/133-318    AC A0A3Q0GX82.1
#=GS A0A3P4NII5_GULGU/2-136      AC A0A3P4NII5.1
#=GS A0A0V1LRX5_9BILA/172-356    AC A0A0V1LRX5.1
#=GS B9SWB5_RICCO/231-409        AC B9SWB5.1
#=GS V6LE32_9EUKA/129-281        AC V6LE32.1
#=GS R0KKP2_SETT2/150-331        AC R0KKP2.1
#=GS A0A6J3D7K1_AYTFU/545-734    AC A0A6J3D7K1.1
#=GS A0A1Q3EDT5_LENED/156-340    AC A0A1Q3EDT5.1
#=GS A0A026X3Q6_OOCBI/568-727    AC A0A026X3Q6.1
#=GS A0A2I4AXY4_9TELE/46-234     AC A0A2I4AXY4.1
#=GS A0A367YIG0_9ASCO/175-369    AC A0A367YIG0.1
#=GS I2FMA7_USTH4/160-342        AC I2FMA7.1
#=GS A0A673L0K1_9TELE/149-329    AC A0A673L0K1.1
#=GS A0A672MW12_SINGR/149-336    AC A0A672MW12.1
#=GS A0A2K5M2K4_CERAT/105-288    AC A0A2K5M2K4.1
#=GS A0A0N1PHN3_PAPMA/157-343    AC A0A0N1PHN3.1
#=GS A0A3B6PFF3_WHEAT/225-412    AC A0A3B6PFF3.1
#=GS A0A6P5K8J2_PHACI/148-329    AC A0A6P5K8J2.1
#=GS A0A5N3XYR5_MUNRE/160-341    AC A0A5N3XYR5.1
#=GS A0A091T3H9_PELCR/124-304    AC A0A091T3H9.1
#=GS A0A556TUT9_BAGYA/58-173     AC A0A556TUT9.1
#=GS A0A6G0Y6W9_APHCR/171-358    AC A0A6G0Y6W9.1
#=GS A0A2H3EGM8_ARMGA/158-343    AC A0A2H3EGM8.1
#=GS G5BM53_HETGA/160-355        AC G5BM53.1
#=GS N6U4S7_DENPD/162-346        AC N6U4S7.1
#=GS A0A0P0VKF5_ORYSJ/192-380    AC A0A0P0VKF5.1
#=GS H9GMA6_ANOCA/196-392        AC H9GMA6.2
#=GS A0A2G5B9K3_COERN/289-460    AC A0A2G5B9K3.1
#=GS D8PQ43_SCHCM/154-339        AC D8PQ43.1
#=GS A0A0D9RP05_CHLSB/129-315    AC A0A0D9RP05.1
#=GS A0A5N5ST34_9CRUS/159-343    AC A0A5N5ST34.1
#=GS A0A1R2AS48_9CILI/157-334    AC A0A1R2AS48.1
#=GS A0A2K5RG92_CEBIM/266-426    AC A0A2K5RG92.1
#=GS A0A2R6Q1Z3_ACTCC/170-354    AC A0A2R6Q1Z3.1
#=GS A0A4W4FK58_ELEEL/190-375    AC A0A4W4FK58.1
#=GS A0A4W4F2M1_ELEEL/149-343    AC A0A4W4F2M1.1
#=GS A0A6P4BYM2_ARADU/217-402    AC A0A6P4BYM2.1
#=GS A0A498SE31_ACAVI/158-338    AC A0A498SE31.1
#=GS A0A3Q1BEE4_AMPOC/149-344    AC A0A3Q1BEE4.1
#=GS A0A6P7TM05_OCTVU/165-350    AC A0A6P7TM05.1
#=GS A0A4W2CB64_BOBOX/218-402    AC A0A4W2CB64.1
#=GS A0A183P0Y3_9TREM/4-138      AC A0A183P0Y3.1
#=GS A0A6P8Z5J4_THRPL/747-925    AC A0A6P8Z5J4.1
#=GS A0A067MEB7_9AGAM/354-477    AC A0A067MEB7.1
#=GS A0A7D8Z419_9TREE/150-332    AC A0A7D8Z419.1
#=GS A0A6J3LA51_9HYME/1617-1780  AC A0A6J3LA51.1
#=GS A0A1S3F655_DIPOR/170-358    AC A0A1S3F655.1
#=GS A0A673A462_9TELE/168-351    AC A0A673A462.1
#=GS A0A452ETB7_CAPHI/531-720    AC A0A452ETB7.1
#=GS A0A395T6T2_9HYPO/444-555    AC A0A395T6T2.1
#=GS F1QTX8_DANRE/158-352        AC F1QTX8.1
#=GS C5K529_PERM5/156-329        AC C5K529.1
#=GS B3M1X8_DROAN/73-230         AC B3M1X8.1
#=GS A0A0C2NCS4_THEKT/64-249     AC A0A0C2NCS4.1
#=GS A0A1Q5Q717_9EURO/157-338    AC A0A1Q5Q717.1
#=GS A0A6I8VSG6_DROPS/531-688    AC A0A6I8VSG6.1
#=GS A0A0D3D7M0_BRAOL/172-356    AC A0A0D3D7M0.1
#=GS A0A099ZWA4_TINGU/80-275     AC A0A099ZWA4.1
#=GS A0A2Y9GEW9_NEOSC/163-347    AC A0A2Y9GEW9.1
#=GS A0A7M7H488_NASVI/1524-1686  AC A0A7M7H488.1
#=GS A0A2H3J0E6_9EURO/157-338    AC A0A2H3J0E6.1
#=GS A0A669BXF7_ORENI/197-385    AC A0A669BXF7.1
#=GS A0A6P7MWB3_BETSP/149-344    AC A0A6P7MWB3.1
#=GS A0A0L0FT82_9EUKA/170-344    AC A0A0L0FT82.1
#=GS A0A6J1MIP2_BICAN/150-345    AC A0A6J1MIP2.1
#=GS A0A2R8Z9F7_PANPA/518-707    AC A0A2R8Z9F7.1
#=GS A0A219ARX5_METCM/175-351    AC A0A219ARX5.1
#=GS A0A182Y1G6_ANOST/161-345    AC A0A182Y1G6.1
#=GS A0A0D9RKH9_CHLSB/178-365    AC A0A0D9RKH9.1
#=GS A0A4C1U0L8_EUMVA/29-225     AC A0A4C1U0L8.1
#=GS T1JFV2_STRMM/115-303        AC T1JFV2.1
#=GS A0A367JIV6_RHIST/150-328    AC A0A367JIV6.1
#=GS A0A670JH87_PODMU/138-326    AC A0A670JH87.1
#=GS A0A2J6QGN9_9HELO/149-329    AC A0A2J6QGN9.1
#=GS A0A1D6PSC2_MAIZE/172-357    AC A0A1D6PSC2.1
#=GS W9X1T4_9EURO/154-333        AC W9X1T4.1
#=GS A0A2K1ZBF6_POPTR/212-421    AC A0A2K1ZBF6.1
#=GS A0A2C6L6L1_9APIC/160-329    AC A0A2C6L6L1.1
#=GS A0A2A2KAN0_9BILA/165-350    AC A0A2A2KAN0.1
#=GS G3JLF8_CORMM/156-338        AC G3JLF8.1
#=GS A0A653BV28_CALMS/168-364    AC A0A653BV28.1
#=GS A0A672R6H1_SINGR/135-318    AC A0A672R6H1.1
#=GS A0A0L0TC80_ALLM3/362-555    AC A0A0L0TC80.1
#=GS A0A2G5U832_9PELO/128-308    AC A0A2G5U832.1
#=GS A0A4Y7J1T1_PAPSO/178-362    AC A0A4Y7J1T1.1
#=GS E1F395_GIAIA/149-330        AC E1F395.1
#=GS A0A452SIG1_URSAM/137-314    AC A0A452SIG1.1
#=GS A0A392PIA3_9FABA/1-123      AC A0A392PIA3.1
#=GS A0A1I8FUH2_9PLAT/163-351    AC A0A1I8FUH2.1
#=GS A0A4U0VMH1_9PEZI/94-275     AC A0A4U0VMH1.1
#=GS A0A3Q3W8M9_MOLML/33-220     AC A0A3Q3W8M9.1
#=GS A0A2T7NK08_POMCA/26-208     AC A0A2T7NK08.1
#=GS A0A5J9VE88_9POAL/216-412    AC A0A5J9VE88.1
#=GS A0A5J5BVK2_9ASTE/169-365    AC A0A5J5BVK2.1
#=GS A0A674M9S8_TAKRU/185-371    AC A0A674M9S8.1
#=GS A0A2R6QFN7_ACTCC/209-392    AC A0A2R6QFN7.1
#=GS A0A6I9SKC2_SESIN/168-354    AC A0A6I9SKC2.1
#=GS A0A0D2B336_9EURO/160-341    AC A0A0D2B336.1
#=GS A0A095CE85_CRYGR/304-486    AC A0A095CE85.1
#=GS A0A2P6VMF2_9CHLO/163-348    AC A0A2P6VMF2.1
#=GS A0A4U5UX05_COLLU/55-235     AC A0A4U5UX05.1
#=GS Q5TWW9_ANOGA/157-342        AC Q5TWW9.2
#=GS G1L7R2_AILME/673-865        AC G1L7R2.2
#=GS A0A196SDH8_BLAHN/158-338    AC A0A196SDH8.1
#=GS A0A2U3WQJ4_ODORO/135-330    AC A0A2U3WQJ4.1
#=GS H0X3S6_OTOGA/149-305        AC H0X3S6.1
#=GS B4JFA1_DROGR/162-340        AC B4JFA1.1
#=GS G3NM64_GASAC/151-334        AC G3NM64.1
#=GS N4UBQ1_FUSC1/145-319        AC N4UBQ1.1
#=GS A0A060XMR8_ONCMY/47-207     AC A0A060XMR8.1
#=GS A0A317XNI9_9BASI/118-302    AC A0A317XNI9.1
#=GS A0A6J2VUM9_CHACN/174-358    AC A0A6J2VUM9.1
#=GS A0A210QUZ2_MIZYE/156-346    AC A0A210QUZ2.1
#=GS A0A183NF07_9TREM/152-337    AC A0A183NF07.1
#=GS A0A6A5FS17_PERFL/396-582    AC A0A6A5FS17.1
#=GS A0A3Q3EE91_9LABR/133-328    AC A0A3Q3EE91.1
#=GS A0A200QBX5_9MAGN/176-360    AC A0A200QBX5.1
#=GS A0A1U8J992_GOSHI/187-368    AC A0A1U8J992.1
#=GS A0A672L1C0_SINGR/150-330    AC A0A672L1C0.1
#=GS A0A6P6ATL6_DURZI/175-360    AC A0A6P6ATL6.1
#=GS B7P4U1_IXOSC/153-339        AC B7P4U1.1
#=GS A0A452RDX8_URSAM/105-288    AC A0A452RDX8.1
#=GS A0A091R5I2_9GRUI/107-292    AC A0A091R5I2.1
#=GS A0A6J0DE46_PERMB/182-369    AC A0A6J0DE46.1
#=GS A0A6A6N244_HEVBR/279-437    AC A0A6A6N244.1
#=GS G0QRK1_ICHMG/179-362        AC G0QRK1.1
#=GS ERP60_SCHMA/152-337         AC P38658.1
#=GS A0A158PIT0_ANGCS/157-336    AC A0A158PIT0.1
#=GS A0A1S4DND2_TOBAC/165-350    AC A0A1S4DND2.1
#=GS W4H6U6_9STRA/165-331        AC W4H6U6.1
#=GS A0A6P6IFL2_PUMCO/226-406    AC A0A6P6IFL2.1
#=GS A0A663E1F4_AQUCH/547-736    AC A0A663E1F4.1
#=GS A0A3Q3M4S6_9TELE/132-315    AC A0A3Q3M4S6.2
#=GS A0A1V8TX11_9PEZI/150-334    AC A0A1V8TX11.1
#=GS B7XJP0_ENTBH/105-275        AC B7XJP0.1
#=GS A0A0W4ZDV5_PNEJ7/393-567    AC A0A0W4ZDV5.1
#=GS A0A672TT09_STRHB/314-505    AC A0A672TT09.1
#=GS A0A367JFJ2_RHIAZ/152-334    AC A0A367JFJ2.1
#=GS A0A670XYZ9_PSETE/303-495    AC A0A670XYZ9.1
#=GS A0A803J9S6_XENTR/169-352    AC A0A803J9S6.1
#=GS A0A5C5FKU9_9BASI/151-333    AC A0A5C5FKU9.1
#=GS A0A669AX96_ORENI/112-296    AC A0A669AX96.1
#=GS A0A4P1QXC3_LUPAN/169-354    AC A0A4P1QXC3.1
#=GS A0A212CT24_CEREH/145-340    AC A0A212CT24.1
#=GS A0A2I0UDP2_LIMLA/157-338    AC A0A2I0UDP2.1
#=GS A0A7E4RZA9_CIMLE/252-405    AC A0A7E4RZA9.1
#=GS K9GF84_PEND2/162-343        AC K9GF84.1
#=GS A0A1I7VCY6_LOALO/140-307    AC A0A1I7VCY6.1
#=GS A0A072PKP9_9EURO/154-333    AC A0A072PKP9.1
#=GS A0A0C3H0G2_9PEZI/85-267     AC A0A0C3H0G2.1
#=GS A0A6I9TWA3_SESIN/233-412    AC A0A6I9TWA3.1
#=GS A0A3Q7GIG7_SOLLC/159-342    AC A0A3Q7GIG7.1
#=GS A0A2K6U893_SAIBB/180-367    AC A0A2K6U893.1
#=GS M5X5N2_PRUPE/212-397        AC M5X5N2.1
#=GS A8XPB1_CAEBR/279-476        AC A8XPB1.1
#=GS A0A0K0F914_STRVS/153-342    AC A0A0K0F914.1
#=GS A0A093PT73_9PASS/148-303    AC A0A093PT73.1
#=GS A0A5N4D3K2_CAMDR/218-402    AC A0A5N4D3K2.1
#=GS A0A183E911_9BILA/2-115      AC A0A183E911.1
#=GS A0A4U5U625_COLLU/159-342    AC A0A4U5U625.1
#=GS A0A7E6EHQ4_OCTVU/148-295    AC A0A7E6EHQ4.1
#=GS E3M509_CAERE/161-341        AC E3M509.1
#=GS U4TYU6_DENPD/185-384        AC U4TYU6.1
#=GS A0A1W4W2X2_AGRPL/175-344    AC A0A1W4W2X2.1
#=GS A0A0V1N0S3_9BILA/312-509    AC A0A0V1N0S3.1
#=GS A0A261BP67_9PELO/612-795    AC A0A261BP67.1
#=GS A0A0G4PT12_PENCA/162-343    AC A0A0G4PT12.1
#=GS A0A384CME4_URSMA/333-525    AC A0A384CME4.1
#=GS A0A1S4A9X4_TOBAC/1-160      AC A0A1S4A9X4.1
#=GS A0A1D6QVF8_MAIZE/221-407    AC A0A1D6QVF8.1
#=GS A0A0E0K126_ORYPU/154-334    AC A0A0E0K126.1
#=GS A0A669EDL6_ORENI/149-343    AC A0A669EDL6.1
#=GS A0A670Z8V9_PSETE/172-353    AC A0A670Z8V9.1
#=GS A0A1F7ZJV2_9EURO/161-342    AC A0A1F7ZJV2.1
#=GS A0A2K1R1X5_9PEZI/153-334    AC A0A2K1R1X5.1
#=GS A0A3Q0ITA2_DIACI/3-79       AC A0A3Q0ITA2.1
#=GS B4QKK6_DROSI/161-345        AC B4QKK6.1
#=GS A0A093EKM1_TYTAL/277-468    AC A0A093EKM1.1
#=GS A0A2N1JFY4_9BASI/335-507    AC A0A2N1JFY4.1
#=GS A0A0E0DEI4_9ORYZ/170-354    AC A0A0E0DEI4.1
#=GS A0A5B6UJ92_9ROSI/169-354    AC A0A5B6UJ92.1
#=GS A0A1X2GPY2_9FUNG/287-476    AC A0A1X2GPY2.1
#=GS F0UIA6_AJEC8/214-325        AC F0UIA6.1
#=GS A0A061H0K9_9BASI/424-608    AC A0A061H0K9.1
#=GS A0A453C018_AEGTS/92-268     AC A0A453C018.1
#=GS A0A672RRI3_SINGR/152-346    AC A0A672RRI3.1
#=GS A0A162KUP8_CORDF/156-338    AC A0A162KUP8.1
#=GS A0A674CYR4_SALTR/157-353    AC A0A674CYR4.1
#=GS A0A067DHW2_CITSI/187-371    AC A0A067DHW2.1
#=GS A0A2T3B8E5_AMORE/152-333    AC A0A2T3B8E5.1
#=GS A0A4D8YRJ6_SALSN/215-400    AC A0A4D8YRJ6.1
#=GS A0A6J2VGX0_CHACN/152-333    AC A0A6J2VGX0.1
#=GS A0A3P8WQ59_CYNSE/157-342    AC A0A3P8WQ59.1
#=GS A0A1S3ESI5_DIPOR/172-359    AC A0A1S3ESI5.1
#=GS A0A1J6IG19_NICAT/162-348    AC A0A1J6IG19.1
#=GS A0A0B0PA96_GOSAR/228-411    AC A0A0B0PA96.1
#=GS A0A2B4SUK4_STYPI/166-355    AC A0A2B4SUK4.1
#=GS A0A6J3J421_SAPAP/168-348    AC A0A6J3J421.1
#=GS G0P9D4_CAEBE/156-340        AC G0P9D4.1
#=GS A0A340XLR7_LIPVE/163-347    AC A0A340XLR7.1
#=GS A0A316W6H9_9BASI/161-344    AC A0A316W6H9.1
#=GS F6SJ69_CALJA/185-372        AC F6SJ69.3
#=GS A0A0D2WQL7_CAPO3/259-440    AC A0A0D2WQL7.1
#=GS W5N925_LEPOC/170-354        AC W5N925.1
#=GS A0A4W5JTE0_9TELE/279-471    AC A0A4W5JTE0.1
#=GS S4RMF2_PETMA/480-673        AC S4RMF2.1
#=GS H2ZFV1_CIOSA/573-762        AC H2ZFV1.1
#=GS A0A0A2VBY7_BEABA/156-338    AC A0A0A2VBY7.1
#=GS C6HAT9_AJECH/214-325        AC C6HAT9.1
#=GS A0A671XF83_SPAAU/155-339    AC A0A671XF83.1
#=GS A0A6G1QLZ8_9TELE/155-335    AC A0A6G1QLZ8.1
#=GS A0A2S4V4C8_9BASI/206-389    AC A0A2S4V4C8.1
#=GS A0A0L7L181_9NEOP/147-337    AC A0A0L7L181.1
#=GS A0A0B2V6F1_TOXCA/304-501    AC A0A0B2V6F1.1
#=GS A0A2K5DQU1_AOTNA/163-364    AC A0A2K5DQU1.1
#=GS A0A7D8YMV4_9HELO/152-333    AC A0A7D8YMV4.1
#=GS A0A6J1QS26_9HYME/157-343    AC A0A6J1QS26.1
#=GS H0VBS1_CAVPO/160-355        AC H0VBS1.1
#=GS A0A6J0YLV7_ODOVR/163-347    AC A0A6J0YLV7.1
#=GS A0A6P5LDP2_PHACI/163-347    AC A0A6P5LDP2.1
#=GS A0A7E4RZA9_CIMLE/445-576    AC A0A7E4RZA9.1
#=GS A0A5N3X130_MUNRE/163-347    AC A0A5N3X130.1
#=GS A0A1S3Y874_TOBAC/217-394    AC A0A1S3Y874.1
#=GS A0A4W3I1W7_CALMI/190-376    AC A0A4W3I1W7.1
#=GS A0A1Y1K4Q8_PHOPY/157-343    AC A0A1Y1K4Q8.1
#=GS A0A6I9ZJQ5_ACIJB/180-365    AC A0A6I9ZJQ5.1
#=GS W4H8Z0_9STRA/165-348        AC W4H8Z0.1
#=GS A0A091HJH6_CALAN/69-213     AC A0A091HJH6.1
#=GS A0A0V0YIJ2_TRIPS/156-320    AC A0A0V0YIJ2.1
#=GS A0A3S3P9S1_9MAGN/230-410    AC A0A3S3P9S1.1
#=GS A0A0A0LBP8_CUCSA/212-397    AC A0A0A0LBP8.1
#=GS A0A067DI79_CITSI/187-374    AC A0A067DI79.1
#=GS A0A384AZU4_BALAS/539-728    AC A0A384AZU4.2
#=GS A0A0A1T5Y1_9HYPO/157-339    AC A0A0A1T5Y1.1
#=GS H6C3Q5_EXODN/153-333        AC H6C3Q5.1
#=GS A0A654HP73_9CEST/166-342    AC A0A654HP73.1
#=GS A0A093KQ37_FULGA/107-292    AC A0A093KQ37.1
#=GS A0A6I8W856_DROPS/5-151      AC A0A6I8W856.1
#=GS A0A0V0RHN7_9BILA/672-861    AC A0A0V0RHN7.1
#=GS A0A1G4MGX4_LACFM/167-349    AC A0A1G4MGX4.1
#=GS A0A672NVY5_SINGR/307-499    AC A0A672NVY5.1
#=GS A0A0V1NAL7_9BILA/193-377    AC A0A0V1NAL7.1
#=GS G1PX72_MYOLU/181-366        AC G1PX72.1
#=GS A0A091JAC0_CALAN/280-471    AC A0A091JAC0.1
#=GS A0A504Z0Y0_FASGI/161-346    AC A0A504Z0Y0.1
#=GS Q4UC22_THEAN/179-384        AC Q4UC22.1
#=GS A0A6I8NVR0_ORNAN/250-434    AC A0A6I8NVR0.1
#=GS A0A4T0FQF2_9BASI/156-339    AC A0A4T0FQF2.1
#=GS A0A453C0R5_AEGTS/173-357    AC A0A453C0R5.1
#=GS A0A0A0L1V6_CUCSA/169-353    AC A0A0A0L1V6.1
#=GS A0A010R826_9PEZI/126-300    AC A0A010R826.1
#=GS A0A2T3YWV2_9HYPO/154-335    AC A0A2T3YWV2.1
#=GS X6NXX6_RETFI/170-360        AC X6NXX6.1
#=GS A0A3N6Q8R8_BRACR/166-350    AC A0A3N6Q8R8.1
#=GS A0A4W2E5Y3_BOBOX/188-375    AC A0A4W2E5Y3.1
#=GS A0A6F9AJB1_9TELE/151-323    AC A0A6F9AJB1.1
#=GS A0A671S213_9TELE/118-295    AC A0A671S213.1
#=GS A0A2G8L8W4_STIJA/69-248     AC A0A2G8L8W4.1
#=GS A0A2G8K0T8_STIJA/303-406    AC A0A2G8K0T8.1
#=GS A0A4W4F2L6_ELEEL/158-352    AC A0A4W4F2L6.1
#=GS A0A671Q828_9TELE/208-324    AC A0A671Q828.1
#=GS A0A485PFM8_LYNPA/203-388    AC A0A485PFM8.1
#=GS A0A1D5PWP7_CHICK/308-499    AC A0A1D5PWP7.1
#=GS A0A0N4Y8V3_NIPBR/162-341    AC A0A0N4Y8V3.2
#=GS A0A091N2U5_APAVI/513-702    AC A0A091N2U5.1
#=GS A0A6P3VMQ7_CLUHA/167-350    AC A0A6P3VMQ7.1
#=GS A0A3P8WVA1_CYNSE/157-340    AC A0A3P8WVA1.1
#=GS M1VX31_CLAP2/156-337        AC M1VX31.1
#=GS A0A078B8V5_STYLE/279-430    AC A0A078B8V5.1
#=GS A0A6Q2XBG7_ESOLU/118-300    AC A0A6Q2XBG7.1
#=GS A0A093HB22_STRCA/98-293     AC A0A093HB22.1
#=GS A0A034WD85_BACDO/165-361    AC A0A034WD85.1
#=GS A0A4T0SQI0_9BASI/157-340    AC A0A4T0SQI0.1
#=GS A0A091UGT6_PHORB/1-139      AC A0A091UGT6.1
#=GS A0A2U9QXD6_PICKU/171-357    AC A0A2U9QXD6.1
#=GS A0A1U7XQE2_NICSY/183-360    AC A0A1U7XQE2.1
#=GS A0A6P5E1C0_BOSIN/180-365    AC A0A6P5E1C0.1
#=GS A0A4W6DX37_LATCA/159-352    AC A0A4W6DX37.1
#=GS A0A6P6M9T1_CARAU/303-495    AC A0A6P6M9T1.1
#=GS A0A2H5PFP3_CITUN/439-624    AC A0A2H5PFP3.1
#=GS A0A2A4JF99_HELVI/157-343    AC A0A2A4JF99.1
#=GS Q2HFQ2_CHAGB/153-334        AC Q2HFQ2.1
#=GS F1SQW6_PIG/63-250           AC F1SQW6.3
#=GS A0A6A5BJW1_NAEFO/154-337    AC A0A6A5BJW1.1
#=GS A0A6G1F5U0_9ORYZ/185-358    AC A0A6G1F5U0.1
#=GS A0A0E0H137_ORYNI/170-356    AC A0A0E0H137.1
#=GS A0A226ECT4_FOLCA/161-346    AC A0A226ECT4.1
#=GS A7S406_NEMVE/157-267        AC A7S406.1
#=GS A0A1D5QCL1_MACMU/64-251     AC A0A1D5QCL1.2
#=GS A0A0V0W2T1_9BILA/153-341    AC A0A0V0W2T1.1
#=GS A0A067KKM7_JATCU/167-352    AC A0A067KKM7.1
#=GS A0A3L8S5N3_CHLGU/214-329    AC A0A3L8S5N3.1
#=GS A0A6J3CIT8_AYTFU/184-365    AC A0A6J3CIT8.1
#=GS A0A453C0M4_AEGTS/173-336    AC A0A453C0M4.1
#=GS A0A1L9TEJ3_9EURO/161-259    AC A0A1L9TEJ3.1
#=GS W1QAT1_OGAPD/169-353        AC W1QAT1.1
#=GS A0A3Q2DWK6_CYPVA/404-603    AC A0A3Q2DWK6.1
#=GS A0A1S3UY18_VIGRR/165-348    AC A0A1S3UY18.1
#=GS H3CIR0_TETNG/162-347        AC H3CIR0.1
#=GS A0A668SU53_OREAU/160-354    AC A0A668SU53.1
#=GS A0A6P8WI58_DROAB/536-692    AC A0A6P8WI58.1
#=GS H0UTL5_CAVPO/64-251         AC H0UTL5.2
#=GS A0A2H5NQ44_CITUN/169-354    AC A0A2H5NQ44.1
#=GS A0A6J1CBY5_MOMCH/173-357    AC A0A6J1CBY5.1
#=GS A0A673FWU5_9TELE/420-543    AC A0A673FWU5.1
#=GS A0A261C853_9PELO/104-293    AC A0A261C853.1
#=GS A0A6J2XNL6_SITOR/503-656    AC A0A6J2XNL6.1
#=GS A0A183AKP9_9TREM/165-340    AC A0A183AKP9.1
#=GS C6KXH6_SOYBN/199-384        AC C6KXH6.1
#=GS A0A0D2NRI0_GOSRA/169-354    AC A0A0D2NRI0.1
#=GS A0A0S6XBH1_9FUNG/151-332    AC A0A0S6XBH1.1
#=GS J3LY01_ORYBR/183-355        AC J3LY01.1
#=GS H2QVK7_PANTR/312-504        AC H2QVK7.1
#=GS A0A553NP73_TIGCA/156-339    AC A0A553NP73.1
#=GS A0A200RCA9_9MAGN/211-396    AC A0A200RCA9.1
#=GS A0A1U7UU54_CARSF/64-251     AC A0A1U7UU54.1
#=GS A0A0V0UDP0_9BILA/172-255    AC A0A0V0UDP0.1
#=GS W7T688_9STRA/171-346        AC W7T688.1
#=GS PDI16_ARATH/209-395         AC Q66GQ3.1
#=GS A0A087YHU0_POEFO/168-351    AC A0A087YHU0.1
#=GS A0A4Q4WIT5_9PEZI/157-338    AC A0A4Q4WIT5.1
#=GS A0A1U8GX36_CAPAN/165-348    AC A0A1U8GX36.1
#=GS A0A099Z5I2_TINGU/276-467    AC A0A099Z5I2.1
#=GS G3Q2E0_GASAC/172-356        AC G3Q2E0.1
#=GS A0A6I8U2R6_AEDAE/517-675    AC A0A6I8U2R6.1
#=GS C7TY45_SCHJA/169-349        AC C7TY45.1
#=GS A0A674CQM2_SALTR/165-359    AC A0A674CQM2.1
#=GS A0A3Q4GA18_NEOBR/306-497    AC A0A3Q4GA18.1
#=GS A0A251S684_HELAN/170-355    AC A0A251S684.1
#=GS A0A673ABC0_9TELE/152-347    AC A0A673ABC0.1
#=GS A0A315VD40_GAMAF/169-295    AC A0A315VD40.1
#=GS A0A183TH91_SCHSO/367-495    AC A0A183TH91.1
#=GS A0A7N6ARE2_ANATE/159-343    AC A0A7N6ARE2.1
#=GS A0A4W6DZL2_LATCA/534-733    AC A0A4W6DZL2.1
#=GS A0A238BJW7_9BILA/168-350    AC A0A238BJW7.1
#=GS A0A1J1HX49_9DIPT/161-347    AC A0A1J1HX49.1
#=GS A0A091IMM3_EGRGA/282-473    AC A0A091IMM3.1
#=GS E2RTZ3_GIAIC/149-330        AC E2RTZ3.1
#=GS A0A1V9XNQ5_9ACAR/158-342    AC A0A1V9XNQ5.1
#=GS A0A5N5LD83_9ROSI/268-447    AC A0A5N5LD83.1
#=GS A0A2K5WKB0_MACFA/311-503    AC A0A2K5WKB0.1
#=GS A0A1S3U7F4_VIGRR/204-389    AC A0A1S3U7F4.1
#=GS A0A2H3HSJ5_FUSOX/155-336    AC A0A2H3HSJ5.1
#=GS A0A178ZLP2_9EURO/2-143      AC A0A178ZLP2.1
#=GS L8GH71_ACACA/154-336        AC L8GH71.1
#=GS A0A3N4JQL4_9PEZI/163-343    AC A0A3N4JQL4.1
#=GS A0A1R2CAB2_9CILI/165-351    AC A0A1R2CAB2.1
#=GS A0A195BRK6_9HYME/215-401    AC A0A195BRK6.1
#=GS A0A091PUW3_HALAL/506-695    AC A0A091PUW3.1
#=GS M3ZHR1_XIPMA/128-299        AC M3ZHR1.2
#=GS R0G4B9_9BRAS/246-432        AC R0G4B9.1
#=GS A0A3Q3GKB0_9LABR/149-343    AC A0A3Q3GKB0.1
#=GS A0A7M7H2L4_NASVI/561-719    AC A0A7M7H2L4.1
#=GS A0A5F4C5S4_CANLF/135-319    AC A0A5F4C5S4.1
#=GS A0A0D8XXQ1_DICVI/154-348    AC A0A0D8XXQ1.1
#=GS A0A218VAA4_9PASE/167-350    AC A0A218VAA4.1
#=GS S2K910_MUCC1/158-336        AC S2K910.1
#=GS F7HLC3_CALJA/180-365        AC F7HLC3.2
#=GS H2MB11_ORYLA/173-354        AC H2MB11.2
#=GS D3BPL3_POLPP/174-358        AC D3BPL3.1
#=GS A0A2Y9T3H7_PHYMC/55-242     AC A0A2Y9T3H7.1
#=GS A0A4W3KA24_CALMI/191-375    AC A0A4W3KA24.1
#=GS A0A3Q1LPQ0_BOVIN/222-325    AC A0A3Q1LPQ0.1
#=GS A0A1S3I088_LINUN/294-487    AC A0A1S3I088.1
#=GS A0A1X7VQL2_AMPQE/283-477    AC A0A1X7VQL2.1
#=GS A0A4Q1BM65_TREME/140-326    AC A0A4Q1BM65.1
#=GS A0A4T0ISZ2_WALIC/452-635    AC A0A4T0ISZ2.1
#=GS A0A137QQW6_9AGAR/156-341    AC A0A137QQW6.1
#=GS A0A139WMR8_TRICA/280-456    AC A0A139WMR8.1
#=GS A0A287II27_HORVV/173-336    AC A0A287II27.1
#=GS A0A6P3S1T5_PTEVA/611-800    AC A0A6P3S1T5.1
#=GS H9EUJ3_MACMU/167-350        AC H9EUJ3.1
#=GS A0A507E7M3_9FUNG/158-338    AC A0A507E7M3.1
#=GS A0A384CL99_URSMA/179-366    AC A0A384CL99.1
#=GS A0A2K5LYM5_CERAT/180-365    AC A0A2K5LYM5.1
#=GS A0A226NZ65_COLVI/134-243    AC A0A226NZ65.1
#=GS A0A6I9VHN2_BACDO/205-360    AC A0A6I9VHN2.1
#=GS A0A384A9G7_BALAS/192-307    AC A0A384A9G7.1
#=GS A0A3B3HZK8_ORYLA/93-278     AC A0A3B3HZK8.1
#=GS A0A368GJP8_ANCCA/154-341    AC A0A368GJP8.1
#=GS H0ECW9_GLAL7/152-333        AC H0ECW9.1
#=GS A0A1S4A5Y6_TOBAC/128-305    AC A0A1S4A5Y6.1
#=GS A0A2I3RI73_PANTR/167-256    AC A0A2I3RI73.1
#=GS A0A446VWY5_TRITD/238-424    AC A0A446VWY5.1
#=GS T0M7L9_CAMFR/326-517        AC T0M7L9.1
#=GS A0A0E0DEI3_9ORYZ/206-390    AC A0A0E0DEI3.1
#=GS M4DIS8_BRARP/169-353        AC M4DIS8.1
#=GS A0A553Q4R0_9TELE/193-380    AC A0A553Q4R0.1
#=GS A0A6J2W2I7_CHACN/47-234     AC A0A6J2W2I7.1
#=GS A0A6I8P6F6_ORNAN/336-528    AC A0A6I8P6F6.1
#=GS A0A1R2D1P2_9CILI/159-346    AC A0A1R2D1P2.1
#=GS A0A7P0T8J3_HUMAN/161-255    AC A0A7P0T8J3.1
#=GS S3E9Q9_GLAL2/110-277        AC S3E9Q9.1
#=GS A0A078FBD8_BRANA/228-407    AC A0A078FBD8.1
#=GS A0A6P6JM19_CARAU/193-380    AC A0A6P6JM19.1
#=GS A0A2R9ALF2_PANPA/312-504    AC A0A2R9ALF2.1
#=GS A0A3Q7MJX0_CALUR/311-428    AC A0A3Q7MJX0.1
#=GS A0A3B6C7K9_WHEAT/174-364    AC A0A3B6C7K9.1
#=GS A0A3Q7UZS1_URSAR/562-751    AC A0A3Q7UZS1.1
#=GS A0A6Q2XTZ7_ESOLU/144-338    AC A0A6Q2XTZ7.1
#=GS A0A091F3W7_CORBR/141-327    AC A0A091F3W7.1
#=GS A0A674CZ79_SALTR/149-343    AC A0A674CZ79.1
#=GS A0A329SAZ2_9STRA/173-343    AC A0A329SAZ2.1
#=GS A0A1S3ESV4_DIPOR/157-342    AC A0A1S3ESV4.1
#=GS A0A068XW94_ECHMU/159-350    AC A0A068XW94.1
#=GS A0D787_PARTE/175-349        AC A0D787.1
#=GS A0A6I8U7J8_AEDAE/530-687    AC A0A6I8U7J8.1
#=GS A0A2G9GY71_9LAMI/176-361    AC A0A2G9GY71.1
#=GS A0A6P8XNL7_DROAB/167-353    AC A0A6P8XNL7.1
#=GS A0A0L0CE53_LUCCU/534-691    AC A0A0L0CE53.1
#=GS L7JWD0_TRAHO/123-275        AC L7JWD0.1
#=GS A0A2G2VD07_CAPBA/192-374    AC A0A2G2VD07.1
#=GS A0A6G0J9C9_LARCR/46-234     AC A0A6G0J9C9.1
#=GS B6CVD6_PIG/167-350          AC B6CVD6.1
#=GS A0A0P5D948_9CRUS/296-489    AC A0A0P5D948.1
#=GS J9JYS8_ACYPI/156-342        AC J9JYS8.1
#=GS Q9FE55_TRITD/176-361        AC Q9FE55.1
#=GS A0A2Y9N4E0_DELLE/539-728    AC A0A2Y9N4E0.1
#=GS A0A5N4E0B5_CAMDR/312-503    AC A0A5N4E0B5.1
#=GS A0A674H0E8_TAEGU/73-259     AC A0A674H0E8.1
#=GS A0A6J3FMG6_SAPAP/434-623    AC A0A6J3FMG6.1
#=GS A0A1Y2A098_9FUNG/166-339    AC A0A1Y2A098.1
#=GS A0A3B0JPH0_DROGU/164-351    AC A0A3B0JPH0.1
#=GS A0A5N5NVJ4_PANHP/149-344    AC A0A5N5NVJ4.1
#=GS A0A3M7RVB6_BRAPC/160-343    AC A0A3M7RVB6.1
#=GS A0A6I9NNH4_9TELE/208-394    AC A0A6I9NNH4.1
#=GS B4LHJ4_DROVI/156-351        AC B4LHJ4.1
#=GS W5Q8A1_SHEEP/533-722        AC W5Q8A1.1
#=GS A0A2K6N957_RHIRO/178-365    AC A0A2K6N957.1
#=GS A0A673L5Z3_9TELE/154-331    AC A0A673L5Z3.1
#=GS A0A4X2LPY7_VOMUR/543-732    AC A0A4X2LPY7.1
#=GS A0A1L8GHH7_XENLA/64-251     AC A0A1L8GHH7.1
#=GS E1JGY5_DROME/202-359        AC E1JGY5.1
#=GS V4LEX3_EUTSA/237-417        AC V4LEX3.1
#=GS A0A022Q0D4_ERYGU/167-350    AC A0A022Q0D4.1
#=GS M4CVR4_BRARP/167-352        AC M4CVR4.1
#=GS A0A6P4FMC1_DRORH/6-187      AC A0A6P4FMC1.1
#=GS A0A3Q2VBG3_HAPBU/558-755    AC A0A3Q2VBG3.1
#=GS A0A3Q7VS97_URSAR/179-366    AC A0A3Q7VS97.1
#=GS A0A388LJ75_CHABU/242-424    AC A0A388LJ75.1
#=GS A0A6I9MF18_PERMB/533-722    AC A0A6I9MF18.1
#=GS A0A2Y9R051_TRIMA/1-140      AC A0A2Y9R051.1
#=GS H3AZR2_LATCH/151-346        AC H3AZR2.1
#=GS A0A667XR32_9TELE/161-344    AC A0A667XR32.1
#=GS A0A437BPH8_CHISP/239-386    AC A0A437BPH8.1
#=GS A0A0D8Y910_DICVI/366-541    AC A0A0D8Y910.1
#=GS I3L0S0_HUMAN/240-303        AC I3L0S0.2
#=GS A0A261C624_9PELO/154-342    AC A0A261C624.1
#=GS A0A673ZEI9_SALTR/161-356    AC A0A673ZEI9.1
#=GS A0A1Y1XGT8_9FUNG/314-468    AC A0A1Y1XGT8.1
#=GS A0A4U6XG57_9PEZI/466-639    AC A0A4U6XG57.1
#=GS A0A7M7N5B1_STRPU/166-356    AC A0A7M7N5B1.1
#=GS A0A1S4EYS5_AEDAE/162-347    AC A0A1S4EYS5.1
#=GS A0A200R5W4_9MAGN/246-426    AC A0A200R5W4.1
#=GS A0A1R1XCM2_9FUNG/459-619    AC A0A1R1XCM2.1
#=GS H9G539_ANOCA/176-361        AC H9G539.2
#=GS A0A1Q3E4L7_LENED/330-476    AC A0A1Q3E4L7.1
#=GS A0A091KJ97_9GRUI/107-234    AC A0A091KJ97.1
#=GS A0A4W4EKR2_ELEEL/112-297    AC A0A4W4EKR2.1
#=GS F2Z6F2_KLULA/167-347        AC F2Z6F2.1
#=GS A0A673B9K8_9TELE/223-414    AC A0A673B9K8.1
#=GS W3WJ98_PESFW/117-285        AC W3WJ98.1
#=GS L1JIK8_GUITC/164-351        AC L1JIK8.1
#=GS A0A673Y7Z6_SALTR/163-351    AC A0A673Y7Z6.1
#=GS A0A671PZ89_9TELE/159-343    AC A0A671PZ89.1
#=GS H2USA9_TAKRU/154-349        AC H2USA9.3
#=GS A0A2H5QST6_CITUN/84-229     AC A0A2H5QST6.1
#=GS A0A669DED6_ORENI/164-347    AC A0A669DED6.1
#=GS A0A2Y9SPF4_PHYMC/224-414    AC A0A2Y9SPF4.1
#=GS A0A2K6LJV9_RHIBE/64-251     AC A0A2K6LJV9.1
#=GS A0A0L7RGJ2_9HYME/629-788    AC A0A0L7RGJ2.1
#=GS A0A674AEA3_SALTR/141-322    AC A0A674AEA3.1
#=GS I3KNI1_ORENI/32-219         AC I3KNI1.2
#=GS A0A0D3F688_9ORYZ/68-243     AC A0A0D3F688.1
#=GS A0A671UEJ4_SPAAU/158-341    AC A0A671UEJ4.1
#=GS F6WEB0_MONDO/167-350        AC F6WEB0.1
#=GS B7NZF1_RABIT/157-352        AC B7NZF1.1
#=GS A0A671Q4B5_9TELE/161-277    AC A0A671Q4B5.1
#=GS A0A446RWK3_TRITD/176-268    AC A0A446RWK3.1
#=GS A0A3M6TV91_POCDA/154-341    AC A0A3M6TV91.1
#=GS A0A093J5R6_FULGA/1-138      AC A0A093J5R6.1
#=GS A0A443SCB2_9ACAR/129-316    AC A0A443SCB2.1
#=GS A0A420YE49_9PEZI/152-333    AC A0A420YE49.1
#=GS A0A439CLS8_9PEZI/106-252    AC A0A439CLS8.1
#=GS A0A7M7Q8W8_NASVI/170-356    AC A0A7M7Q8W8.1
#=GS A0A3Q1LPL8_BOVIN/120-300    AC A0A3Q1LPL8.1
#=GS A0A4P1R7H0_LUPAN/220-400    AC A0A4P1R7H0.1
#=GS A0A1J1HEA5_PLARL/165-331    AC A0A1J1HEA5.1
#=GS A0A6G1QUQ1_9TELE/149-344    AC A0A6G1QUQ1.1
#=GS A0A2K6F415_PROCO/180-363    AC A0A2K6F415.1
#=GS H0X1X7_OTOGA/178-361        AC H0X1X7.1
#=GS A0A445K844_GLYSO/170-356    AC A0A445K844.1
#=GS A0A437DM15_ORYJA/209-394    AC A0A437DM15.1
#=GS A0A016SKK1_9BILA/384-560    AC A0A016SKK1.1
#=GS A0A6G0UIH5_9BILA/382-554    AC A0A6G0UIH5.1
#=GS A0A409XD47_9AGAR/36-210     AC A0A409XD47.1
#=GS A0A3P8RSH8_AMPPE/145-297    AC A0A3P8RSH8.1
#=GS A0A0M3QX62_DROBS/105-292    AC A0A0M3QX62.1
#=GS A0A643C7X5_BALPH/96-280     AC A0A643C7X5.1
#=GS A0A1W4WNI4_AGRPL/161-345    AC A0A1W4WNI4.1
#=GS A0A1D6PSB7_MAIZE/172-264    AC A0A1D6PSB7.1
#=GS A0A2I4CKJ7_9TELE/150-344    AC A0A2I4CKJ7.1
#=GS G1R041_NOMLE/160-355        AC G1R041.1
#=GS A0A672R5T5_SINGR/161-344    AC A0A672R5T5.1
#=GS A0A2K6PBP4_RHIRO/129-315    AC A0A2K6PBP4.1
#=GS A0A3Q2W7W8_HAPBU/159-343    AC A0A3Q2W7W8.1
#=GS A0A2K6BT25_MACNE/175-358    AC A0A2K6BT25.1
#=GS W5PPN2_SHEEP/186-373        AC W5PPN2.1
#=GS T1J252_STRMM/113-323        AC T1J252.1
#=GS A0A226NT74_COLVI/3-98       AC A0A226NT74.1
#=GS A0A226NX74_COLVI/223-338    AC A0A226NX74.1
#=GS A0A1D6PSC0_MAIZE/172-360    AC A0A1D6PSC0.1
#=GS A0A671Q2U5_9TELE/195-313    AC A0A671Q2U5.1
#=GS A0A445HLU2_GLYSO/234-414    AC A0A445HLU2.1
#=GS A0A6J3KY53_9HYME/170-372    AC A0A6J3KY53.1
#=GS A0A6J1NTD1_BICAN/441-624    AC A0A6J1NTD1.1
#=GS A0A452G7V5_CAPHI/218-402    AC A0A452G7V5.1
#=GS A0A0K3CT26_RHOTO/203-385    AC A0A0K3CT26.1
#=GS A5K4T5_PLAVS/162-341        AC A5K4T5.1
#=GS I3MD01_ICTTR/161-341        AC I3MD01.2
#=GS A0A226DD97_FOLCA/182-368    AC A0A226DD97.1
#=GS S8CV45_9LAMI/162-345        AC S8CV45.1
#=GS A0A212CU66_CEREH/163-352    AC A0A212CU66.1
#=GS L8Y9U0_TUPCH/190-305        AC L8Y9U0.1
#=GS PDI53_ORYSJ/192-367         AC Q0E0I1.1
#=GS A0A6J1RV84_FRAOC/160-344    AC A0A6J1RV84.1
#=GS B4GC86_DROPE/531-688        AC B4GC86.1
#=GS F6Q9Q9_BOVIN/218-402        AC F6Q9Q9.1
#=GS A0A3Q3EI53_9LABR/138-333    AC A0A3Q3EI53.1
#=GS A0A674EFQ0_SALTR/47-235     AC A0A674EFQ0.1
#=GS A0A669PAL1_PHACC/235-426    AC A0A669PAL1.1
#=GS A0A016X407_9BILA/100-288    AC A0A016X407.1
#=GS A0A2K5N617_CERAT/101-292    AC A0A2K5N617.1
#=GS A0A5A8CHB8_CAFRO/283-454    AC A0A5A8CHB8.1
#=GS A0A091U5Q7_PHORB/72-255     AC A0A091U5Q7.1
#=GS A0A6A5M8V8_LUPAL/169-354    AC A0A6A5M8V8.1
#=GS A0A453P573_AEGTS/195-363    AC A0A453P573.1
#=GS G1PIZ6_MYOLU/167-350        AC G1PIZ6.1
#=GS A0A668U1Y1_OREAU/557-754    AC A0A668U1Y1.1
#=GS A0A094CQM7_9PEZI/195-376    AC A0A094CQM7.1
#=GS A0A2A2JTD1_9BILA/162-342    AC A0A2A2JTD1.1
#=GS A0A287B5U9_PIG/186-274      AC A0A287B5U9.2
#=GS A0A1E4U1C9_PACTA/175-361    AC A0A1E4U1C9.1
#=GS A0A0D9YKX3_9ORYZ/213-400    AC A0A0D9YKX3.1
#=GS A0A0V0UC03_9BILA/172-356    AC A0A0V0UC03.1
#=GS A0A168NY57_ABSGL/246-436    AC A0A168NY57.1
#=GS A0A0N4VKZ7_ENTVE/305-386    AC A0A0N4VKZ7.1
#=GS A0A452F3U9_CAPHI/331-446    AC A0A452F3U9.1
#=GS H0VLT0_CAVPO/534-723        AC H0VLT0.2
#=GS A0A1D6ERC3_MAIZE/1-160      AC A0A1D6ERC3.1
#=GS A0A1J4K3T9_9EUKA/164-343    AC A0A1J4K3T9.1
#=GS A0A4T0W7P3_9PEZI/126-309    AC A0A4T0W7P3.1
#=GS A0A4U5LU69_STECR/123-290    AC A0A4U5LU69.1
#=GS A0A316U758_9BASI/161-343    AC A0A316U758.1
#=GS A0A084VAX6_ANOSI/462-629    AC A0A084VAX6.1
#=GS H2LXB2_ORYLA/86-270         AC H2LXB2.2
#=GS A0A3Q1H381_ANATE/159-342    AC A0A3Q1H381.2
#=GS A0A485NTL3_LYNPA/137-318    AC A0A485NTL3.1
#=GS A0A6J2UZ68_CHACN/314-506    AC A0A6J2UZ68.1
#=GS A0A0D0DPF5_9AGAM/327-499    AC A0A0D0DPF5.1
#=GS A0A6I9HL57_GEOFO/308-499    AC A0A6I9HL57.1
#=GS V4TIG4_CITCL/85-259         AC V4TIG4.1
#=GS A0A5N4AG13_PHOPY/160-341    AC A0A5N4AG13.1
#=GS D4A9L9_RAT/64-251           AC D4A9L9.1
#=GS A0A1S4C5C5_TOBAC/206-391    AC A0A1S4C5C5.1
#=GS A0A4U5ME42_STECR/359-528    AC A0A4U5ME42.1
#=GS A0A673TVM5_SURSU/180-367    AC A0A673TVM5.1
#=GS A0A287NWD9_HORVV/126-311    AC A0A287NWD9.1
#=GS A0A0L7R6H7_9HYME/177-379    AC A0A0L7R6H7.1
#=GS A0A3M9Y1J9_9PEZI/155-336    AC A0A3M9Y1J9.1
#=GS W4GTK4_9STRA/231-428        AC W4GTK4.1
#=GS A0A671P1H3_9TELE/192-311    AC A0A671P1H3.1
#=GS D2VCZ2_NAEGR/156-337        AC D2VCZ2.1
#=GS A0A6J3DWN9_AYTFU/196-382    AC A0A6J3DWN9.1
#=GS A0A5N5HMU4_9ROSA/169-393    AC A0A5N5HMU4.1
#=GS E9GGE1_DAPPU/299-492        AC E9GGE1.1
#=GS A0A0N4Y5R4_NIPBR/152-340    AC A0A0N4Y5R4.1
#=GS A0A2U3X5J4_ODORO/157-338    AC A0A2U3X5J4.1
#=GS A0A5A9PL54_9TELE/198-385    AC A0A5A9PL54.1
#=GS S7XI77_SPRLO/129-287        AC S7XI77.1
#=GS A0A2K1J9T8_PHYPA/213-392    AC A0A2K1J9T8.1
#=GS F7CVH0_MONDO/157-339        AC F7CVH0.2
#=GS A0A6P5XIP0_DURZI/171-349    AC A0A6P5XIP0.1
#=GS A0A091N3H7_APAVI/78-273     AC A0A091N3H7.1
#=GS A0A1Y3BHD2_EURMA/4-100      AC A0A1Y3BHD2.1
#=GS A0A4U5VJ65_COLLU/309-501    AC A0A4U5VJ65.1
#=GS A0A6J0XN04_ODOVR/130-310    AC A0A6J0XN04.1
#=GS A0A078JT18_BRANA/200-385    AC A0A078JT18.1
#=GS A0A428T3D5_9HYPO/90-206     AC A0A428T3D5.1
#=GS A0A6G1FQK7_9PEZI/153-334    AC A0A6G1FQK7.1
#=GS A0A2P8YWA6_BLAGE/140-296    AC A0A2P8YWA6.1
#=GS F1PH10_CANLF/180-365        AC F1PH10.2
#=GS A0A087VEA5_BALRE/107-292    AC A0A087VEA5.1
#=GS A0A158QR70_HAEPC/270-467    AC A0A158QR70.1
#=GS A0A803K097_XENTR/566-753    AC A0A803K097.1
#=GS A0A6J2LDF0_9CHIR/533-722    AC A0A6J2LDF0.1
#=GS A0A671RBG2_9TELE/136-317    AC A0A671RBG2.1
#=GS A0A4S2MJ51_9PEZI/162-342    AC A0A4S2MJ51.1
#=GS PDIA1_BOVIN/163-347         AC P05307.1
#=GS A0A6J0K0R6_RAPSA/213-398    AC A0A6J0K0R6.1
#=GS A0A068UIV0_COFCA/156-338    AC A0A068UIV0.1
#=GS A0A1V4JV64_PATFA/314-506    AC A0A1V4JV64.1
#=GS A0A3Q2VYM3_HAPBU/164-348    AC A0A3Q2VYM3.1
#=GS A0A251RVQ9_HELAN/200-382    AC A0A251RVQ9.1
#=GS A0A087R478_APTFO/78-273     AC A0A087R478.1
#=GS A0A5N3X5C2_MUNRE/160-355    AC A0A5N3X5C2.1
#=GS A0A060VW07_ONCMY/196-377    AC A0A060VW07.1
#=GS A0A2S4VV67_9BASI/233-318    AC A0A2S4VV67.1
#=GS A0A5J5MQ88_MUNRE/180-365    AC A0A5J5MQ88.1
#=GS A0A1S3FX23_DIPOR/44-231     AC A0A1S3FX23.1
#=GS A0A0E0J333_ORYNI/179-364    AC A0A0E0J333.1
#=GS A0A087VKN6_BALRE/124-304    AC A0A087VKN6.1
#=GS A0A0R3TEW4_RODNA/1-126      AC A0A0R3TEW4.1
#=GS F6XWT8_XENTR/183-368        AC F6XWT8.4
#=GS A0A420J623_9PEZI/200-381    AC A0A420J623.1
#=GS A0A672JBM6_SALFA/113-291    AC A0A672JBM6.1
#=GS A0A0D2X8D1_FUSO4/155-336    AC A0A0D2X8D1.1
#=GS PDIA3_CHICK/158-353         AC Q8JG64.1
#=GS F6VSN9_HORSE/160-355        AC F6VSN9.2
#=GS A0A0G4F631_VITBC/173-348    AC A0A0G4F631.1
#=GS A0A1U8JFD3_GOSHI/213-397    AC A0A1U8JFD3.1
#=GS A0A194X5V6_9HELO/78-257     AC A0A194X5V6.1
#=GS A0A3Q7SHC2_VULVU/142-326    AC A0A3Q7SHC2.1
#=GS A0A1U8GG21_CAPAN/207-354    AC A0A1U8GG21.1
#=GS ERP27_BOVIN/63-250          AC Q32L47.2
#=GS H0ZIZ6_TAEGU/193-388        AC H0ZIZ6.2
#=GS A0A6G1E5E5_9ORYZ/217-397    AC A0A6G1E5E5.1
#=GS A0A2C9WEI4_MANES/168-353    AC A0A2C9WEI4.1
#=GS A0A402F3P5_9SAUR/166-350    AC A0A402F3P5.1
#=GS F6QA08_PIG/159-354          AC F6QA08.1
#=GS A0A6A5D1X8_SCHHA/152-337    AC A0A6A5D1X8.1
#=GS A0A3Q3WAS3_MOLML/159-351    AC A0A3Q3WAS3.1
#=GS W5QHR0_SHEEP/63-250         AC W5QHR0.1
#=GS A0A409XTH5_PSICY/154-339    AC A0A409XTH5.1
#=GS A0A3B6QA65_WHEAT/235-419    AC A0A3B6QA65.1
#=GS A0A044V197_ONCVO/270-466    AC A0A044V197.2
#=GS A0A3M0JHQ2_HIRRU/534-721    AC A0A3M0JHQ2.1
#=GS A0A5N6R7Y7_9ROSI/175-343    AC A0A5N6R7Y7.1
#=GS Q6DD55_XENLA/161-345        AC Q6DD55.1
#=GS A0A665W7G1_ECHNA/154-344    AC A0A665W7G1.1
#=GS A0A2C5Y3K8_9HYPO/150-324    AC A0A2C5Y3K8.1
#=GS A0A3Q0HG91_ALLSI/200-315    AC A0A3Q0HG91.1
#=GS A0A421JGK2_9ASCO/180-366    AC A0A421JGK2.1
#=GS A0A673H3G5_9TELE/129-300    AC A0A673H3G5.1
#=GS A0A3P8TK48_AMPPE/160-354    AC A0A3P8TK48.1
#=GS F9FFN7_FUSOF/450-636        AC F9FFN7.1
#=GS A0A3P9MT42_POERE/169-353    AC A0A3P9MT42.1
#=GS A0A6H5IY33_9HYME/1565-1751  AC A0A6H5IY33.1
#=GS A0A196SJ60_BLAHN/177-373    AC A0A196SJ60.1
#=GS A0A5G2R7S2_PIG/150-333      AC A0A5G2R7S2.1
#=GS A0A4E0REJ7_FASHE/144-302    AC A0A4E0REJ7.1
#=GS A0A6Q2XLU6_ESOLU/147-340    AC A0A6Q2XLU6.1
#=GS A0A6J3F5W4_SAPAP/312-505    AC A0A6J3F5W4.1
#=GS A0A7P0TB26_HUMAN/186-370    AC A0A7P0TB26.1
#=GS J9JIZ2_ACYPI/166-352        AC J9JIZ2.1
#=GS A0A175VPU9_9PEZI/101-271    AC A0A175VPU9.1
#=GS A0A150VFZ6_9PEZI/150-334    AC A0A150VFZ6.1
#=GS J3P7V1_GAET3/153-334        AC J3P7V1.1
#=GS A0A0H1BQ01_9EURO/159-340    AC A0A0H1BQ01.1
#=GS A0A1S3U2D1_VIGRR/173-358    AC A0A1S3U2D1.1
#=GS A0A5P1FH52_ASPOF/176-361    AC A0A5P1FH52.1
#=GS A0A5F9DGH4_RABIT/167-350    AC A0A5F9DGH4.1
#=GS A0A0N4U605_DRAME/132-312    AC A0A0N4U605.1
#=GS H2LY09_ORYLA/168-351        AC H2LY09.2
#=GS A0A446RWG6_TRITD/176-276    AC A0A446RWG6.1
#=GS A0A2K5M003_CERAT/534-723    AC A0A2K5M003.1
#=GS A0A3P8W4D3_CYNSE/559-758    AC A0A3P8W4D3.1
#=GS A0A195CZV3_9HYME/157-343    AC A0A195CZV3.1
#=GS A0A3Q1M6P4_BOVIN/506-695    AC A0A3Q1M6P4.1
#=GS I3KEV3_ORENI/152-346        AC I3KEV3.2
#=GS B4LK14_DROVI/530-686        AC B4LK14.2
#=GS A0A673ZGR2_SALTR/146-340    AC A0A673ZGR2.1
#=GS A0A2I1HSK2_9GLOM/154-333    AC A0A2I1HSK2.1
#=GS A0A6J1WRZ4_GALME/174-360    AC A0A6J1WRZ4.1
#=GS A0A2Y9FQ80_PHYMC/105-288    AC A0A2Y9FQ80.1
#=GS F6X285_HORSE/177-360        AC F6X285.2
#=GS A0A093G5T6_DRYPU/148-331    AC A0A093G5T6.1
#=GS A0A2H2I7W8_CAEJA/156-339    AC A0A2H2I7W8.1
#=GS A0A6G0UFC9_9BILA/167-350    AC A0A6G0UFC9.1
#=GS A0A1S3K0S4_LINUN/186-370    AC A0A1S3K0S4.1
#=GS A0A6P4EWB6_DRORH/73-232     AC A0A6P4EWB6.1
#=GS A0A443SH14_9ACAR/110-294    AC A0A443SH14.1
#=GS A0A565B1V1_9BRAS/168-353    AC A0A565B1V1.1
#=GS A0A2K6A870_MANLE/68-252     AC A0A2K6A870.1
#=GS M9LQF1_PSEA3/170-341        AC M9LQF1.1
#=GS G0P305_CAEBE/154-342        AC G0P305.1
#=GS A0A4S4LTF1_9AGAM/156-340    AC A0A4S4LTF1.1
#=GS A0A6J1T837_FRAOC/166-363    AC A0A6J1T837.1
#=GS PDI_WHEAT/176-361           AC P52589.1
#=GS F0Z7Y2_DICPU/163-349        AC F0Z7Y2.1
#=GS A0A074S9W5_9AGAM/299-479    AC A0A074S9W5.1
#=GS A0A024WNR2_PLAFA/59-238     AC A0A024WNR2.1
#=GS B4HNU6_DROSE/157-342        AC B4HNU6.1
#=GS A0A665UXM9_ECHNA/176-360    AC A0A665UXM9.1
#=GS R0LNP9_ANAPL/159-344        AC R0LNP9.1
#=GS A0A2Y9NJZ4_DELLE/311-503    AC A0A2Y9NJZ4.1
#=GS A0A0D2EUS3_9EURO/153-333    AC A0A0D2EUS3.1
#=GS A0A5C6NW24_9TELE/244-372    AC A0A5C6NW24.1
#=GS A0A6J2TYL9_DROLE/158-343    AC A0A6J2TYL9.1
#=GS A0A0V1A4H0_9BILA/398-582    AC A0A0V1A4H0.1
#=GS A0A6I9KFT8_CHRAS/546-735    AC A0A6I9KFT8.1
#=GS A0A0N4U9I2_DRAME/172-356    AC A0A0N4U9I2.1
#=GS A0A5N5GGZ4_9ROSA/227-407    AC A0A5N5GGZ4.1
#=GS A0A0V0ZWN4_9BILA/635-824    AC A0A0V0ZWN4.1
#=GS M1B3K6_SOLTU/157-340        AC M1B3K6.1
#=GS A0A6P9BXN3_PANGU/105-288    AC A0A6P9BXN3.1
#=GS A0A5N5GBN2_9ROSA/198-359    AC A0A5N5GBN2.1
#=GS A0A6P3QZZ7_PTEVA/162-346    AC A0A6P3QZZ7.1
#=GS A0A094KQG6_PODCR/72-255     AC A0A094KQG6.1
#=GS A0A2G9TYG2_TELCI/21-186     AC A0A2G9TYG2.1
#=GS A0A2W1BHX0_HELAM/150-346    AC A0A2W1BHX0.1
#=GS A0A4X2M1C0_VOMUR/4-144      AC A0A4X2M1C0.1
#=GS R9PBG9_PSEHS/159-342        AC R9PBG9.1
#=GS A0A1S3LV10_SALSA/160-339    AC A0A1S3LV10.1
#=GS L9KZR9_TUPCH/445-586        AC L9KZR9.1
#=GS A0A2T4GP08_FUSCU/450-558    AC A0A2T4GP08.1
#=GS A0A016SRW2_9BILA/157-341    AC A0A016SRW2.1
#=GS Q5CXS7_CRYPI/162-369        AC Q5CXS7.1
#=GS A0A482VIU5_9CUCU/137-326    AC A0A482VIU5.1
#=GS M7YXF2_TRIUA/178-354        AC M7YXF2.1
#=GS A0A177WRE8_BATDL/337-529    AC A0A177WRE8.1
#=GS A0A3P9DBP3_9CICH/48-235     AC A0A3P9DBP3.1
#=GS A0A0E0F3A0_9ORYZ/179-364    AC A0A0E0F3A0.1
#=GS A0A3P9PJ99_POERE/309-498    AC A0A3P9PJ99.1
#=GS A0A6A5PHX2_LUPAL/189-366    AC A0A6A5PHX2.1
#=GS A0A0H5S5E5_BRUMA/161-341    AC A0A0H5S5E5.1
#=GS A0A565ARP0_9BRAS/168-352    AC A0A565ARP0.1
#=GS A0A2J6M9R6_LACSA/179-363    AC A0A2J6M9R6.1
#=GS A0A5G2Q8S4_PIG/120-300      AC A0A5G2Q8S4.1
#=GS A0A4W5NG13_9TELE/128-322    AC A0A4W5NG13.1
#=GS R7TMF8_CAPTE/515-709        AC R7TMF8.1
#=GS A0A4Q9M0K5_9MICR/130-291    AC A0A4Q9M0K5.1
#=GS A0A2K6K6R2_RHIBE/447-588    AC A0A2K6K6R2.1
#=GS M3Y570_MUSPF/312-504        AC M3Y570.1
#=GS D8LV51_BLAHO/158-341        AC D8LV51.1
A0A1Y2E334_9PEZI/151-332               ...................................................................................................ida---SDKASNETFTEVA.EK.......LRDS......YPF.G.....A...S...N.....D...VA......................LAEA.............EGV.TA.....P.A....I..V...L..YK..................................Q.......FD.E.....G.K...S.I...F..SEK........................-F..DV...E.A....I..E....T....F...A.........K..T.........S.............S..........T........P............L............I........G........E.................V.....G.....P................E...........T......Y..S...........G.....Y....M.........S.....A.....G......L.......P..........-.......-....L..A....Y.......I.......F.......A.....E....T.....P...EE..R.......................K...E...L.G..D.SL.......KPVA....E.KY..................................R...G...............K.........IN.....FA..................................TIDAK..........SF.GA...HA....G....N....L....N....L....K......T.....D...........K........F....P....S....F..A.I.QETVK...N....Q......K.FP..F...D...Q...EK...E....I.TV.......DAISTFVDE........................................................................................
K7F6Z5_PELSI/1-120                     ......................................................................................................----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.-....-..-...-..--..................................-.......--.-.....-.-...-.-...-..---........................--..--...-.-....M..S....R....F...I.........K..I.........N.............E..........L........R............L............V........T........E.................Y.....N.....P................V...........T......A..I...........G.....L....F.........S.....S.....L......V.......Q..........I.......H....L..L....L.......F.......T.......D.....K....S.....S...QE..H.......................T...E...R.M..H.RY.......REAA....E.LF..................................R...G...............Q.........IL.....FI..................................LVDSNv........kGN.GR...VM....S....F....F....N....L....K......K.....S...........Q........L....P....A....L..A.I.FHTPD...E....K......Q.DV..L...P...-...LD...E....V.SV.......EHVRDFCN-g.......................................................................................
A0A3P6UBV8_LITSI/119-289               ........................................................................................atgyievvktddrs----------------.--.......----......---.-.....-...-...-.....-...--......................VARG.............LAV.AT....fP.A....L..V...Y..FR..................................R.......--.Q.....N.P...I.T...Y..DGD.......................fN-..DS...H.A....I..L....R....W...L.........R..S.........H.............E..........E........V............A............T........W........V.................L.....T.....D................D...........S......F..E...........D.....Y....T.........D.....S.....Y......S.......Pde.....galD.......W....F..V....M.......F.......Y.......N.....S....E.....E...PD..C.......................N...S...F.V..A.TW.......ESVA....H.KFf...............................rlR...G...............L.........VN.....VG..................................RVDMS..........IN.DD...VT....D....R....F....R....L....D......D.....A...........Q........C....P....I....F..L.L.FH-RG...K....M......Y.RY..K...-...-...DA...A....K.NI.......RSLTAFA--my......................................................................................
A0A671U7U2_SPAAU/556-755               ......................................................................................................FKTQAHTGVSLFTEAA.KS.......LRGE......VLT.G.....L...L...T.....D...-G......................LAEKwa.........aeHTA.DL.....P.A....V..F...V..FPs................................wR.......TH.T.....H.P...L.S...L..PAS........................-T..SA...D.E....L..L....S....H...I.........N..T.........A.............L..........L........H............P............L........P........E.................L.....T.....V................E...........N......L..P...........S.....F....L.........S.....L.....G......K.......A..........-.......L....L..L....L.......F.......V.......G.....E....E.....E...DE..I.......................G...R...R.Q..N.--.......QVLV....E.EMrgv...........................vesgR...Gr............meQ.........YL.....AC..................................WIHLGr.......tpAG.MS...VL....G....S....Y....L....G....S......M.....P...........P........L....P....A....L..V.L.THLPS...G....De....iY.QY..S...P...-...NT...P....I.TA.......PSVLQWLQ-r.......................................................................................
A0A1B9IS13_9TREE/310-485               ........................................................................................ksalepllgavpay----------------.--.......----......---.-.....T...S...S.....D...PQ......................FYQQ.............LSV.ANp...pP.T....S..V...L..FA..................................F.......SS.F.....S.S...R.-...P..VGSl.....................sfPA..SE...D.S....L..K....R....F...I.........Q..S.........H.............R..........F........P............T............L........V........E.................L.....T.....G................S...........N......Y..N...........A.....I....M.........N.....S.....D......T.......R..........A.......I....V..V....L.......G.......A.......L.....H....K.....A...DE..G.......................Q...K...E.K..E.KL.......AEVA....K.AWkrg...........................grpfS...Q...............P.........VW.....FV..................................WVDGE..........KW.SG...WL....K...qQ....Y....S....I....K......K.....S...........Q........L....P....S....A..V.V.IDTPQ...N....E......Y.Y-..-...-...-...--...-....-.--.......---------dttiegteit..............................................................................
A0A663EXN3_AQUCH/1-130                 .................................................................................................mnskd----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.-....-..-...-..--..................................-.......--.-.....-.-...-.-...-..---........................-V..DA...E.K....M..T....R....F...I.........R..M.........N.............E..........L........R............L............V........T........E.................Y.....N.....P................V...........T......A..I...........G.....V....M.........Q.....S.....S......L.......Q..........L.......H....L..L....L.......I.......T.......D.....K....M.....S...PR..H.......................P...E...R.M..R.RY.......RAAA....E.LF..................................K...G...............K.........IL.....FI..................................LVDSNl........kSN.EQ...TV....S....F....F....K....L....K......K.....S...........Q........L....P....A....L..A.I.FNTPD...E....K......Q.DV..L...T...-...LD...E....V.SV.......ERVQDFCN-r.......................................................................................
A0A452F670_CAPHI/238-342               ..................................................................................................aagq----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.-....-..-...-..--..................................-.......--.-.....-.-...-.-...-..---........................--..--...-.-....-..-....-....-...-.........-..-.........-.............-..........-........-............-............-........-........-.................-.....-.....-................-...........T......S..S...........K.....I....F.........A.....A.....R......I.......L..........N.......H....L..L....L.......F.......V.......N.....Q....T.....L...DA..H.......................R...E...L.L..P.GF.......REAA....P.HF..................................R...G...............Q.........VL.....FV..................................VVDVG.........aDN.DH...VL....Q....Y....F....G....L....K......A.....Q...........E........A....P....T....L..R.F.INVET...T....K......K.YA..P...E...H...GA...A....V.TA.......ATITDFCR-t.......................................................................................
A0A2S5B441_9BASI/153-335               ....................................................................................................vd--ESDSKTQEAFKTFA.NQ.......HRDD......YLF.G.....L...S...T.....D...AA......................THSA.............ANV.KP.....P.Q....V..V...M..YK..................................S.......FD.E.....G.R...N.D...L..EGS........................-I..SE...D.S....L..F....D....F...A.........K..E.........H.............S..........V........P............L............L........D........E.................I.....S.....P................D...........N......F..A...........T.....Y....A.........E.....A.....G......I.......P..........-.......L....A..Y....I.......F.......V.......P.....S....N.....D...AK..R.......................D...E...I.V..D.AI.......KPVA....R.EH..................................K...G...............K.........LN.....FV..................................WIDSN..........KF.AD...HA....K....S....L....N....L....Q......E.....P...........K........W....P....A....F..A.-.IQSIQ...D....M......T.KF..P..lD...Q...SK...D....V.SH.......DNVAAFVKD........................................................................................
PDIA4_RAT/310-502                      ...............................................................................................fqgvgdp-------GYLQYQDAA.NT.......LRED......YKF.H.....H...T...F.....S...TE......................IAKF.............LKV.SL.....G.K....L..V...L..MQ..................................P.......-E.K.....F.Q...S.K...Y..EPRmhvm................dvqgST..EA...S.A....I..K....D....Y...V.........V..K.........H.............A..........L........P............L............V........G........H.................R.....K.....T................S...........N.....dA..K...........R.....Y....S.........K.....R.....P......L.......V..........V.......V....Y..Y....Sv.....dF.......S.......F.....D....Y.....R...TA..T.......................Q...F...W.R..N.KV.......LEVA....K.DF..................................P...E...............-.........YT.....FA..................................IADEE..........DY.AT...EV....K....D....L....G....L....S......E....sG...........E........D....V....N....A..A.I.LD-ES...G....K......K.FA..M...E...-...PE...E....F.DS.......DALQEFVM-a.......................................................................................
#=GR PDIA4_RAT/310-502           SS    ...............................................................................................-S-TT-H-------HHHHHHHHH.HH.......CTTT......--E.E.....E...E...-.....-...HH......................HHHH.............HT-.-S.....S.E....E..E...E..E-..................................-.......-G.G.....G.-...-.T...T..S-SEEEE................E--TTS..-H...H.H....H..H....H....H...H.........H..H.........H.............S..........S........-............T............E........E........E.................E.....-.....T................T...........T.....HH..H...........H.....S....-.........S.....S.....S......E.......E..........E.......E....E..E....--.....--.......S.......T.....T....T.....H...HH..H.......................H...H...H.H..H.HH.......HHHH....T.T-..................................T...T...............-.........SE.....EE..................................EEETT..........TT.HH...HH....H....H....T....T....T....T......T....SS...........-........S....-....E....E..E.E.E--TT...S....-......E.EE..-...-...-...--...S....-.-H.......HHHHHHHH-H.......................................................................................
A0A2G5SSL5_9PELO/157-341               ......................................................................................................FKDTASDDAKTFLEVA.AG.......ID-D......IPF.G.....I...S...T.....E...DA......................VKSE.............IEL.KG.....E.G....I..V...L..FK..................................K.......FD.D.....G.R...V.A...F..DEK........................-L..TQ...D.S....L..K....T....W...I.........Q..A.........N.............R..........L........A............L............V........S........E.................F.....T.....Q................E...........T......A..S...........V.....I....F.........G.....G.....E......I.......K..........S.......H....N..L....L.......F.......V.......S.....K....E.....S...SD..F.......................A...K...L.E..T.EF.......KNAA....K.QF..................................K...G...............K.........VL.....FV..................................YINTDv........eEN.AR...IM....E....F....F....G....L....K......K.....D...........E........L....P....A....I..R.L.ISLEE...D....M......T.KF..K...P...D...FE...E....I.TT.......ENISKFTQ-s.......................................................................................
A0A6J1NQ02_BICAN/158-340               ....................................................................................................fe---KDSELKSEFLKNA.DK.......MREE......ITF.G.....H...T...S.....A...EE......................VLKK.............AGF.K-.....D.N....V..V...L..YRpkr............................lsnK.......FE.D.....S.S...V.V...Y..NGE........................--..--...G.S....L..K....A....F...I.........K..E.........N.............Y..........H........G............L............V........G........V.................R.....Q.....K................E...........T......L..A...........D.....F....T.........S.....P.....L......V.......V..........A.......Y....Y..D....L.......D.......W.......T.....K....N.....P...KG..T.......................N...Y...W.R..N.RV.......LKVA....K.EL..................................P...E...............-.........VT.....FA..................................VSDKD..........DF.VH...EL....N....D....Y....G....I....D......Fa...rG...........D........K....P....V....V..A.G.KDIEG...N....K......-.-F..V...M...-...SA...E....F.SI.......DNIIAFTKD........................................................................................
A0A232FII7_9HYME/160-344               ......................................................................................................FKDAESENAKVFLEVA.NS.......ID-D......TVF.G.....I...S...S.....N...AD......................VFAE.............YGV.ED.....G.K....V..V...L..FK..................................K.......FD.D.....N.K...A.E...F..ADE........................-H..NV...A.N....L..K....K....F...I.........Q..V.........E.............S..........L........P............L............I........V........E.................F.....N.....Q................E...........T......A..R...........T.....I....F.........N.....G.....D......I.......K..........S.......H....L..L....V.......F.......L.......S.....Q....E.....A...GH..F.......................D...K...Y.A..D.DL.......KTPA....K.EF..................................R...G...............K.........VL.....FV..................................TINADd........aDH.ER...IL....E....F....F....G....M....K......K.....D...........N........T....P....A....M..R.L.IQLEE...D....M......A.KY..K...P...E...NS...E....I.SA.......DNVKEFV--sa......................................................................................
A0A2Y9FGV3_PHYMC/314-506               ......................................................................................................FKAESDPAYQQYQDAA.NN.......LRED......YKF.H.....H...T...F.....S...PE......................IAKF.............LKV.SP.....G.K....L..V...I..MQ..................................P.......-E.K.....F.Q...S.K...Y..EPKshvm................diqdST..ES...S.A....I..K....E....H...V.........L..R.........H.............T..........L........P............L............V........G........Q.................R.....K.....S................S...........N.....eA..K...........R.....Y....S.........R.....R.....P......L.......V..........V.......V....YygV....D.......F.......G.......F.....D....Y.....R...VA..T.......................Q...F...W.R..N.KV.......LEVA....K.DF..................................P...E...............-.........YT.....FA..................................VADED..........DF.AT...EV....K....D....L....G....L....S......E.....S...........G........E....E....V....N..A.A.IL-DE...G....G......R.RF..A...M...E...PD...D....F.DA.......DALRAFV--sa......................................................................................
G5E7I2_MELGA/253-445                   .....................................................................................................f-SGETDEAYQLYQEAA.NS.......LRED......YKF.H.....H...T...F.....S...NE......................IAKL.............LKV.SP.....G.K....L..V...V..MQ..................................Pekf.qskHE.S.....K.M...-.-...Y..VLDlk....................qyST..DE...S.E....I..K....E....H...V.........V..K.........H.............A..........L........P............L............V........G........H.................R.....K.....P................S...........N.....dA..K...........R.....Y....A.........K.....R.....P......L.......V..........V.......V....Y..Yt..vD.......F.......S.......F.....D....Y.....R...VA..T.......................Q...Y...W.R..S.KV.......LEVA....K.DF..................................P...E...............-.........YV.....FA..................................VSDEE..........DY.SS...EI....K....D....L....G....L....L......E....sG...........E........D....V....N....V..A.I.LD--E...G....G......K.KY..A...M...E...PE...E....F.DS.......DALRQFV--l.......................................................................................
A0A674E3M2_SALTR/167-350               .....................................................................................................f-IQKDSENYHTFEKVA.NI.......LRDD......CVF.L.....A...A...F.....-...GD......................VSQT.............ERF.SG.....D.N....V..I...-..YK..................................P.......MG.E.....T.V...P.D...M..VYLg......................sLT..NF...D.L....T..Y....A....W...A.........Q..D.........K.............C..........V........P............L............V........R........E.................I.....T.....F................E...........N......G..E...........E.....L....T.........E.....E.....G......I.......P..........F.......L....I..L....F.......H.......V.......K.....E....D.....T...ES..L.......................E...K...F.Q..H.EV.......ARQL....I.SE..................................K...G...............S.........IN.....FL..................................HADCE..........KF.RH...PL....L....H....I....Q....K....T......P.....A...........D........C....P....V....I..A.-.IDSFR...H....M......Y.VY..P...E...F...RD...I....E.IP.......GKLRQFV--ld......................................................................................
A0A6J0A3K6_ACIJB/534-723               ......................................................................................................FSPNMTTAKEDFTKAG.NY.......LRGC......VIT.G.....I...Y...S.....E...ED......................VLILs..........nkYGA.TL.....P.A....L..L...L..AR..................................H.......KE.G.....K.V...E.S...V..PFA........................NS..RV...Q.D....I..V....Q....I...V.........T..N.........A.............L..........L........E............T............F........P........E.................I.....T.....V................E...........N......L..P...........V.....Y....L.........R.....L.....Q......K.......P..........-.......L....L..I....L.......F.......S.......D.....-....G.....S...IN..P.......................Q...Y...T.K..A.IL.......TLVK....E.KH..................................L...D...............S.........LT.....PC..................................WLNLKn........tPA.GR..gIL....Q...tY....F....N....A....L......-.....P...........P........L....P....L....I..V.V.VNLHS...G....G.....qV.FA..F...P...S...EQ...A....V.TE.......QNLLLWLKK........................................................................................
A7AVK4_BABBO/160-326                   ....................................................................................................hd---SSEELMQEYENLA.DI.......HRSD......ATF.Y.....F...V...H.....Q...GK......................----.............---.--.....K.E....I..Y...V..MH..................................R.......-G.N.....D.R...F.E...F..TGS........................--..TV...E.E....L..V....E....F...V.........R..Q.........E.............S..........L........P............L............F........A........E.................I.....G.....H................A...........N......Y..V...........R.....Y....F.........N.....S.....G......K.......A..........-.......-....I..S....W.......F.......C.......A.....-....T.....Q...AD..Y.......................D...K...Y.R..S.TF.......ISVA....R.KL..................................R...A...............S.........VL.....FA..................................WLDVE..........KF.TA...AK....E....A....F....A....I....E......-.....-...........S........F....P....A....V..A.-.HQTNA...G....R......Y.IL..L...P..eV...YP...Y....D.DV.......EAVIRFY--sd......................................................................................
M3YPG6_MUSPF/180-365                   ......................................................................................................FQDLEEEVAELFYDMI.KD.......FP-E......LTF.G.....V...I...S.....I...SN......................VIGR.............FHV.TL.....D.S....V..L...V..FK..................................K.......--.G.....K.I...V.K...R..EELi.....................ndIT..NK...H.V....L..N....Q....V...I.........K..G.........H.............L..........T........D............F............V........I........E.................Y.....N.....T................E...........S......K..D...........L.....I....Y.........E.....L.....H......I.......L..........N.......H....M..L....L.......F.......A.......S.....K....S.....W...ES..F.......................G...L...I.M..Q.HY.......KLAS....K.EF..................................T...N...............K.........IL.....FI..................................LVNADe........pRN.GH...IL....K....Y....F....R....I....T......E.....V...........N........I....P....C....V..Q.I.LNLSS...D....A......R.YK..M...P...-...SE...E....I.TY.......ENLKKF---ghs.....................................................................................
A0A6J0PBT0_RAPSA/179-351               ...................................................................................................lgr----------------.-K.......YKKK......AWF.A.....V...A...K.....D...ASe....................dVMVA.............YDF.DR....aP.A....L..V...A..QH..................................P.......AY.N.....E.H...S.V...F..YGP........................-F..ED...G.F....L..E....E....F...V.........K..Q.........N.............F..........I........P............L............I........L........P.................I.....N.....H................N...........T......L..K...........L.....L....K.........D.....D.....E......R.......K..........M.......V....L..T....I.......V.......E.......D.....E....T.....H...ES..M.......................G...K...L.V..K.AL.......RAAA....H.AN..................................R...D...............-.........LV.....FG..................................YVGVE..........QF.EE...FA....D....S....F....H....A....D......K....kA...........E........L....P....K....I..V.V.WDGDE...E....-......-.--..-...-...-...--...-....-.--.......---------yeqvnvvetisheedhltqvsr..................................................................
A0A670IA89_PODMU/168-352               ......................................................................................................FKDAESDAAKQFLLAA.ES.......ID-D......IPF.G.....I...S...S.....N...SD......................VFAK.............YQL.SK.....D.G....V..A...L..FK..................................K.......FD.E.....G.R...N.N...Y..EGE........................-I..TK...E.N....L..L....N....F...I.........K..S.........N.............Q..........L........P............L............V........I........E.................F.....T.....E................Q...........T......A..P...........K.....I....F.........G.....G.....E......I.......K..........T.......H....I..L....L.......F.......L.......P.....K....S.....V...TD..Y.......................Q...G...K.L..D.NF.......KKAA....E.SF..................................K...G...............K.........IL.....FI..................................FIDSDh........gDN.QR...IL....E....F....F....G....L....K......K.....E...........E........C....P....A....I..R.L.ITLEE...E....M......T.KY..K...P...D...SE...E....L.TP.......ENIRDFCNK........................................................................................
A0A0D2SWW0_GOSRA/172-330               .....................................................................................isnlavkykkkawfsva----------------.--.......----......---.-.....-...-...-.....-...KD......................FSDDam.........vlYDF.DK....vP.S....L..V...A..LH..................................P.......SY.K.....Q.Q...S.V...F..YGP........................-F..ED...S.F....L..G....D....F...V.........K..Q.........N.............L..........L........P............L............V........V........P.................L.....N.....H................E...........T......L..K...........L.....L....K.........D.....E.....E......R.......K..........-.......V....V..L....T.......I.......L.......N.....D....E.....D...ED..Q.......................S...Q...N.L..I.KL.......LKAA....A.SA..................................N...P...............D.........LV.....FS..................................YVGVE..........QW.ED...FA....D....K....F....E....A....N......Q....kT...........K........L....P....K....M..I.V.WN---...-....-......-.--..-...-...-...--...-....-.--.......---------gneeyfsvg...............................................................................
A0A437APU1_9MICR/254-444               ...........................................................................................fysdlglanhy-----------FKRIA.HE.......YKFR......TKF.Y.....K...T...N.....D...KL......................LFERa...........gIHP.KK.....P.T....L..E...N..IN..................................D.......ND.K.....V.I...L.S...V..YKDgtfhq..............cpfglE-..EN...Q.K....V..P....E....W...I.........F..N.........S.............H..........F........P............N............L........T........K.................I.....T.....N................D...........N......F..S...........S.....V....F.........H.....G.....L......N.......P..........-.......V....L..L....L.......I.......T.......-.....K....-.....-...--..N.......................D...Q...F.V..D.QL.......EKYS....I.KK..................................R...Tgm..........pffE.........YL.....FA..................................TIDSD..........SF.PS...FT....T....T....L....-....V....P......T.....L...........P........V....P....I....L..V.V.YXPQT...Q....K......F.YY..-...K...-...--...-....-.--.......---------itkfdklxfdnyad..........................................................................
A0A090MX54_STRRB/163-347               ......................................................................................................FEKEDSEQAKAFLEVA.GS.......MD-D......IPF.G.....I...T...T.....K...EV......................AAKA.............IEL.KE.....E.G....V..V...L..LK..................................K.......FD.E.....G.R...N.E...F..EGK........................-I..EE...S.K....L..K....T....F...I.........Q..A.........N.............R..........L........A............L............V........N........E.................F.....S.....Q................E...........T......A..S...........V.....I....F.........G.....G.....E......I.......K..........S.......H....N..L....L.......F.......I.......S.....K....E.....S...ED..F.......................D...K...I.Y..G.QF.......QTAA....K.EF..................................K...G...............K.........LL.....FV..................................YINTDv........eDN.AR...IM....E....F....F....G....L....K......S.....E...........E........L....P....A....I..R.L.ISLEE...D....M......T.KF..K...P...D...FT...E....I.TA.......ENIKKFTQ-s.......................................................................................
B9EL99_SALSA/47-235                    ............................................................................................fetpsdetfg--------YKEFVEAA.KT.......VK-H......IPV.A.....L...C...S.....D...KE......................AWAK.............LSI.VS.....D.T....I..A...I..FR..................................K.......AD.N.....H.Q...D.N...L..QLSe.....................tkKV..EA...D.G....L..A....R....F...I.........T..M.........N.............E..........L........R............Y............I........T........E.................Y.....N.....Q................V...........T......A..V...........G.....L....F.........Q.....S.....E......V.......K..........A.......H....L..L....L.......F.......I.......N.....R....G.....S...GD..Y.......................E...V...L.K..D.RL.......GALA....P.EF..................................V...G...............K.........FL.....FV..................................LVHGV.........kSN.EK...SL....G....Y....F....G....L....T......S.....R...........D........L....P....R....V..G.I.YDRDS...D....M......K.WL..M...P...-...EG...E....I.ST.......ERVREFCQ-s.......................................................................................
A0A183KVC7_9TREM/5-140                 ............................................................................................skiksltilk----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.-....-..-...-..--..................................-.......--.-.....-.-...-.-...-..---........................NA..DL...T.A....I..H....N....W...V.........K..N.........Q.............C..........N........S............L............V........R........E.................I.....T.....F................S...........N......A..E...........E.....I....T.........E.....E.....R......L.......P..........-.......L....M..L....L.......F.......Y.......N.....P....D.....N...KT.iV.......................S...R...F.M..E.FV.......NSHL....S.HH..................................Q...S...............T.........IN.....FV..................................TANGI..........TF.SH...PL....A....H....L....G....K....S......K.....E...........D........L....P....F....I..C.-.LDSFA...H....M......Y.VY..P...Gs.vE...MA...L....S.DP.......KHLDQFVED........................................................................................
A0A1E5VI43_9POAL/228-412               ................................................................................................fpafgg------SEYENFMAVA.EK.......MRND......YDF.L.....H...T...L.....D...AS......................ILPQg...........dKPV.KG.....P.A....V..R...L..FK..................................P.......FD.E.....L.F...A.D...S..QD-........................-F..DK...D.A....L..Q....K....F...I.........E..V.........S.............G..........S........P............T............V........V........T.................F.....Dt...nP................T...........Nh...kfL..L...........K.....Y....F.........E.....N.....D......G.......T..........-.......K....A..M....L.......F.......L.......S.....F....D.....D...DR..I.......................E...A...F.K..S.QF.......YEAA....K.QY.................................gE...K...............N.........IS.....FL..................................IGDVT..........EA.QG...AF....Q....Y....F....G....L....K......E.....S...........E........V....P....L....L..F.I.QASTT...K....Y......-.-I..-...-...-...--...-....-.--.......---------kptvepdqilpwlke.........................................................................
A0A5D2Z3T3_GOSMU/228-411               .................................................................................................nslvg------PESDELAATS.KL.......LD-D......IKF.Y.....Q...T...M.....N...PD......................VAKLfh.........idPEV.KR.....P.A....L..V...L..LK..................................K.......DA.E.....K.I...C.H...F..DGL........................-F..VK...T.A....I..S....E....F...V.........T..S.........N.............K..........L........P............L............V........T........I.................F.....S.....R................E...........S......A..P...........S.....I....F.........E.....S.....S......I.......K..........M.......H....L..L....L.......F.......A.......-.....-....T.....L...NI..S.......................E...K...Y.I..P.VL.......QEAA....K.LF..................................K...G...............K.........LI.....SI..................................YVQVDn.......eeSG.KP...VA....N....F....F....G....V....S......-.....G...........N........G....P....T....I..R.A.YS-GD...D....V......K.KF..A...M...-...NG...D....V.TF.......NNIKAFAED........................................................................................
A0A5A7P488_STRAF/182-364               ............................................................................................desiivdlav----------------.-K.......YKKKa....wFSV.A.....K...D...F.....S...ED......................VMTL.............YDF.DK....vP.A....L..V...A..IH..................................P.......AY.N.....E.K...N.I...F..YGP........................-F..EE...N.F....L..E....D....Y...I.........K..Q.........S.............L..........L........P............L............V........L........P.................I.....N.....Q................D...........S......L..K...........L.....L....K.........D.....D.....E......R.......K..........V.......A....L..T....I.......L.......E.......D.....E....V.....D...EK..S.......................R...K...I.I..E.VL.......KSAA....A.AN..................................R...D...............-.........VI.....FG..................................YVGLK..........QW.ED...FV....D....S....F....E....I....N......K....kT...........K........L....P....K....M..V.V.WDGDE...D....Y......Y.NV..I...G...-...SD...S....I.DEad...mgNQVSKFL--eg......................................................................................
A0A2K5N302_CERAT/178-365               ......................................................................................................FQDLQDEDVATFLALA.RD.......AL-D......MTF.G.....L...T...D.....R...PR......................LFEQ.............FGL.TK.....D.T....V..V...L..FK..................................K.......FD.E.....G.R...A.D...F..PVDe.....................elGL..DL...G.D....L..S....R....F...L.........V..T.........H.............S..........M........H............L............V........T........E.................F.....N.....S................Q...........T......S..P...........K.....I....F.........A.....A.....R......I.......L..........S.......H....L..L....L.......F.......V.......N.....Q....T.....L...AA..H.......................R...E...L.L..V.GF.......GEAA....P.HF..................................R...G...............Q.........VL.....FV..................................VVDVA.........aDN.EH...VL....Q....Y....F....G....L....K......V.....E...........A........A....P....T....L..R.F.INVET...T....K......K.YA..P...V...D...GG...P....V.TA.......ASVTAFCH-a.......................................................................................
Q4E3F7_TRYCC/152-345                   ....................................................................................................ts--DMESTLSKTLATSA.EG.......LRMK......MKF.V.....V...I...T.....D...SN......................ILPD.............EKP.--.....E.S....I..I...V..FR..................................K.......GG.E.....-.K...E.V...F..DGA........................-M..ET...A.D....L..K....S....F...L.........E..V.........A.............F..........I........P............F............M........G........E.................I.....N.....P................N...........T......Y..L...........D.....Y....A.........G.....I.....S......G.......P..........-.......V....A..W....V.......L.......L.......K.....P....S.....E...EE..S.......................K...E...L.K..S.KL.......LDVG....K.KM..................................R...R...............L.........MV.....LL..................................WVDAE..........QY.GV...-A....S....S....L....G....L....S......D....dA...........K........Y....P....A....F..V.I.AR-GE...D....H......F.-V..H...P...S...TE...P....V.TA.......ESIEKFI--ieysekklspeiksqpvp......................................................................
A0A5J9V317_9POAL/353-529               .........................................................................................eygakykkkawfs--------------VA.KD.......FSED......MMV.L.....-...-...-.....-...--......................----.............YDF.DK....aP.A....L..I...S..HN..................................P.......KY.N.....E.Q...S.V...F..YGP........................-F..EG...T.F....L..E....D....F...I.........R..Q.........S.............L..........L........P............L............T........V........P.................I.....N.....R................E...........T......V..K...........L.....L....D.........D.....D.....D......R.......K..........V.......V....L..T....I.......L.......D.......D.....E....T.....D...EN..S.......................P...Q...L.I..K.VL.......RSAA....S.AN..................................H...D...............-.........LI.....FG..................................YVGVK..........QW.EE...FT....E....T....F....D....V....S......K....sS...........R........Q....P....K....M..I.V.WD-RD...E....E......Y.EV..V...E...G...SE...Q....L.EEgd...ygSQISQFL--eg......................................................................................
B6HK48_PENRW/162-343                   ...................................................................................................vas---DDKAANKSFTSFA.ES.......QRDN......FLF.A.....A...S...N.....D...AA......................LAKA.............EGA.KQ.....P.S....I..V...L..YK..................................D.......FD.E.....K.K...A.V...Y..DGK........................-L..DE...E.A....I..L....E....W...V.........K..T.........A.............S..........T........P............L............V........G........E.................L.....G.....P................E...........T......Y..S...........K.....Y....M.........A.....A.....G......I.......P..........-.......-....L..A....Y.......I.......F.......A.....E....T.....A...EE..R.......................E...Q...F.A..A.DF.......RPIA....E.SH..................................R...G...............A.........IN.....IV..................................TLDAK..........LF.GA...HA....G....N....L....N....L....E......P.....E...........K........F....P....A....F..A.I.QDTTK...N....A......K.YP..Y...D...Q...TK...K....V.DA.......KDIGKFIKD........................................................................................
J9JPW0_ACYPI/529-687                   ..............................................................................................dqsgiafv----------------.--.......----......---.-.....K...I...S.....N...ID......................EARE.............YGI.TT....vP.K....L..M...Y..FE..................................K.......R-.-.....I.P...H.L...Y..NGD........................LL..KE...E.E....V..L....S....W..lI.........H..Q.........K.............R..........H........S............E............I........P........E.................V.....T.....D................E...........I......V..D...........K.....L....I.........E.....S.....E......-.......A..........Y.......L....A..V....L.......F.......Y.......D.....K....D.....D...RE..D.......................I...R...I.L..N.EL.......ENID....D.EL..................................D...K...............E.........-G.....IV..................................IVRLD..........-D.AN...EA....K....E....Y....G....I....D......-.....-...........H........L....P....T....L..V.Y.FE---...N....K......I.PA..I...Y...E...GD...L....I.NE.......EQVLKWL--ie......................................................................................
A0A428QY51_9HYPO/455-566               ..................................................................................................kivk----------------.--.......----......---.-.....-...T...S.....D...PE......................LCTK.............FKI.TT....wP.R....L..L...V..SR..................................E......gRA.T.....Y.Y...T.P...I..TPD.......................eMR..NV...D.E....L..V....S....W...M.........K..S.........T.............W..........L........P............L............V........P........E.................M.....T.....A................I...........N......A..R...........Q.....I....M.........N.....H.....K......L.......V..........-.......-....V..L....A.......V.......L.......N.....-....-.....R...ED..E.......................G...K...F.Q..N.SI.......----....-.--..................................-...-...............-.........--.....--..................................-----..........--.--...--....-....-....-....-....-....-......-.....-...........-........-....-....-....-..-.-.-----...-....-......-.--..-...-...-...--...-....-.--.......---------felknaanewmdrqvqefq.....................................................................
A0A6P6B7X5_DURZI/168-353               ......................................................................................................FPKFSGEEFESYIAFA.EK.......LRSD......YEF.G.....H...T...L.....D...AK......................HLPRg...........eSLV.TG.....P.V....V..R...L..FK..................................P.......FD.E.....L.F...V.D...F..KD-........................-F..NL...E.A....L..E....K....F...V.........E..E.........S.............S..........I........P............L............V........T........F.................Y.....Nn...dP................S...........Nh...pfV..V...........K.....F....F.........N.....S.....P......Y.......V..........-.......K....A..M....L.......F.......A.......N.....L....S.....S...EG..V.......................D...S...L.K..S.KY.......REVA....E.QY..................................R...G...............Q........gIS.....FL..................................LGDVE..........AS.QG...AF....Q....Y....F....G....V....Q......E.....S...........Q........V....P....L....I..I.I.QNNDG...K....K......Y.-L..-...-...-...--...-....-.--.......---------kahvvadhiapwvkd.........................................................................
A0A452RJ89_URSAM/312-504               ......................................................................................................FKAESDPAYQQYQDAA.NN.......LRED......YKF.H.....H...T...F.....N...TE......................IAKF.............LKV.SP.....G.K....L..V...V..MQ..................................P.......-E.K.....F.Q...S.K...Y..EPRshvm................diesST..EG...A.A....I..K....D....H...V.........L..K.........H.............T..........L........P............L............V........G........H.................R.....K.....T................S...........N.....dA..K...........R.....Y....T.........R.....R.....P......L.......V..........V.......V....Y..Y....Sv.....dF.......G.......F.....D....Y.....R...AA..T.......................Q...F...W.R..N.KV.......LEVA....K.DF..................................P...E...............-.........YT.....FA..................................VADEE..........DF.AT...EV....K....D....L....G....L....S......E....sG...........E........D....V....N....A..A.I.LD--E...G....G......R.KF..A...M...E...PD...D....F.DS.......DTLREFVR-a.......................................................................................
A2E4B8_TRIVA/21-120                    .......................................................................................nyrmfkkmvlnrtsd----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.-....-..-...-..--..................................-.......--.-.....-.-...-.-...-..---........................--..--...-.-....-..-....-....-...-.........-..-.........-.............-..........-........-............-............-........-........-.................-.....-.....-................-...........-......-..-...........-.....-....-.........-.....-.....-......-.......Q..........T.......W....V..V....F.......F.......Y.......D.....E....S.....N...KQ..S.......................N...I...D.Y..Q.EF.......IKVA....H.SS..................................L...D...............A.........IH.....FG..................................SVDVK..........KN.VQ...LC....E....D....L....G....V....Y......P.....E...........S........I....P....K....I..M.I.YH-HN...G....Q......T.EY..I...G...S...KK...-....-.--.......---------sekmsmkll...............................................................................
A0A6I9VB65_BACDO/523-679               ....................................................................................................dq----------------.--.......--ND......IAF.V.....K...I...D.....D...DS......................EAKE.............WGI.DE....iP.S....I..V...F..FE..................................R.......GI.P.....H.-...-.I...Y..EGD........................LM..KE...D.E....L..L....G....W..lV.........H..Q.........K.............R..........H........S............E............I........P........E.................V.....T.....D................E...........M......K..D...........K.....L....V.........E.....N.....T......-.......E..........H.......L....A..V....I.......F.......Y.......D.....K....D.....D...KQ..D.......................I...R...V.L..N.EL.......ENID....D.EL..................................E...K...............E........gIV.....IV..................................RID--..........-N.AA...EA....K....E....Y....G....L....D......-.....-...........H........L....P....A....L..I.Y.FE---...N....K......I.PA..L...Y...E...GD...L....M.NE.......DEVLEWL--........................................................................................
A0A194XQD0_9HELO/148-328               ....................................................................................................da---EDKTSNATFTAVA.EK.......LRDN......YLF.G.....A...S...N.....D...AA......................LAKA.............EGV.TA.....P.A....I..V...L..YK..................................S.......FD.E.....G.K...T.I...F..AES........................-F..DA...E.A....I..E....K....F...A.........S..T.........A.............S..........I........P............L............I........G........E.................V.....G.....P................E...........T......Y..A...........G.....Y....M.........A.....T.....G......I.......P..........-.......-....L..A....Y.......I.......F.......A.....E....T.....P...EE..R.......................E...T...L.S..T.AL.......RSVA....E.EH..................................R...G...............K.........VS.....FA..................................TIDAK..........AF.GA...HA....G....N....L....N....L....K......A.....D...........Q........F....P....A....F..A.I.QDTVN...N....K......K.YP..Y...D...Q...DA...E....I.TA.......ETIGKFVS-e.......................................................................................
A0A2C9V3A2_MANES/207-391               .........................................................................................ldslegedseela--------------AI.SK.......VHVD......VKF.Y.....Q...T...N.....-...VD......................VGNLf...........sHQI.KR.....P.S....L..V...L..LK..................................R.......EG.L.....T.P...T.Y...F..AYE.......................gQF..TR...L.A....M..G....E....F...V.........S..K.........H.............K..........L........P............S............V........I........P.................F.....T.....L................D...........N......A..Q...........R.....I....Y.........N.....N.....P......I.......K..........-.......Q....L..W....L.......F.......A.......P.....-....-.....-...QQ..F.......................Q...D...V.I..S.IF.......EEVE....K.AF..................................K...G...............K.........LL.....FV..................................HVETSkk......esYI.RN...IC....N....Q....F....G....I....T......-.....E...........V........F....P....T....V..V.A.CHKAD..fG....T......K.KF..K...Y...-...DG...E....F.SL.......SGIKSFAED........................................................................................
A0A6P8QFI6_GEOSA/301-492               ......................................................................................................FTGEQDKAYQLYQDAA.NN.......LRED......YKF.H.....H...T...F.....S...SE......................ITKF.............LSV.TP.....G.Q....L..V...V..MH..................................P.......-E.K.....F.Q...S.K...Y..EPKkhll................tfkdST..TD...S.D....L..K....E....H...V.........T..K.........C.............M..........L........P............L............V........G........H.................R.....K.....I................S...........N.....dA..K...........R.....Y....T.........K.....R.....P......L.......V..........V.......V....Y..Yt..vD.......F.......S.......F.....D....Y.....K...VA..T.......................Q...Y...W.R..S.KV.......LEVA....K.DF..................................P...E...............-.........YT.....FA..................................IANEE..........DY.SS...EL....N....D....L....G....L....G......D....sG...........E........E....V....N....V..A.I.LD--A...G....G......K.KY..A...M...E...PD...E....F.DS.......DTLRSFV--l.......................................................................................
A0A5E8AYB6_9ASCO/153-345               ......................................................................................................FEPSDKKSNSSLSAIA.RQ.......MHHQ......FSI.G.....L...S...S.....D...KA......................VFDK.............FEI.ET....lP.A....V..I...L..NL..................................K.......TA.D.....E.T...I.V...L..SDDtd...................pkfSL..DP...E.Y....I..L....G....K...A.........L..S.........A.............Q..........I........V............P............A........G........E.................I.....S.....P................E...........T......F..R...........G.....Y....M.........A.....S.....G......L.......P..........-.......L....A..Y....Y.......F.......Y.......N.....E....-.....E...AD..R.......................D...A...I.R..N.EI.......LELA....K.EV..................................K...A...............D.........LN.....IG..................................FIDAK..........AF.GA...HA....P....N....L....N....L....N......D.....K...........E........F....P....A....F..A.I.HDMKG...N....Y.....kY.PI..L...P...Q...DK...V....P.TP.......DEIIKHV--refva...................................................................................
A0A2J7PQD1_9NEOP/168-354               ......................................................................................................FDQKDVPQYTVFRKVA.TG.......LKED......CQF.Y.....V...G...F.....-...GA......................ASAQ.............MHP.PG.....Q.P....I..V...V..FR..................................Pdk...arSN.E.....Q.D...E.T...F..TAN.......................lN-..VY...D.E....L..N....S....W...V.........T..E.........K.............C..........V........P............L............V........R........E.................I.....T.....F................E...........N......A..E...........E.....L....T.........E.....E.....G......I.......P..........F.......L....I..L....F.......H.......K.......P.....E....D.....N...ES..V.......................K...K...F.N..D.VV.......RNEL....I.SE..................................K...K...............S.........VN.....FL..................................TADGV..........RF.AH...PL....H....H....L....G....K....S......Q.....S...........D........L....P....L....I..A.-.IDSFR...H....M......Y.LF..P...D...-...IN...E....M.EV......pGKLKSFLQD........................................................................................
A0A4S4DY28_CAMSI/174-359               ......................................................................................................FPEFSGEKYENFTAVA.EK.......LRSE......YEF.G.....H...T...L.....D...AK......................LLPRg...........eSSV.TG.....P.V....V..R...L..FK..................................P.......FD.E.....L.L...V.D...F..KD-........................-F..DT...D.A....L..E....E....F...V.........E..E.........A.............S..........T........P............V............V........T........L.................F.....Nk...dP................S...........Nh...pfV..I...........K.....F....F.........N.....S.....P......N.......A..........-.......K....A..M....L.......F.......L.......N.....F....S.....S...GL..V.......................D...A...F.K..S.KY.......RDVA....E.QY..................................K...G...............Q........gIS.....FL..................................LGDVE..........AS.QG...AF....Q....Y....F....G....L....K......D.....D...........Q........V....P....L....I..V.-.IQTND...G....L......K.YL..K...-...-...-P...N....V.EP.......EQISSWVKE........................................................................................
A0A6J3H5Z9_SAPAP/186-373               ......................................................................................................FQDLQDEDVATFLALA.RD.......AL-D......MTF.G.....L...T...D.....R...PQ......................LFQH.............FGL.TK.....D.T....V..V...L..FK..................................K.......FD.E.....G.R...A.D...F..PVDe.....................elGL..DL...G.D....L..S....R....F...L.........V..T.........H.............S..........M........H............L............V........T........E.................F.....N.....S................Q...........T......S..P...........K.....I....F.........A.....A.....R......I.......L..........N.......H....L..L....L.......F.......L.......N.....Q....S.....L...AA..H.......................R...E...L.L..P.GF.......GEAA....P.RF..................................R...G...............Q.........VL.....FV..................................VVDVE.........aEN.EH...VL....Q....Y....F....G....L....K......A.....E...........A........A....P....T....L..R.L.VNVET...T....K......K.YA..P...A...D...GD...P....V.TA.......ASVTAFCH-a.......................................................................................
B4MDX8_DROVI/158-343                   ......................................................................................................FKDIDSQLAKTFLKFA.DK.......NREK......YRF.G.....H...S...D.....N...EA......................VLKQ.............QG-.ET.....D.K....I..V...L..IRaph............................lsnK.......FE.S.....S.T...I.K...F..EGS........................--..SE...S.D....L..S....T....F...I.........K..D.........N.............F..........H........G............L............V........G........H.................R.....T.....Q................D...........T......S..R...........D.....F....Q.........N.....P.....L......I.......T..........A.......Y....Y..S....V.......D.......Y.......Q.....K....N.....P...KG..T.......................N...Y...W.R..N.RV.......LKVA....K.EF..................................V...G...............Q.........IN.....FA..................................ISSKD..........DF.QH...EL....N....E....Y....G....Y....D......F....vG...........D........K....P....V....V..L.A.RD--A...K....N......L.KY..A...L...-...KE...E....F.SV.......DSLKDFVEK........................................................................................
H2TSN9_TAKRU/150-297                   ...............................................................................................rvggdnm----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.-....-..-...I..YK..................................P.......VG.E.....N.V...P.D...M..VYLg......................sLA..SF...D.L....A..Y....A....W...A.........Q..D.........K.............C..........V........P............L............V........R........E.................I.....T.....F................E...........N......G..E...........E.....L....T.........E.....E.....G......L.......P..........F.......L....I..L....F.......H.......I.......N.....D....D.....T...ES..L.......................E...K...F.Q..Q.EV.......ARQL....I.SE..................................K...G...............T.........IN.....FL..................................HADCE..........KF.RH...PL....L....H....I....Q....K....S......P.....T...........D........C....P....V....I..A.-.IDSFR...H....M......Y.VF..P...D...F...KD...L....N.IP.......GKLKQFV--ld......................................................................................
A0A4U6WF02_SETVI/58-242                ................................................................................................fpafgg------SEYENFMAVA.EK.......MRND......YDF.L.....H...T...L.....D...AS......................ILPQg...........dKAV.KG.....P.V....V..R...L..FK..................................P.......FD.D.....L.F...A.D...S..QD-........................-F..DK...D.A....L..Q....K....F...I.........E..V.........S.............G..........F........P............T............V........V........N.................FdtnptN.....H................K...........Y......L..L...........K.....Y....F.........E.....N.....D......G.......T..........-.......K....A..M....L.......F.......L.......S.....F....D.....D...DR..I.......................D...A...F.K..S.QF.......YEAA....K.QY.................................dV...K...............N.........IS.....FL..................................IGDVT..........DA.QG...AF....Q....Y....F....G....L....K......E.....S...........E........V....P....L....L..F.I.QESTA...K....-......-.--..-...-...-...--...-....-.--.......---------fikptvepdqilpwlkd.......................................................................
A0A453HJU0_AEGTS/137-322               ......................................................................................................FTEFSGTEFTNFLEVA.EK.......LRSD......YDF.G.....H...T...V.....H...AN......................HLPRg...........dAAV.ER.....P.L....V..R...L..FK..................................P.......FD.E.....L.V...V.D...S..KD-........................-F..DV...S.A....L..E....K....F...I.........D..A.........S.............S..........T........P............K............V........V........T.................F.....Dk...nP................D...........Nh...pyL..L...........K.....F....F.........Q.....T.....N......A.......P..........-.......K....A..M....L.......F.......L.......N.....F....S.....T...GP..F.......................E...S...F.K..S.AY.......YGAV....E.EF..................................S...G...............K........dVK.....FL..................................IGDIE..........AS.QG...AF....Q....Y....F....G....L....K......E.....D...........Q........A....P....L....I..L.I.QDSDS...K....K......-.-F..-...L...-...KE...Q....V.EA.......GQIVAWLKD........................................................................................
A0A7F8K9F8_DELLE/159-346               ......................................................................................................FQDLQDKDVATFLALA.QD.......AL-D......MSF.G.....L...T...N.....Q...PQ......................LFQK.............FGL.TK.....D.T....V..V...L..FK..................................K.......YD.E.....G.R...A.D...F..PVDe.....................elGL..DQ...G.D....L..S....R....F...L.........L..T.........H.............S..........M........H............L............V........T........E.................F.....N.....S................Q...........T......S..R...........K.....I....F.........A.....A.....R......I.......L..........N.......H....L..L....L.......F.......V.......N.....Q....T.....L...AS..H.......................R...E...L.L..A.GF.......REAA....P.SF..................................R...G...............Q.........VL.....FV..................................VVDVG.........aSN.DH...VL....Q....Y....F....G....L....K......A.....K...........E........A....P....T....L..R.F.INIET...T....K......K.CM..P...A...D...RG...P....V.TA.......TSVAAFCH-a.......................................................................................
A0A4P1RDJ5_LUPAN/232-412               ...............................................................................................gadseel-------------ANA.SK.......LEDD......VNF.Y.....Q...T...V.....N...PD......................VAKLfh.........idPNS.KR.....P.A....L..V...L..LK..................................K.......EE.D.....K.I...N.H...F..DGQ........................-Y..VK...S.A....I..A....D....F...V.........S..S.........N.............K..........L........P............L............V........T........T.................F.....T.....R................E...........N......A..P...........S.....I....F.........E.....S.....Q......I.......K..........K.......Q....L..L....L.......F.......V.......T.....K....-.....-...KD..S.......................E...K...F.V..P.IF.......QEVA....K.VF..................................K...G...............K.........LI.....FV..................................HVEMDn........eDV.GK..pVA....D....Y....F....G....I....T......-.....G...........S........D....P....K....V..L.A.FAGND...D....G......R.KF..V...F...-...DE...E....V.SV.......DKLKAFGK-d.......................................................................................
A0A672KNU7_SINGR/159-319               ................................................................................................fslsfs----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.-F.....R.C....V..L...L..FRppr............................lnsK.......FE.E.....N.V...V.K...Y..TES........................-I..SY...S.S....L..R....T....F...I.........R..D.........N.............V..........F........G............L............C........P........H.................L.....S.....T................E...........N......R..D...........I.....L....R.........G.....S.....D......L.......L..........T.......T....Y..Y....D.......V......dY.......L.....R....N.....L...KG..T.......................N...Y...W.R..N.RI.......MKVA....T.QF..................................Q...D...............R........gLS.....FA..................................VADRQ..........EF.QD...EL....E...eE....F....G....L....G......Ss..egG...........D........I....P....L....V..T.I.RTREG...H....K......Y.SM..-...Q...E...EF...T....R.DG.......KSLERFLED........................................................................................
A0A6J1V4P6_9SAUR/249-441               ......................................................................................................FKESKDPAYQIYQDAA.NS.......LRED......YKF.Y.....H...T...F.....S...SE......................ISNF.............LKV.HS.....G.K....L..V...I..MQ..................................P.......-E.K.....F.Q...S.K...Y..EASvyil................dikeST..DV...A.E....V..K....N....H...V.........V..K.........H.............A..........L........P............L............V........G........H.................R.....K.....T................A...........N.....dA..K...........R.....Y....A.........K.....K.....P......L.......V..........I.......V....Y..Yt..vD.......F.......S.......F.....D....Y.....R...VA..T.......................Q...Y...W.R..N.KV.......LEVA....K.DF..................................P...E...............-.........YT.....FA..................................IADEE..........DY.SS...EI....K....D....L...gL....V....D......S.....G...........E........D....V....N....V..A.I.FD-EA...G....K......K.YA..M...E...-...PE...E....F.DS.......DILREFV--ls......................................................................................
G8BQ75_TETPH/165-357                   ...................................................................................................gne------GLKEKFQEIA.AK.......NNER......IVF.A.....A...I...A.....K...GG......................EGES.............MNV.Q-.....D.Y....L..A...V..YP..................................T.......GA.E.....T.P...I.I...Y..NGDve....................tlIN..NE...D.N....F..M....N....W...V.........T..F.........G.............T..........L........P............L............V........G........E.................L.....S.....E................D...........N......L..H...........L.....Y....A.........N.....L.....N......V.......P..........-.......V....A..S....F.......F.......Y.......S.....-....D.....N...VD..K.......................E...I...I.M..E.KL.......ESLA....K.EY..................................K...Y...............R.........MV.....FL..................................TTDAE..........RY.DS...SL....K....N....L....N....M....K......-.....Q...........Q........L....P....A....F..C.I.ITPHD...N....K.....aY.GF..P...Q..vD...D-...-....-.--.......---------edykkmsgryaidpkelenfiss.................................................................
A0A328DK11_9ASTE/249-428               ................................................................................................laseef-------------AAA.SK.......LEDD......INF.Y.....Q...T...D.....D...PN......................VAKLfh.........mePNV.ER.....P.T....L..V...M..LK..................................K.......EE.E.....K.V...A.L...Y..DG-........................VF..TK...S.G....I..V....A....F...V.........S..A.........N.............K..........L........P............L............V........T........P.................F.....T.....R................E...........S......G..P...........L.....I....F.........G.....S.....P......I.......K..........K.......Q....V..M....L.......F.......T.......-.....-....T.....A...DD..K.......................D...K...F.F..P.IF.......QDAA....K.FF..................................K...G...............K.........LL.....FV..................................YIEMDd........kDV.GE..pVA....E....Y....F....G....V....G......G.....D...........A........A....K....V....L..G.-.YSGND...D....A......K.KY..I...F...-...DQ...E....I.TL.......ENIKGFAA-d.......................................................................................
A0A6A5E0T6_PERFL/209-406               ..............................................................................................fethrgap----------LFTEAA.KS.......LRGE......VLT.G.....L...L...T.....-...DG......................LAEKwa.........aeHSV.DL.....P.A....V..L...V..FPs................................wR.......TH.T.....H.P...S.A...L..PVS........................-S..SA...E.E....L..L....S....H...I.........N..T.........A.............L..........L........H............P............L........P........E.................L.....T.....V................E...........N......L..P...........S.....F....L.........S.....L.....G......K.......A..........-.......L....L..L....L.......F.......V.......G.....E....E.....E...DE..F.......................G...R...R.Q..N.--.......QALV....E.EM..................................R...Gvvel......ggrrmE........pYL.....AC..................................WIHLGr.......tpAG.MS...VL....G...sY....L....G....Y....M......-.....P...........P........L....P....A....L..V.L.THLPS...G....Ge....iY.QY..P...P...-...NM...P....I.GA.......PSVLQWLQ-r.......................................................................................
A0A671XUZ4_SPAAU/153-348               ......................................................................................................FADDKSTSQAEYLKAA.SA.......LRDN......YRF.A.....H...T...N.....S...EA......................LLQS.............QGI.DG.....E.G....V..V...L..FR..................................Pprl.nnmFE.D.....S.S...V.K...F..TDE........................KY..TS...N.K....I..K....R....F...I.........Q..D.........N.............I..........F........G............I............C........P........H.................M.....T.....D................D...........N......K..D...........Q.....L....K.........G.....K.....D......L.......L..........V.......A....Y..Y....D.......V......dY.......D.....K....N.....P...KG..S.......................N...Y...W.R..N.RV.......MKVA....K.SF..................................L...Dq............gkK.........LN.....FA..................................VASKA..........AF.SH...DL....S....E....F....G....L....D......Gs...sG...........E........L....P....L....V..T.I.RT-AK...G....D......K.YA..M...A...E...EF...S....R.DG.......KALERFLQD........................................................................................
A0A444UBB6_ACIRT/633-817               ......................................................................................................FKDLEKGEAQVFYEAA.QD.......IP-D......LPF.G.....V...T...K.....N...KN......................VFSK.............YDI.TK.....N.A....V..V...L..FK..................................K.......SE.E.....K.P...V.A...Y..EMS.......................gEV..SR...D.S....L..V....R....F...I.........R..T.........F.............E..........M........D............L............V........T........E.................Y.....N.....R................E...........T......S..G...........K.....I....F.........T.....A.....L......V.......T..........S.......H....I..L....L.......F.......T.......N.....K....T.....A...DD..F.......................R...E...L.H..G.EF.......QSAA....V.EF..................................R...G...............K.........VL.....FV..................................FVDTDe........tRN.GR...IF....E....V....F....H....V....R......E.....V...........D........T....P....A....V..R.I.INLTD...N....V......Q.YQ..M...Q...-...AD...E....V.TA.......HNLRTFC--w.......................................................................................
A0A0N4YFC4_NIPBR/141-295               .....................................................................................sllqqmdktkrnvvgyv----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.-....-..-...-..-R..................................R.......DD.St...yK.N...L.H...F..TGD.......................lQ-..NY...T.Y....L..K....S....W...L.........T..D.........K.............C..........V........P............I............V........R........E.................V.....T.....F................A...........N......V..E...........G.....F....T.........E.....E.....G......V.......P..........-.......F....L..I....Y.......F.......R.......D.....A....E....kK...HE..D.......................N...I...F.I..D.AV.......MREL....P.DL..................................R...M...............T.........IN.....PL..................................LADGK..........VF.QH...PL....R....H....L....G....K....T......T.....N...........D........L....P....V....L..A.-.IDSFV...H....M......Y.LF..P...D...I...KK...L....S.EP.......GVLRQ----lhq.....................................................................................
A0A3N6QWS7_BRACR/220-367               .............................................................................lnslvgvehdqlaaaskaeddvnfy----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.-....-..-...-..--..................................-.......--.-.....-.-...-.-...-..---........................--..QT...S.G....L..V....S....F...V.........S..A.........N.............K..........L........P............L............V........T........V.................F.....T.....P................E...........S......S..Q...........E.....I....F.........E.....S.....A......I.......K..........K.......Q....L..L....L.......F.......A.......-.....-....T.....E...KG..S.......................E...K...V.L..Q.EF.......EEAA....K.SF..................................K...G...............K.........LI.....FV..................................SVDVDn........eDY.GK..pVA....E....Y....F....G....V....S......S.....S...........N........A....P....K....L..V.A.FTGNE...D....P......Q.KH..Y...F...-...DG...E....I.KS.......DNVKIF---gee.....................................................................................
A0A1X7V4D7_AMPQE/99-247                .....................................................................................qiylhnissmfigqidv----------------.--.......----......---.-.....-...S...I.....H...SD......................VART.............FRI.KA....tP.T....I..L...M..FR..................................N.......GS.-.....-.R...Y.E...F..IEE........................-L..SL...K.N....L..L....K....F...V.........L..R.........I.............M..........S........P............P............L........V........E.................V.....N....tS................S...........E......V..K...........E.....L....Q.........K.....S.....H......-.......K..........-.......-....V..L....F.......C.......L.......V.....H....D.....H...EI..H.......................E...D...W.Q..A.IY.......QQVA....Q.ER..................................I...L...............I.........GQ.....FL..................................YTT--..........-N.PD...IT....N....E....L....G....L....X......L.....S...........S........L....P....G....I..V.A.LK-DD...N....L......Y.Q-..-...-...-...--...-....-.--.......---------y.......................................................................................
A0A673IM74_9TELE/152-349               ......................................................................................................FSGEDSTELAEFLKVS.SA.......LRDS......YRF.A.....H...S...T.....D...VG......................TGLK.............YGV.DG.....E.C....V..L...L..FRpph............................lnsK.......FE.D.....N.V...V.K...Y..TES........................-I..SI...S.S....L..H....T....F...I.........R..D.........N.............V..........F........G............L............C........P........H.................L.....T.....A................E...........N......R..D...........I.....L....R.........G.....S.....D......L.......L..........T.......A....Y..Y....N.......V......dY.......L.....R....N.....L...KG..T.......................N...Y...W.R..N.RI.......MKVV....T.QF..................................Q...D...............R........gLS.....FA..................................VADRQ..........EF.QD...EL....E...eE....Fv..lG....S....S......E....gG...........D........I....P....L....V..T.I.RTREG...H....K......Y.SM..-...-...-...--...-....-.--.......---------qeeftfledyfakrlkryvk....................................................................
A0A287NRR0_HORVV/5-129                 .....................................................................................................l-------------AAA.SR.......LEYT......ASF.Y.....Q...T...T.....S...PD......................VAKLfh.........idPEA.KR.....S.S....V..V...L..LK..................................K.......EE.E.....K.L...T.V...F..DGE........................-F..RV...S.A....I..A....E....F...V.........S..A.........N.............K..........I........P............L............I........T........T.................L.....T.....Q................E...........T......A..P...........A.....I....F.........D.....N.....P......I.......K..........K.......Q....I..L....L.......F.......V.......V.....-....-.....A...KE..S.......................S...K...F.L..P.IL.......KETT....K.SF..................................K...G...............K.........VL.....--..................................-----..........--.--...--....-....-....-....-....-....-......-.....-...........-........-....-....-....-..-.-.-----...-....-......-.--..-...-...-...--...-....-.--.......---------csvdrts.................................................................................
A0A6P6KCT5_CARAU/159-343               ......................................................................................................FKDVESEDAKVFIKTA.EA.......VD-D......IPF.G.....I...T...S.....D...DA......................VISK.............FEV.AK.....D.G....V..V...L..FK..................................K.......FD.E.....G.R...N.T...F..EEE........................-I..SK...E.N....L..L....N....F...I.........K..A.........N.............Q..........L........P............L............V........I........E.................F.....T.....E................Q...........T......A..P...........K.....I....F.........G.....G.....E......I.......K..........S.......H....I..L....M.......F.......L.......P.....K....T.....A...TD..F.......................Q...D...K.M..D.QF.......KKAS....K.GF..................................K...G...............K.........IL.....FI..................................FIDSDv........dDN.QR...IL....E....F....F....G....L....K......K.....E...........E........C....P....A....I..R.L.ITLEE...E....M......T.KY..K...P...E...TS...E....I.TA.......ENIITFCTD........................................................................................
A0A4W3IEU7_CALMI/536-727               ......................................................................................................FSPNMKEAYDAFIGAA.NY.......LRGN......VVM.A.....V...Y...L.....E...KN......................ALDLs..........yrYGV.LL.....P.A....L..V...F..AR..................................H.......WT.S.....S.T...E.C...I..HIE........................KP..TT...E.E....I..V....Y....A...V.........K..N.........A.............T..........L........E............K............F........P........E.................V.....T.....V................E...........N......L..A...........V.....Y....L.........Q.....T.....Q......K.......P..........-.......L....L..I....L.......F.......I.......D.....N....D.....D...PK..T.......................T...K...A.K..E.EL......aELIK....I.KS..................................L...Q...............T.........YT.....TC..................................WIDLRn.......thVG.GE...IL....Q....V....Y....L....N....H......L.....P...........Q........L....P....V....L..V.L.VYIHS...G....G.....hV.FA..F...P...E...EQ...L....I.SR.......KDVLRWLNK........................................................................................
A0A6J2GUN4_9PASS/158-339               ...................................................................................................vgg----ESPLKEKYIEVA.SE.......LI-V......YTY.F.....F...S...A.....S...ED......................VVPE............yVTL.PE....lP.A....V..M...V..FK..................................D.......-G.T.....Y.-...F.V...Y..DE-........................-Y..ED...G.D....L..S....S....W...I.........N..R.........E.............R..........F........Q............G............Y........L........N.................V.....D.....G................F...........T......L..Y...........E.....L....G.........D.....T.....G......K.......L..........V.......A....I..A....V.......I.......D.......D.....K....N....sS...VE..H.......................T...R...L.K..S.II.......QEVA....R.DY..................................R...D...............H.........FHr...dFQ..................................FGHMD..........-G.ND...YI....N....S....L....L....M....D......D.....L...........T........I....P....T....I..V.V.LNTSN...Q....Q......Y.FL..P...D...-...RH...I....E.ST.......EDMVQFINN........................................................................................
A0A0V0V2Q5_9BILA/617-807               .................................................................................................eknvs-----NPLIEEYYTVA.KK.......LFSK......AYF.Y.....Q...I...L.....P...RH......................LPST.............FPC.DE.....T.V....C..I...F..VV..................................K.......DG.T.....Q.-...-.-...F..LYN.......................pTI..DQ...N.S....L..E....K....W...I.........Q..S.........S.............R..........W........P............F............M........Q........L.................A.....K.....Y................E...........T......L..T...........E.....Mg.ecC.........N.....D.....K......L.......L..........V.......V....A..V....L.......D.......L.......V.....E....K.....R...KL..Kspv................kqldD...L...I.R..M.TW.......QQYS....E.QL..................................K...G...............K.........FQ.....FV..................................WLDGN..........--.-E...IA....N....S....I....L....L....R......T.....V...........P........V....P....C....L..F.V.FNASS...Y....S......Y.YL..P...D...Q...DA..lQ....M.TE.......EILLQFLQN........................................................................................
A0A091TL80_PHALP/513-702               ..................................................................................................fgta----TTEAREAFEEAG.NI.......LSGH......VTM.G.....M...Y...F.....E...DDa...................laLCRK.............YAV.SP.....P.A....L..L...L..AR..................................T.......GG.R.....S.V...E.G...I..ALS........................KQ..ST...Q.D....M..V....R....M...I.........R..Y.........E.............L..........L........D............I............F........P........E.................I.....T.....V................Q...........N......L..P...........Y.....Y....L.........Q.....L.....K......K.......P..........-.......F....L..I....L.......F.......S.......-.....-....D.....G...DI..G.......................Q...M...A.S..E.EM.......LKLA....K.GR..................................P...Q...............Q........aFV.....AC..................................WLNLKk........tPV.GR..gVL....K....A....Y....F....T....T......T.....P...........S........L....P....L....L..V.W.VNLHA...G....G.....qV.FK..F...P...S...EQ...A....I.TE.......TNILSWLEK........................................................................................
A0A2I2ZH86_GORGO/303-495               ......................................................................................................FKGESDPAYQQYQDAA.NN.......LRED......YKF.H.....H...T...F.....S...TE......................IAKF.............LKV.SH.....G.Q....L..V...V..MQ..................................P.......-E.K.....F.Q...S.K...Y..EPRshvm................dvqgST..QD...S.A....I..K....D....F...V.........L..K.........Y.............A..........L........P............L............V........G........H.................R.....K.....A................S...........N.....dA..K...........R.....Y....T.........R.....R.....P......L.......V..........V.......V....Y..Y....Sv.....dF.......S.......F.....D....Y.....R...AA..T.......................Q...F...W.R..S.KV.......LEVA....K.DF..................................P...E...............-.........YT.....FA..................................IADEE..........DY.AG...EV....K....D....L....G....L....S......E....sG...........E........D....V....N....A..A.I.LD-ES...G....K......K.FA..M...E...-...PE...E....F.DS.......DTLREFVT-a.......................................................................................
A0A2A9NTT7_9AGAR/155-340               .............................................................................................lasptdvpa---------PQFSAAA.EA.......HRDD......YLF.G.....L...T...T.....D...ND......................AIKA.............AGV.TP.....P.A....V..I...V..YR..................................T.......FD.E.....S.R...S.E...Y..PYPv......................sAL..TS...D.E....L..S....D....W...L.........K..E.........L.............N..........I........P............V............I........D........E.................V.....N.....G................D...........N......Y..L...........A.....Y....A.........T.....S.....R......K.......P..........-.......L....A..Y....L.......F.......L.......D.....P....T.....S...EK..K.......................D...E...I.I..E.AI.......RPVA....S.KF..................................K...P...............K.........MN.....FV..................................WIDAV..........QF.GD...HA....K....A....L....N....L....V......E.....S...........K........W....P....S....F..V.V.QDLTK...Q....L......K.YP..F...D...Q...SK...E....V.TP.......EAVSAFVE-e.......................................................................................
A0A671EU81_RHIFE/311-428               ..................................................................................................whpk----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.-....-..-...-..--..................................-.......--.-.....-.-...-.-...-..---........................--..--...-.-....-..-....-....-...-.........-..-.........-.............-..........-........-............P............V........L........E.................L.....S.....D................S...........N......A..V...........Q.....L....N.........E.....G.....P......-.......-..........C.......L....V..L....F.......V.......D.......S.....E....D.....D...GE..S.......................E...A...A.K..Q.LI.......QPIA....E.KIiaky.........................kakeeE...A...............P.........LL.....FF..................................VAGED..........DM.TD...SL....R....D....Y....T....N....L......P.....E...........A........A....P....L....L..T.I.LDMSA...R....A......K.YV..M...D...-...VE...E....I.TP.......AIVEAFVND........................................................................................
C5XRG2_SORBI/233-413                   ...............................................................................................gahsdel-------------AAA.SR.......LEDS......INF.Y.....Q...T...L.....T...PD......................VAKLfh.........idAAT.KR.....P.S....I..V...L..LK..................................K.......EE.E.....K.L...T.F...Y..DGE........................-F..KA...S.A....I..A....D....F...V.........S..A.........N.............K..........L........P............L............V........T........T.................L.....T.....Q................E...........T......S..P...........S.....I....F.........G.....N.....P......I.......K..........K.......Q....I..L....L.......F.......A.......-.....-....I.....A...SE..S.......................S...K...F.L..P.IF.......KEAA....K.PF..................................K...G...............K.........LL.....FV..................................FVERDn........eEV.GE...PV....A...dY....F....G....I....T......G.....Q...........E........T....T....V....L..A.Y.TG-NE...D....A......K.KF..F...L...-...DG...E....V.SL.......EAIKDFAE-g.......................................................................................
A0A665W759_ECHNA/157-341               ......................................................................................................FKDLDQASIQVFYSAA.ID.......LP-D......INF.V.....V...T...Q.....N...NE......................VISK.............YGL.TH.....D.V....V..L...L..LK..................................K.......-S.E.....L.I...Q.A...Y..KMT.......................sQT..SK...E.E....L..I....I....F...I.........T..V.........Y.............Q..........M........E............P............V........T........E.................Y.....T.....G................E...........T......V..T...........Q.....I....L.........T.....S.....P......V.......L..........N.......H....A..L....L.......F.......V.......N.....K....S.....S...AD..I.......................S...E...I.Y..S.AF.......KSAA....E.AF..................................R...L...............K.........IL.....FV..................................LVNVDe........pRN.GR...LM....E....Y....F....R....V....R......D.....F...........E........A....P....L....I..R.L.VNLTD...H....V......S.YH..L...P...-...SD...T....L.DV.......DTIKTFCQ-s.......................................................................................
B9HQ95_POPTR/239-419                   ................................................................................................gpesee------------LAAA.SR.......LEDE......VSF.Y.....Q...T...V.....N...PD......................VAKLfh.........ldPQA.KR.....P.A....L..V...M..LK..................................K.......EA.E.....K.L...S.V...F..DGN........................-F..SK...S.E....I..A....E....F...V.........F..A.........N.............K..........L........P............L............V........T........I.................F.....T.....R................E...........S......A..P...........L.....I....F.........E.....S.....T......I.......K..........K.......Q....L..L....L.......F.......A.......I.....-....-.....S...ND..S.......................E...K...V.V..P.IF.......QEAA....R.LF..................................K...G...............K.........LI.....FV..................................YVEMDn........eDV.GK...PV....S...eY....F....G....I....S......-.....G...........T........A....P....K....V..L.A.YTGND...D....A......K.KF..V...F...-...DG...D....V.TL.......DKIKAF---ged.....................................................................................
G8ZQS4_TORDC/166-338                   ..................................................................................................isng----ASKLNETFYQIA.NK.......FSDE......YIF.A.....S...C...P.....-...-E......................LKSEl...........sLQL.PG....vA.E....P..I...V..FN..................................G.......-D.V.....K.K...-.-...-..-A-........................ET..DA...E.V....L..E....S....W...I.........K..V.........E.............A..........L........P............Y............F........G........E.................V.....N.....G................S...........T......F..S...........S.....Y....L.........E.....S.....G......I.......P..........-.......L....A..Y....F.......F.......Y.......T.....-....D.....D...EE..L.......................K...E...Y.A..P.FF.......TELA....K.EH..................................R...G...............K.........LN.....FA..................................SLDSR..........KF.GR...HA....E....S....L....N....M....R......-.....E...........Q........F....P....L....F..A.V.HNVTS...N....L......K.YG..L...P...-...--...-....-.--.......---------qlaqeefekltd............................................................................
R0IEZ0_9BRAS/211-396                   ......................................................................................................FEKLEGSEHDEFVKAA.KS.......DD-E......IQF.V.....E...T...S.....N...SD......................VAKLl...........fPDP.KT.....S.N....V..Fi.gM..VK..................................T.......EA.E.....R.Y...T.V...Y..DGS........................-Y..KM...E.K....I..L....E....F...L.........G..S.........N.............K..........F........P............L............I........T........K.................L.....T.....E................T...........N......T..V...........W.....V....Y.........S.....S.....P......V.......K..........L.......Q....V..M....L.......F.......S.......K.....-....-.....A...DD..F.......................Q...K...L.A..Q.PL.......EDIA....R.KF..................................K...S...............K.........LM.....FI..................................HVDITn........eNL.AM..pFL....T....L....F....G....I....E......V.....A...........N........K....T....V....V..A.A.FD-NN...L....N......S.KY..L...L...-...ES...D....P.SP.......NSIEEFCS-g.......................................................................................
E2R7L1_CANLF/309-501                   ......................................................................................................FKAESDPAYQQYQDAA.NN.......LRED......YKF.H.....H...T...F.....S...TE......................IAKF.............LKV.SS.....G.K....L..V...V..MQ..................................P.......-E.K.....F.Q...S.K...Y..EPRsnvl................diqgSA..AG...S.A....I..R....E....H...V.........L..R.........H.............T..........L........P............L............V........G........H.................R.....R.....S................A...........N.....dA..K...........R.....Y....A.........R.....R.....P......L.......V..........V.......V....Y..Y....Sv.....dF.......S.......F.....D....Y.....R...AA..T.......................Q...F...W.R..N.KV.......LEVA....K.DF..................................P...E...............-.........YT.....FA..................................VADED..........DF.AS...EV....R....D....L....G....L....S......E.....S...........G........E....D....V....N..A.A.IL-AE...G....G......R.RF..A...M...E...PD...D....F.DA.......DALREFVR-a.......................................................................................
A0A0V1M4C6_9BILA/116-304               ....................................................................................................ff--EKESKLKDSFLKVA.DL.......ERTK......FRF.G.....H...T...S.....D...KE......................ILKE.............HSV.S-.....D.D....I..I...V..FVpkk............................yhnK.......FE.D.....S.K...V.V...Y..EGN........................-F..DS...D.R....I..K....K....F...L.........N..S.........E.............I..........Y........G............L............C........G........H.................R.....Q.....V................D...........N......A..A...........S.....-....F.........A.....K.....P......L.......L..........I.......A....Y..Y....D.......V......dY.......E.....R....N.....P...KG..T.......................N...Y...F.R..N.RI.......MKVA....K.EF..................................K...R...............K.........LT.....FC..................................ISNKD..........EF.AA...EI....E....S....F....G....L....S......Dd..vdK...........Q........N....M....I....V..A.V.LD--K...D....K......R.KY..V...M...-...KD...E....F.SV.......ENLKTFVEN........................................................................................
A0A6P6Q687_CARAU/186-373               ......................................................................................................FQDLEGDKAKTFYDVT.LI.......AV-D......VDF.G.....I...T...S.....N...LE......................LFKK.............YDV.KS.....D.S....L..V...L..FK..................................K.......FD.E.....K.R...A.D...L..TLTe.....................esKL..DK...E.E....M..I....S....F...I.........H..S.........N.............S..........M........K............L............V........I........P.................F.....N.....E................E...........N......A..E...........L.....I....F.........S.....S.....K......V.......R..........N.......H....M..L....L.......F.......I.......N.....T....T.....V...ES..Q.......................N...A...L.L..E.DF.......RDVA....S.EF..................................K...G...............K.........VL.....FI..................................TLDVTs........dKV.DH...VL....K....Y....F....S....I....S......A.....N...........D........A....P....N....T..R.L.IN-TE...K....V......V.TY..A...M...E...GS...T....I.NK.......DTLRTFCQ-g.......................................................................................
A0A672ZFT1_9TELE/154-348               .....................................................................................................f-SDLHTSRLPEFLKAA.GL.......LREQ......FRF.A.....H...S...S.....N...LN......................LAKK.............YGA.NS.....D.C....V..L...L..FRppr............................lsnK.......FE.D.....S.V...V.V...F..TDY........................-L..TI...G.S....L..R....R....F...I.........R..D.........H.............I..........Y........G............L............C........P........H.................M.....T.....L................E...........N......K..D...........R.....L....R.........V.....R.....D......L.......L..........T.......A....Y..Y....D.......L......dY.......H.....R....N.....V...RG..S.......................N...Y...W.R..N.RV.......MMVA....S.KY..................................L...G...............R........gLT.....FS..................................VANKK..........DF.LA...EL....E...dD....F....G....L....G......T.....S...........Dg.....geL....P....F....V..T.I.RT-KL...G....Q......K.YT..M...R...E...EF...T....R.DG.......QSLERFLDD........................................................................................
A0A6P8XDI6_DROAB/158-343               ......................................................................................................FSDVDSKLAKTFLKFA.DK.......NREK......YRF.G.....H...S...E.....D...KD......................VLKQ.............QG-.ET.....D.K....I..V...L..IRaph............................lsnK.......FE.A.....S.T...I.K...F..EGS........................--..SE...S.D....L..T....T....F...I.........K..E.........N.............F..........H........G............L............V........G........H.................R.....T.....Q................D...........T......S..K...........D.....F....Q.........N.....P.....L......I.......T..........A.......Y....Y..S....V.......D.......Y.......Q.....K....N.....P...KG..T.......................N...Y...W.R..N.RV.......LKVA....K.EF..................................V...G...............Q.........LT.....FA..................................ISSKD..........DF.QH...EL....N....E....F....G....Y....D......F....vG...........D........K....P....V....I..L.A.RD--A...K....N......L.KY..A...L...-...KE...E....F.SV.......DNLNDFVEK........................................................................................
A0A674JMH7_TERCA/138-246               ...........................................................................................dvepfvlqtsv----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.-....-..-...-..--..................................-.......--.-.....-.-...-.-...-..---........................--..--...-.-....-..-....-....-...-.........-..-.........-.............-..........-........-............-............-........-........-.................-.....-.....-................-...........-......-..-...........K.....I....F.........D.....V.....P......V.......E..........N.......H....I..L....L.......F.......T.......P.....K....N.....S...ET..F.......................N...K...T.Y..E.DY.......RSAA....V.EF..................................R...G...............K.........IM.....FI..................................LVDTNe........tRN.GR...VF....E....Y....F....R....I....T......E.....I...........D........V....P....A....V..R.I.LNLTS...D....A......K.YK..M...P...-...AD...E....V.TV.......ENLRSFCH-s.......................................................................................
L1JWF0_GUITC/172-350                   .........................................................................avapeytgddlefrimldgrtvqedvglg----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....G.K....L..V...V..FR..................................E.......KE.A.....K.C...L.S...S..SIN........................-R..TA...E.A....L..S....H....W...I.........D..G.........H.............R..........F........P............M............L........S........K.................V.....D.....A................S...........N......Y..R...........A.....L....G.........E.....R.....N......K.......P..........L.......V....I..A....V.......L.......R.......G.....K....A.....R...PA..Gqegqaegee....ddsfesipinI...E...F.L..Q.TV.......RGLA....R.EL..................................E...D...............D.........FG.....FG..................................YLNGK..........QW.EQ...FV....V....K....F....G....I....S......T.....R...........V........L....P....R....L..L.I.IDVQK...E....H......-.--..-...-...-...--...-....-.--.......---------flpvpvdvk...............................................................................
A0A1V4KBQ7_PATFA/546-735               ....................................................................................................fs--TATIEAKEAFEEAG.NI.......LSGH......VTM.G.....M...Y...F.....E...DD......................ALALs..........rqYAV.SP.....P.A....L..L...L..AR..................................S.......GG.R.....S.V...E.G...I..ALS........................KQ..SV...Q.D....M..V....Q....M...I.........R..Y.........E.............L..........L........D............I............F........P........E.................I.....T.....V................Q...........N......L..P...........P.....Y....L.........Q.....L.....G......K.......P..........-.......F....L..I....L.......F.......S.......-.....-....D.....G...DI..S.......................Q...M...E.S..E.EM.......LKVA....K.RR..................................S...Q...............Q........vFV.....AC..................................WLNLKk........tPV.GR..gIL....K....A....Y....F....A....T......V.....P...........S........L....P....L....L..V.W.VNLHA...G....G.....qV.FK..F...P...S...EQ...S....I.TE.......MNILSWLEK........................................................................................
A0A182YNV8_ANOST/518-676               ....................................................................................................dq----------------.--.......--ND......IAF.V.....K...I...D.....D...DS......................EAKE.............WGI.EE....lP.T....M..I...L..FE..................................R.......GI.P.....H.-...-.I...Y..EGD........................LL..KE...E.E....L..L....G....W..lV.........H..Q.........K.............R..........H........S............E............I........P........E.................I.....T.....D................E...........M......K..D...........K.....L....M.........Q.....M.....Y......-.......D..........H.......V....A..I....I.......F.......Y.......D.....K....D.....D...KQ..D.......................I...R...V.L..N.EL.......ENID....D.EL..................................E...K...............E.........-E.....IV..................................IARLD..........-N.AE...EA....R....E....Y....G....L....D......-.....-...........H........L....P....A....L..V.Y.FE---...N....E......I.PA..I...Y...E...GD...L....M.NE.......EEVLEWLK-l.......................................................................................
D7G1P0_ECTSI/277-418                   ................................................................................................ednlsf----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.-....-..-...-..--..................................-.......--.-.....-.-...-.-...-..---........................--..--...-.-....-..Q....D....W...V.........V..R.........E.............S..........L........P............L............V........G........R.................L.....S.....N................A...........N......F..A...........Q.....Y....E.........R.....T.....H......L.......P..........-.......M....L..I....M.......F.......L.......E.....-....L.....P...DS..Faagsahgsr....iggksggvrnD...E...L.V..K.EL.......KEVA....L.EH..................................K...G...............S.........IT.....CL..................................YADGV..........AL.AD...SM....K....T....L....G....Lf..gS......R.....E...........R........L....P....Q....V..G.-.FNTMD...G....R......Q.LP..F...P...E...DL...P....I.NR.......ETLLHFA--aa......................................................................................
L5KH49_PTEAL/179-366                   ......................................................................................................FQDLQDEDVATFLALA.QD.......AL-D......MTF.G.....L...T...D.....R...PQ......................LFQT.............FGL.TK.....D.T....V..V...L..FK..................................K.......FD.E.....G.R...A.D...F..PVDe.....................elGL..DQ...E.D....L..S....R....F...L.........L..T.........H.............S..........M........H............L............V........T........E.................F.....N.....S................Q...........T......S..P...........K.....I....F.........A.....A.....R......I.......L..........N.......H....L..L....L.......F.......I.......N.....Q....T.....M...AP..H.......................Q...E...L.L..A.GF.......REAA....P.PF..................................R...G...............Q.........VL.....FV..................................VVDVG.........aDN.NH...VL....Q....Y....F....G....L....K......A.....E...........E........A....P....T....L..R.F.INMET...T....K......K.YT..P...A...E...RG...P....V.TA.......ASVTAFCH-a.......................................................................................
A0A668ST48_OREAU/159-343               ......................................................................................................FSGTDSPRLAEFLKAA.TL.......LREQ......FRF.A.....H...S...T.....N...--......................----.............---.-L.....Q.C....V..L...L..FRppr............................ltnA.......FE.D.....S.V...V.I...F..RDY........................-L..TI...G.S....L..R....R....F...I.........R..D.........H.............I..........Y........G............L............C........P........H.................M.....T.....I................E...........N......R..D...........R.....L....R.........V.....R.....D......L.......L..........T.......A....Y..Y....D.......L......dY.......H.....H....N.....L...PG..S.......................N...Y...W.R..N.RV.......MKVA....S.KY..................................V...G...............R........gLT.....FS..................................VANKK..........DF.LL...EL....E...eD....F....G....M....G......T.....S...........Dg.....geL....P....F....I..T.I.RTRLG...H....K......Y.-T..M...R...E...EF...T....R.DG.......ASLQRFLED........................................................................................
A0A0V0RHQ2_9BILA/645-834               ..................................................................................................knvs-----NPLIEEYYTVA.KK.......LFSK......TYF.Y.....Q...I...L.....P...RH......................LPST.............FPC.DE.....T.V....C..I...F..VV..................................K.......DG.T.....Q.-...-.-...F..LYN.......................pTI..DQ...N.S....L..E....K....W...I.........Q..S.........S.............R..........W........P............F............M........Q........L.................A.....K.....Y................E...........T......L..N...........E.....M....G.........Ec..cnD.....K......L.......L..........V.......V....A..V....L.......D.......L.......V.....E....K.....R...KL..Kspv................kqldD...L...V.R..M.TW.......QQYS....E.QL..................................K...G...............K.........FQ.....FV..................................WLDGN..........--.-E...IA....N....S....I....L....L....R......T.....V...........P........V....P....C....L..F.V.FNASS...Y....S......Y.YL..P...D...Q...DA..lQ....M.TE.......EILLQFLQN........................................................................................
A0A1R3IFE7_9ROSI/214-391               ................................................................................................vseelv--------------AA.SR.......LQDD......VKF.Y.....K...T...S.....N...PD......................VAKL.............FNI.EPla.krP.A....M..V...L..LK..................................K.......ED.E.....-.K...L.S...Y..FDG........................PF..SK...L.A....I..S....E....F...V.........S..N.........N.............K..........L........P............L............V........V........T.................L.....T.....S................Q...........T......A..K...........L.....V....F.........G.....N.....S......I.......K..........K.......H....L..L....L.......F.......A.......N.....-....-.....S...HD..S.......................E...K...I.K..A.AF.......LEAA....K.SF..................................K...G...............K.........LT.....FV..................................YVELDh.......qdTE.KR...VL....E....Y....F....S....V....S......-.....G...........D........S....P....R....V..L.A.FRYDD...D....K......K.-Y..V...M...-...NG...D....L.TF.......SNIKSFVE-e.......................................................................................
A0A672MAQ1_SINGR/160-344               ......................................................................................................FKDVESEDAKAFIKTA.EA.......VD-D......IPF.G.....I...I...S.....D...DA......................VFSK.............FEV.AK.....D.G....V..V...L..FK..................................K.......FD.E.....V.R...S.T...F..DGE........................-I..SK...E.K....L..L....T....F...I.........K..S.........N.............Q..........L........P............L............V........I........E.................F.....T.....E................Q...........T......A..P...........K.....I....F.........G.....G.....D......I.......K..........S.......H....I..L....M.......F.......V.......P.....K....T.....A...KD..F.......................Q...D...K.M..D.QF.......KKAA....E.GF..................................K...G...............K.........IL.....FI..................................FIDSDv........dDN.QR...IL....E....F....F....G....L....K......K.....E...........E........C....P....A....I..R.L.ITLEE...E....M......T.KY..K...P...E...TS...E....I.TA.......ENIITFCT-a.......................................................................................
I3MEW0_ICTTR/167-350                   ......................................................................................................FEQKDSDNYRIFERVA.SI.......LHDD......CAF.L.....S...A...F.....-...GD......................VSKP.............ERY.SG.....D.N....I..I...-..YK..................................P.......PG.H.....S.A...P.D...M..VYLg......................sMT..NF...D.L....T..Y....N....W...I.........Q..D.........K.............C..........V........P............L............V........R........E.................I.....T.....F................E...........N......G..E...........E.....L....T.........E.....E.....G......L.......P..........F.......L....I..L....F.......H.......M.......K.....E....D.....T...ES..L.......................E...I...F.Q..T.EV.......ARQL....I.SE..................................K...G...............T.........IN.....FL..................................HADCD..........KF.RH...PL....L....H....I....Q....K....T......P.....A...........D........C....P....V....I..A.-.IDSFR...H....M......Y.VF..G...D...F...QD...V....L.IP.......GKLKQFVFD........................................................................................
A0A674GVV9_TAEGU/196-327               ......................................................................................................FQDPQSPEAEQFRLAA.GQ.......LP-E......VPF.G.....L...S...S.....S...AA......................VLSH.............YGA.AE.....N.T....V..S...L..FR..................................T.......VD.S.....D.R...R.D...L..DMNn......................rEV..DA...K.D....L..T....R....F...V.........R..T.........N.............E..........L........R............L............V........T........E.................Y.....N.....P................V...........T......S..I...........G.....V....M.........Q.....S.....S......L.......Q..........F.......N....L..L....L.......I.......T.......D.....K....M.....S...PK..H.......................P...E...R.M..R.KF.......RAAA....E.LY..................................K...G...............K.........F-.....--..................................-----..........--.--...--....-....-....-....-....-....-......-.....-...........-........-....-....-....-..-.-.-----...-....-......-.--..-...-...-...--...-....-.--.......---------csp.....................................................................................
A0A7N6C428_ANATE/193-379               ......................................................................................................FDDLESDAAKVFKEVS.FD.......MA-D......TEF.A.....V...T...A.....T...PE......................VFQK.............YEV.KD.....D.S....V..V...L..FK..................................K.......FD.D.....G.R...A.D...F..ALSe.....................dgKL..DK...S.N....L..T....K....F...I.........K..E.........S.............S..........L........E............L............L........I........K.................F.....S.....A................E...........T......S..D...........K.....I....F.........T.....S.....S......I.......H..........L.......H....S..L....L.......F.......I.......N.....S....T.....V...ES..Q.......................T...T...L.V..E.EV.......RTVA....K.EF..................................K...G...............K.........ML.....FI..................................VIDVT.........eAL.SH...VL....D....Y....F....G....V....S......E.....K...........D........D....P....T....A..R.I.INMDT...G....K......K.FN..I...A...-...TQ...E....L.TA.......DSLRQLCQE........................................................................................
B3RSE4_TRIAD/134-321                   .....................................................................................................f-AQ-EDDLSKAFLKSA.NS.......MRDT......HRF.A.....H...T...S.....E...TE......................LMDK.............YGY.R-.....S.A....V..V...L..FRspl............................lksK.......FE.E.....Q.R...V.K...Y..SGA........................-A..SV...D.D....L..K....D....F...Y.........R..K.........N.............S..........L........G............L............A........G........V.................M.....T.....D................N...........N......K..D...........Q.....-....F.........E.....K.....P......L.......V..........I.......A....F..Y....D.......V......dY.......V.....K....N.....P...KG..T.......................N...Y...Y.R..N.RI.......MKIA....K.EM..................................S...Ag............gvK.........LN.....YA..................................IANKD..........EF.PQ...DI....E....Q....F....G....A....S......S.....S...........D........D....M....V....I..G.V.RD-ES...G....K......-.KF..A...M...-...SD...S....F.SM.......ENFKEFLTK........................................................................................
A0A0K6FVD9_9AGAM/152-338               ....................................................................................................vd--SDSDNLAKAIQAVA.ED.......HRDD......YLF.G.....L...T...T.....D...AE......................AIKE.............AGV.TA.....P.A....L..V...V..YK..................................T.......FD.E.....G.R...V.D...L..PTAs.....................vkSA..TS...D.S....L..V....S....F...I.........K..E.........N.............S..........V........P............L............L........D........E.................I.....S.....G................E...........N......Y..A...........N.....Y....A.........Q.....S.....G......L.......P..........-.......L....A..Y....L.......F.......I.......D.....P....T.....Q...PD..R.......................E...A...K.I..A.EF.......TPVA....K.KF..................................K...G...............K.........VN.....FV..................................WIDAV..........KY.AE...HG....K....A....M....N....L....L......E.....A...........K........W....P....A....F..V.-.VDDMA...N....S......L.KY..P...H..dQ...SG...E....L.TA.......ASVTTLV--ds......................................................................................
A0A0K0EKT9_STRER/152-340               ....................................................................................................ff--ETDSKLKDSFLKVA.DT.......ERDR......FRF.A.....H...T...S.....D...KK......................LLEK.............LGY.T-.....D.D....I..V...V..ITpkk............................lqnK.......FE.S.....Y.E...H.K...Y..DGN........................-Y..DT...D.K....I..K....T....F...L.........V..H.........E.............S..........T........G............L............A........G........I.................R.....T.....Q................G...........N......L..F...........Q.....F....T.........R.....R.....P......L.......F..........V.......V....Y..Y....N.......V......dY.......V.....K....D.....P...KG..S.......................Q...Y...W.R..N.RV.......LKVA....Q.DF..................................K...R...............K.........AY.....FS..................................VSSKE..........EF.GE...EI....D....S....V....G....Lg.erK......E.....S...........D........K....P....I....V..A.A.LT--K...D....G......-.KF..P...M...-...EA...E....F.SV.......DNLKKFVQ-s.......................................................................................
C5LZ44_PERM5/155-330                   ..................................................................................................vyeg-----PEASTDFEEIA.AR.......KRTE......FTF.Y.....H...V...A.....-...--......................----.............VDT.EK.....P.T....V..S...V..QH..................................K.......-S.E.....E.P...V.A...C..DDL........................--..TF...D.G....L..K....K....C...L.........D..D.........N.............T..........L........P............L............F........G........V.................L.....D.....G................E...........T......Y..E...........K.....Y....M.........T.....S.....G......K.......G..........-.......L....V..W....A.......C.......L.......E.....M....E.....S...SD..Dle..................kvaD...E...Y.R..P.LI.......KEVA....E.EF..................................K...D...............Q.........FA.....FL..................................YIDTI..........QF.KR...FL....E...gV....L....G....V....T......-.....-...........E........L....P....T....L..A.-.VNKKA..gD....K......L.KY..L...Y...-...TG...E....M.TA.......PKVDEFLKN........................................................................................
W7LHM7_GIBM7/155-336                   ..................................................................................................lnad----DKSSNETFSKLA.EG.......LRDT......YLF.G.....G...V...N.....D...AA......................VAEA.............EGV.KA.....P.A....L..V...V..YK..................................S.......FD.E.....G.K...N.T...F..TEK........................-F..EE...D.A....I..A....S....F...I.........T..T.........S.............A..........T........P............L............I........G........E.................V.....G.....P................E...........T......Y..S...........S.....Y....M.........S.....A.....G......I.......P..........-.......-....L..A....Y.......I.......F.......S.....E....T.....P...EE..R.......................K...E...L.G..D.AL.......KPIA....E.KF..................................K...G...............K.........IN.....FA..................................TIDAK..........AF.GA...HA....G....N....L....N....L....K......A.....D...........K........F....P....S....F..A.I.QEVVK...N....Q......K.FP..F...D...Q...EK...E....I.TH.......DNIAKFVED........................................................................................
A0A2U1L2R7_ARTAN/177-363               ....................................................................................................fp--ELKGEDFVKFWTLA.EK.......LRSD......YDF.G.....H...T...T.....N...AK......................LIPRg...........dSSV.TK.....S.T....L..R...L..LK..................................P.......FD.E.....L.F...V.D...F..QK-........................-F..EV...E.D....M..E....K....F...I.........D..E.........A.............S..........T........P............L............V........T........L.................F.....D.....Q................Kd........pnNq...pfV..S...........K.....Y....F.........D.....S.....S......D.......S..........-.......K....V..M....L.......F.......V.......D.....Y....S.....H...EQ..S.......................D...K...F.K..S.VY.......HEVA....S.QY..................................K...G...............K........gLV.....FL..................................IGHVP..........DS.QG...AL....Q....F....F....G....L....K......E.....E...........Q........T....P....V....I..I.V.QD--T...E....G......L.KF..I...N...-...-Q...N....V.QA.......DHIASWLKD........................................................................................
L8YAU6_TUPCH/174-369                   ......................................................................................................FQDLFSEEHAEFLKAA.SN.......LRDN......YRF.A.....H...T...N.....I...ES......................LVNE.............YDD.NG.....K.G....I..T...L..FRpsh............................lanK.......FE.D.....K.T...V.A...Y..KEQ........................KM..TS...G.K....I..K....K....F...I.........Q..E.........N.............I..........F........G............I............C........P........H.................M.....T.....E................D...........N......K..D...........L.....I....Q.........G.....K.....D......L.......L..........T.......A....Y..Y....E.......V......dY.......E.....K....N.....A...KG..S.......................N...Y...W.R..N.RV.......MMVA....K.KF..................................L...Da............ghK.........LN.....FA..................................VASRK..........TF.SH...EL....S....D....F....G....L....E......St...tG...........E........I....P....V....V..A.-.IRTAK...G....E......K.FV..M...Q...E...EF...S....R.DG.......KALERFLQD........................................................................................
A0A446WFD2_TRITD/109-283               ................................................................................................aeygar----------------.--.......YKKKa....wFST.A.....N...D...F.....S...ED......................LMAV.............YDF.DK....iP.A....L..V...S..LN..................................P.......KY.N.....E.Q...S.V...F..YGP........................-F..EG...T.F....L..E....D....F...I.........R..Q.........S.............L..........L........P............I............T........V........P.................I.....N.....E................E...........T......V..K...........M.....L....K.........D.....D.....D......R.......K..........V.......V....L..A....I.......L.......Q.......D.....E....S.....D...ET..S.......................M...Q...L.I..K.VL.......RSAA....N.AN..................................H...D...............-.........LV.....FG..................................YVGVN..........QW.EE...FT....E....P....F...hD....S....K......S.....S...........Q........L....P....K....L..V.V.WD-KD...E....E......Y.--..-...-...-...--...-....-.--.......---------evveglesleegdhgsqisrf...................................................................
A0A2P5WEI2_GOSBA/170-353               ....................................................................................emvishlaikykrkawfs--------------VA.KD.......FSGD......AMV.L.....Y...D...F.....D...KVp...................alVV--.............FHP.NY....nQ.Q....S..V...F..YG..................................P.......FE.DicfwlH.K...E.K...L..SYSs.....................csND..AD...E.F....L..G....D....F...I.........K..Q.........N.............L..........I........P............L............A........V........P.................M.....N.....R................E...........T......L..K...........L.....L....S.........D.....D.....D......R.......K..........I.......V....L..T....I.......M.......E.......D.....E....N.....E...EK..S.......................Q...K...L.I..K.-L.......LKAA....A.SA..................................N...R...............D.........LV.....FG..................................YVGVK..........QW.DE...FA....N....T....F....G....A....N......E....dT...........N........F....P....K....L..I.I.WNGDE...Q....Y......F.T-..-...-...-...--...-....-.--.......---------flml....................................................................................
U3IT25_ANAPP/314-505                   .....................................................................................................f-SGETDKAYQLYQEAA.NG.......LRED......YKF.H.....H...T...F.....S...NE......................IAKL.............LKA.SP.....G.K....L..V...V..MQ..................................Pe....kfQS.K.....H.E...P.K...M..HVLdl....................kdST..DG...S.E....I..K....E....H...V.........L..K.........H.............A..........L........P............L............V........G........H.................R.....K.....P................S...........N.....dV..K...........R.....Y....T.........K.....R.....P......L.......V..........V.......V....Y..Yt..vD.......F.......S.......F.....D....Y.....R...VA..T.......................Q...Y...W.R..G.KV.......LEVA....K.DF..................................P...E...............-.........YV.....FA..................................VSDEE..........DY.SS...EI....K....D....L....G....L....L......E....sG...........E........D....V....N....V..A.I.LD--E...G....G......K.KY..A...M...E...PE...E....F.DS.......DVLRQFV--l.......................................................................................
A0A6J0XPB9_ODOVR/313-505               ......................................................................................................FKSESDPAYQLYQDAA.NS.......LRED......YKF.H.....H...T...F.....S...TE......................IAKF.............LKV.SL.....G.K....L..V...V..MQ..................................P.......-E.K.....F.Q...S.K...Y..EPKsyvm................dikdST..EA...A.A....I..A....E....H...V.........V..K.........H.............T..........L........P............L............V........G........H.................R.....K.....A................A...........N.....dA..K...........R.....Y....A.........R.....R.....P......L.......V..........V.......V....YygV....D.......F.......S.......F.....D....Y.....R...AA..T.......................Q...F...W.R..N.KV.......LEVA....K.DF..................................P...E...............-.........YT.....FA..................................VADEE..........DF.AT...EV....K....D....L....G....L....S......E.....S...........G........E....E....V....N..A.A.VL-DE...G....G......R.RF..A...M...E...PD...D....F.DA.......DALRDFVT-a.......................................................................................
A0A6I9PKZ0_9TELE/555-754               ................................................................................................fktqlh------TGVSLFTEAA.KS.......LRGE......MLT.G.....L...L...T.....-...NG......................LAEKwa.........aeHSM.-E....lP.A....V..L...V..FP..................................S.......WR.T.....H.T...P.P...S..TLP.......................vST..SS...E.E....L..L....T....H...I.........H..S.........A.............L..........L........H............P............L........P........E.................L.....T.....V................E...........N......L..P...........S.....F....L.........S.....L.....G......K.......A..........-.......L....L..L....L.......F.......V.......G.....E....E.....E...DE..-.......................-...I...G.R..K.QN.......QALV....E.EM..................................R...Gvvevg.....ggrmeQ.........YL.....AC..................................WIHLGr.......tpAG.MS...VL....G....S....Y....L....G....T......M.....P...........P........L....P....A....L..V.L.THLPS...G....De....iY.QF..P...P...-...NT...P....I.VA.......SSVLQWLQ-r.......................................................................................
A0A1S3BAI2_CUCME/175-359               .....................................................................................................f-PHFSGEEFENYTILA.KK.......LRPT......EEF.F.....H...T...S.....D...AK......................LLPWg...........eSSV.PS.....P.L....M..K...V..FK..................................P.......FD.E.....L.F...V.D...T..QD-........................-F..DV...N.A....L..E....K....F...V.........E..E.........S.............I..........V........P............T............V........T........I.................M.....Dg...dQ................R...........Nq...rlV..D...........N.....F....M.........Y.....N.....S......N.......S..........-.......K....V..M....L.......F.......I.......N.....F....S.....S...EV..A.......................A...S...F.K..Y.KY.......HELA....E.LY..................................K...G..............nN.........LS.....FL..................................MADIG..........VS.SH...AT....K....Q....Y....G....I....K......D.....D...........Q........I....P....F....V..I.L.LS---...D....G......T.KY..L...-...-...KS...N....V.EP.......DELSPWLKK........................................................................................
A0A0V0SLZ7_9BILA/173-258               ......................................................................................................FKDENANELAVFKEVA.DT.......FD-N......VKF.A.....Y...T...S.....N...PD......................VYKA.............YKI.QK.....D.G....I..Y...V..IK..................................V.......AD.D.....-.T...E.M...Y..KGN........................-G..TI...E.D....I..R....S....W...I.........V..M.........N.............S..........L........P............L............V........P........T.................Y.....G.....A................K...........K......A..-...........-.....-....-.........-.....-.....-......-.......-..........-.......-....-..-....-.......-.......-.......-.....-....-.....-...--..-.......................-...-...-.-..-.--.......----....-.--..................................-...-...............-.........--.....--..................................-----..........--.--...--....-....-....-....-....-....-......-.....-...........-........-....-....-....-..-.-.-----...-....-......-.--..-...-...-...--...-....-.--.......---------aa......................................................................................
A0A6J2A9A2_ACIJB/225-406               ...................................................................................................igg----ESPLKEKYIDAA.SE.......LI-V......YTY.F.....F...S...A.....S...ED......................VVPE............yVIL.KE....mP.A....V..L...V..FK..................................D.......-E.T.....Y.-...F.V...Y..DE-........................-Y..ED...G.D....L..S....S....W...I.........N..R.........E.............R..........F........Q............N............Y........L........T.................M.....D.....G................F...........L......L..Y...........E.....L....G.........D.....T.....G......K.......L..........V.......A....I..A....V.......I.......D.......E.....K....N....tS...NE..H.......................T...R...L.K..S.II.......QEVA....R.DY..................................R...D...............Q.........FHr...dFQ..................................FGHMD..........-G.ND...YI....N....T....L....L....M....D......E.....L...........K........V....P....T....V..V.V.LNTSN...Q....Q......Y.FL..L...D...-...RQ...I....G.SA.......EDMAHFIRD........................................................................................
A0A1R2ALJ5_9CILI/150-327               ...................................................................................................sld-------YVEDFRKLA.RE.......YKST.....hVYL.G.....T...C...H.....V...GE......................VAYR.............ENI.KK.....S.D....L..P...I..IK..................................Q.......LG.N.....-.D...A.A...Y..QFNi.....................tkPL..TL...E.K....M..K....N....F...I.........E..A.........H.............K..........C........T............M............K........L........E.................I.....T.....S................S...........Y......L..H...........D.....A....L.........D....cF.....K......D.......K..........I.......V....G..I....S.......F.......V.......N.....S....L.....S...PA..Y.......................S...K...P.G..H.-T.......NMLM....Y.GY..................................R...G...............Kne.....trFQ.....FA..................................FVDTD..........KY.PQ...LM....D....Y....F....G....V....K......E.....A...........T........T....F....V....V..A.-.-DYRK...G....A......A.VF..R...Y...-...F-...-....-.--.......---------rnfnlrd.................................................................................
A0A2H5PB57_CITUN/187-371               ..........................................................................................flhdlegmesee------------LAAA.SK.......LHSD......VNF.Y.....Q...T...T.....S...AD......................VAEFfh.........ihPKS.KR.....P.A....L..I...F..LH..................................L.......EA.G.....K.A...T.P...F..RHQ........................-F..TR...L.A....I..A....N....F...V.........T..H.........T.............K..........H........P............L............V........V........T.................L.....T.....I................H...........N......A..Q...........F.....V....F.........Q.....D.....P......R.......K..........-.......Q....L..W....L.......F.......A.......P.....-....-.....A...YG..S.......................D...K...V.I..L.TF.......EEVA....K.AL..................................K...G...............K.........LL.....HV..................................YVEMNs.......egVG.RR...VS....Q....E....F....G....V....S......-.....G...........N........A....P....R....V..I.A.YS-AR...D....A......K.KY..V...L...-...NG...E....L.TL.......SSIKSF---gee.....................................................................................
A0A6J0BF84_NEOLC/167-353               ......................................................................................................FDRKDVPEYQMFRRVA.TN.......LKDD......CQF.H.....V...G...F.....-...GS......................ASAA.............MHP.PG.....Q.P....I..I...V..FRsd..............................kaL.......SN.D.....D.D...E.T...Y..KGS........................MT..TF...D.E....L..N....I....W...A.........Q..E.........K.............C..........V........P............L............V........R........E.................I.....T.....F................E...........N......A..E...........E.....L....T.........E.....E.....G......L.......P..........F.......L....I..L....F.......H.......K.......P.....D....D.....T...ES..V.......................K...A...Y.K..D.II.......SGSL....I.DE..................................K...Q...............S.........IN.....FL..................................TADGL..........KF.AH...PL....H....H....L....G....K....S......T.....S...........D........L....P....L....I..A.-.IDSFR...H....M......Y.LF..P...N...F...QD...I....F.QP.......GKLKSFLQD........................................................................................
A0A2K6EEW0_PROCO/311-503               ......................................................................................................FEGESDPAYQQYQDAA.NN.......LRED......YKF.H.....H...T...F.....S...TE......................IAKF.............LKV.SP.....G.K....L..V...V..MQ..................................P.......-E.K.....F.Q...S.K...Y..EPRsnvm................diqgST..EG...A.A....I..K....D....Y...V.........V..K.........H.............A..........L........P............L............V........G........H.................R.....K.....T................S...........N.....dA..K...........R.....Y....S.........R.....R.....P......L.......V..........V.......V....YygV....D.......F.......S.......F.....D....Y.....R...AA..T.......................Q...F...W.R..N.KV.......LEVA....K.DF..................................P...E...............-.........YT.....FA..................................IADEE..........DY.AT...EV....K....D....L....G....L....S......E....sG...........E........D....V....N....A..A.I.LD-ES...G....K......K.FA..M...E...-...PE...E....F.DS.......DTLREFVM-a.......................................................................................
A0A2K6B708_MACNE/178-365               ......................................................................................................FQDLQDEDVATFLALA.RD.......AL-D......MTF.G.....L...T...D.....R...PR......................LFEQ.............FGL.TK.....D.T....V..V...L..FK..................................K.......FD.E.....G.R...A.D...F..PVDe.....................elGL..DL...G.D....L..S....R....F...L.........V..T.........H.............S..........M........H............L............V........T........E.................F.....N.....S................Q...........T......S..P...........K.....I....F.........A.....A.....R......I.......L..........N.......H....L..L....L.......F.......V.......N.....Q....T.....L...AA..H.......................R...E...L.L..A.GF.......GEAA....P.HF..................................R...G...............Q.........VL.....FV..................................VVDVA.........aDN.EH...VL....Q....Y....F....G....L....K......A.....E...........A........A....P....T....L..R.F.INVET...T....K......K.YA..P...V...D...GG...P....V.TA.......ASVTAFCH-a.......................................................................................
A0A6P6RHX1_CARAU/158-352               .....................................................................................................f-SGTDSSQLSEFLKGA.SL.......MRES......FRF.A.....H...T...A.....D...LE......................LGKK.............YDV.KY.....E.S....V..L...L..FRppr............................lssK.......FE.E.....S.V...V.H...H..TGP........................-L..SI...T.G....L..R....R....F...I.........R..D.........N.............I..........F........G............L............C........P........H.................L.....T.....K................E...........N......K..D...........S.....L....R.........K.....R.....D......L.......L..........T.......A....F..Y....D.......L......dY.......L.....H....N.....P...KG..S.......................N...Y...W.R..N.RV.......LKVA....T.KF..................................S...S...............Q........gLL.....FS..................................VANRN..........DF.LE...EL....E...dE....F....G....Lg.tsD......S.....T...........E........L....P....F....V..T.I.RT-RT...G....N......K.YT..M...R...E...EF...T....R.DG.......KSLENFLED........................................................................................
A0A2Y9QJG4_TRIMA/434-623               ......................................................................................................FSPTMTRAIEDFTEAG.NY.......LRGY......VIT.G.....V...Y...S.....E...ED......................VLILs..........nkYTT.TI.....P.A....L..L...L..AR..................................H.......KE.G.....K.I...E.S...I..PLA........................NT..QA...Q.D....I..V....Q....I...I.........T..N.........A.............L..........L........E............T............F........P........E.................I.....T.....V................E...........N......L..P...........T.....Y....L.........R.....L.....Q......K.......P..........-.......L....L..I....L.......F.......S.......D.....-....G.....S...IN..H.......................K...Y...E.E..V.IL.......TLIK....Q.KH..................................L...D...............S.........LT.....PC..................................WLNLKn........tPV.GR..gIL....Q...aY....F....D....P....L......-.....P...........P........L....P....L....L..V.L.VNLHS...G....G.....qV.FA..F...P...S...DQ...S....I.TE.......QNLLLWLQK........................................................................................
A0A7N8WQH6_9TELE/182-365               ......................................................................................................FKDAESDDAKAFQKAA.EA.......ID-D......IPF.A.....M...T...A.....D...DA......................VYSK.............FEV.SK.....D.S....V..L...L..FK..................................K.......FD.E.....G.R...N.T...F..DGE........................-L..TK...E.N....L..L....A....F...V.........K..A.........N.............Q..........L........P............L............V........I........E.................F.....T.....E................Q...........T......A..P...........K.....I....F.........G.....G.....D......V.......K..........S.......H....I..L....M.......F.......L.......P.....K....A.....A...SD..F.......................Q...E...K.M..D.QF.......KKAA....D.GF..................................K...G...............R.........IL.....FI..................................FIDSEv........dDN.QR...IL....E....F....F....G....L....K......K.....E...........E........C....P....A....I..R.L.ITLED...E....M......T.KY..K...P...E...SS...A....I.TA.......ESITKFC--t.......................................................................................
A0A6J2RT75_COTGO/306-498               ......................................................................................................FSSEQDAAYEIYIEAC.NA.......LRED......FVF.R.....H...S...F.....S...SE......................VAKL.............LNA.SP.....G.Q....I..I...I..TQ..................................P.......-E.R.....F.R...S.K...F..EPAshtl................svmdST..LV...T.E....V..Q....E....F...F.........K..K.........H.............V..........I........P............L............V........G........H.................R.....K.....P................A...........N.....dA..K...........R.....Y....I.........K.....R.....P......L.......V..........V.......V....Y..Yg..vD.......F.......S.......F.....-....D....fK...KA..T.......................Q...F...W.R..S.KV.......LEVA....N.DF..................................P...E...............-.........YT.....FA..................................IGDEE..........DY.AE...EL....K....S....L....G....L....S......D.....S...........G........E....E....V....N..V.G.IL-AD...G....G......K.KF..A...M...E...PE...E....F.DA.......DVLRDFVM-a.......................................................................................
B4HB66_DROPE/169-355                   ......................................................................................................FDRRDQPEYDTFRKVA.TN.......LKED......CQF.H.....V...G...F.....-...GD......................ASQA.............MHP.PG.....T.P....I..I...V..FR..................................Pdv...alSH.E.....N.D...E.T...Y..TGS.......................lQ-..NF...D.E....L..K....I....W...I.........Q..E.........K.............C..........V........P............L............V........R........E.................I.....T.....F................E...........N......A..E...........E.....L....T.........E.....E.....G......L.......P..........F.......L....I..L....F.......H.......R.......P.....D....D.....L...NS..I.......................K...D...Y.K..S.II.......ERQL....L.DE..................................K...Q...............N.........VN.....FL..................................TADGK..........RF.AH...PL....H....H....L....G....K....S......E.....D...........D........L....P....L....I..A.-.IDSFK...H....M......Y.LF..P...H...F...SD...M....Y.TP.......GKLKQFLQD........................................................................................
A0A3E2HS58_SCYLI/231-412               .....................................................................................................f-AADDKTSNTTFTTVA.EK.......LRDD......FLF.G.....A...S...N.....D...AA......................LAEA.............EGV.NF.....P.G....V..V...L..YK..................................S.......FD.E.....G.K...N.I...F..TKA........................-F..EA...E.D....I..E....S....F...T.........K..T.........A.............S..........I........P............L............I........G........E.................V.....G.....P................E...........T......Y..T...........A.....Y....M.........T.....S.....G......L.......P..........-.......-....L..A....Y.......I.......F.......A.....K....T.....Q...EE..R.......................T...E...L.S..D.AL.......RDIA....K.KY..................................Q...G...............S.........IS.....FA..................................TIDAS..........AF.GA...HA....G....N....L....N....L....K......S.....D...........V........F....P....A....F..A.I.QDTVT...N....K......K.YP..F...D...Q...EK...A....I.TA.......ESIGKFVQE........................................................................................
A0A3Q3NJ85_9TELE/159-353               .....................................................................................................f-SGADSAHLLEFLKAA.GL.......LREQ......FRF.A.....H...I...T.....D...LK......................LGAE.............YGL.DS.....E.G....V..L...L..FRppr............................lanK.......FE.E.....S.V...V.V...F..TDY........................-L..TI...G.S....L..R....R....F...I.........R..D.........H.............I..........Y........G............L............C........P........H.................M.....T.....L................E...........N......R..D...........R.....L....R.........V.....R.....D......L.......L..........T.......A....Y..Y....D.......L......dY.......Q.....H....N.....P...RG..S.......................N...Y...W.R..N.RV.......MKAA....S.KY..................................T...G...............R........gLT.....FS..................................VANKK..........DF.LS...EL....E...dD....F....G....L....D......T.....S...........Dg.....geL....P....F....V..T.I.RTKLG...H....K......Y.-T..M...R...E...EF...T....R.DG.......QSLERFLDD........................................................................................
A0A6H5GYR4_9HEMI/117-293               ..............................................................................ykeyveerkfpvltaflgsdpvrt----------------.--.......----......---.-.....-...-...-.....-...--......................----.............MHP.PG.....E.P....I..I...V..FR..................................Pdv...alSN.E.....R.D...E.T...F..KGS........................LL..NY...D.E....V..S....V....W...T.........S..E.........R.............C..........L........P............L............V........R........E.................I.....T.....F................E...........N......A..E...........E.....L....T.........E.....E.....G......L.......P..........F.......L....I..L....F.......H......rL.......G.....Q....D.....E...ET..V.......................K...R...Y.K..D.IV.......NNEL....I.SE..................................K...Q...............N.........IN.....FL..................................TADGE..........KF.AH...PL....H....H....L....G....K....S......I.....S...........D........L....P....L....I..A.-.IDSFR...H....M......Y.LF..P...D...V...KQ...M....D.VP.......GRLKQFISD........................................................................................
A0A218VDX5_9PASE/158-339               ...................................................................................................vgg----ESPLKEKYIEVA.SE.......LI-V......YTY.F.....F...S...A.....S...ED......................VLPE............yVTL.PE....lP.A....V..M...V..FK..................................D.......-G.T.....Y.-...F.V...Y..DE-........................-Y..ED...G.D....L..S....S....W...V.........N..R.........E.............R..........F........Q............G............Y........L........H.................V.....D.....G................F...........T......L..Y...........E.....L....G.........D.....T.....G......K.......L..........V.......A....I..A....V.......I.......D.......D.....K....N....sS...VE..H.......................T...R...L.K..S.II.......QEVA....R.DY..................................R...D...............H.........FHr...dFQ..................................FGHMD..........-G.ND...YI....N....S....L....L....M....D......D.....L...........T........I....P....T....I..V.V.LNTSN...Q....Q......Y.FL..P...D...-...RH...I....E.ST.......EDMVQFINN........................................................................................
A0A660KQY8_9ROSI/227-407               ................................................................................................gpesee------------LAAA.SK.......LEDD......VNF.Y.....Q...T...V.....N...PD......................VAKIfh.........vdPEA.KR.....P.A....L..V...L..LK..................................K.......-E.A.....E.K...L.S...Y..FDG........................LF..VK...S.K....L..A....E....F...V.........F..A.........N.............K..........L........P............L............V........T........T.................F.....T.....R................E...........S......A..P...........L.....I....F.........E.....S.....P......I.......K..........K.......Q....L..M....L.......F.......A.......T.....S....-.....-...ND..T.......................E...K...V.V..P.VF.......LEAS....K.SF..................................K...G...............K.........LI.....FV..................................HVEMDn........eDV.GR...PV....S...dY....F....G....V....S......-.....G...........N........D....P....K....V..I.A.YTGND...D....A......K.KF..V...L...-...DQ...E....L.TL.......DNIKAF---ged.....................................................................................
A0A484E2Z2_BRELC/164-340               .....................................................................................................v-DSKEGNARSMLEKLA.DD.......DA-R......AVY.V.....A...T...T.....N...TN......................VTED.............ANA.-V.....N.T....V..V...L..YK..................................K.......FD.E.....G.K...V.I...Y..DGD........................-F..DK...D.A....L..G....E....F...I.........K..G.........N.............S..........L........P............L............V........I........T.................F.....Q.....Q................D...........I......A..P...........T.....I....F.........G.....G.....D......M.......T..........E.......H....V..L....A.......F.......A.......D.....T....S.....E...DY..V.......................S...G...I.E..T.AL.......RSPA....K.LN..................................K...G...............K.........LL.....HV..................................IMPST..........-E.KR...IV....E....Y....F....G....L....T......D.....E...........D........M....P....T....I..M.I.VNMSG...S....M......K.KY..V...F...-...D-...-....-.--.......---------hkaddliakvt.............................................................................
A0A2K6MCY6_RHIBE/310-502               ......................................................................................................FKGESDPAYQQYQDAA.NN.......LRED......YKF.H.....H...A...F.....S...TE......................IAKF.............LKV.SQ.....G.Q....L..V...V..MQ..................................P.......-E.K.....F.Q...S.K...Y..EPRshvm................dvqgST..QD...S.A....I..K....D....F...V.........L..K.........Y.............A..........L........P............L............V........G........H.................R.....K.....A................S...........N.....eA..K...........R.....Y....T.........R.....R.....P......L.......V..........V.......V....Y..Y....Sv.....dF.......S.......F.....D....Y.....R...AA..T.......................Q...F...W.R..S.KV.......LEVA....K.DF..................................P...E...............-.........YT.....FA..................................IADEE..........DY.AG...EV....K....D....L....G....L....S......E....sG...........E........D....V....N....A..A.I.LD-ES...G....K......K.FA..M...E...-...PE...E....F.DS.......DTLREFVT-a.......................................................................................
A0A077ZC57_TRITR/81-238                ......................................................................................iasslrdecefhafir----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.Q....V..L...F..IS..................................E.......SP.N.....E.W...I.V...Y..PDN........................LL..NN...V.A....L..K....H....W...I.........H..E.........K.............C..........I........P............L............V........R........E.................I.....T.....F................Q...........N......A..E...........E.....L....T.........E.....E.....G......R.......P..........-.......F....L..I....L.......F.......Y.......S.....K....D.....N...RG.iV.......................K...T...Y.A..N.EV.......SKQL....Q.DL..................................K...S...............S.........VN.....FL..................................YADGH..........TF.AH...PL....H....H....L....G....K....S......E.....A...........D........L....P....L....L..A.-.IDSFR...H....M......Y.LF..P...S...-...IN...D....L.TV......pGKLRQFI--ld......................................................................................
A0A1J6IXH9_NICAT/206-391               ......................................................................................................FDKSEGPDYNEFTKAA.KM.......-DNE......IQF.V.....E...T...S.....N...AE......................IAKH.............LFP.NF....kP.T....N..L...F..LG..................................L.......VK.S.....E.P...E.K...Y..SEYe......................gTF..ST...E.G....I..L....Q....F...L.........D..D.........N.............K..........F........P............L............I........T........V.................L.....T.....E................L...........N......A..A...........R.....V....Y.........S.....S.....S......N.......K..........L.......Q....V..L....I.......I.......A.......-.....-....E.....P...DD..F.......................K...K...N.V..E.PL.......QDVA....R.KF..................................K...S...............Q.........IM.....FI..................................FVDIRe........dNL.AK..pFL....T....M....F....G....L....E......E.....S...........K........D....S....V....V..I.S.FNYRS...N....L......K.-Y..L...L...-...ES...D....A.TP.......TSIEDFC--sg......................................................................................
A0A6J1WSZ9_GALME/157-343               ....................................................................................................ff--EKETDLKGEFLKTA.DK.......MREE......ITF.G.....H...S...I.....V...KD......................VLAK.............AGY.K-.....D.N....V..V...L..YRpkr............................lqnK.......FE.D.....S.F...V.V...Y..SGE........................-P..ET...Y.S....L..K....A....F...I.........K..E.........N.............Y..........H........G............L............V........G........I.................R.....Q.....K................D...........N......I..P...........D.....F....G.........N.....P.....L......V.......V..........A.......Y....Y..D....V.......D.......Y.......V.....K....N.....P...KG..T.......................N...Y...W.R..N.RV.......LKVA....K.EL..................................S...E...............-.........VN.....FA..................................VSDKD..........DF.TH...EL....N....E....Y....G....I....D......Fa...kG...........D........K....P....V....V..A.G.RD-AD...G....N......K.-F..V...M...-...TE...E....F.SI.......ENLVAFTKD........................................................................................
A0A673K259_9TELE/159-343               ......................................................................................................FKDVESEDAKAFIKTA.EA.......VD-D......IPF.G.....I...T...S.....D...DA......................VISK.............FEV.AK.....D.G....V..V...L..FK..................................K.......FD.E.....G.R...N.T...F..DGE........................-I..GK...E.K....L..L....A....F...I.........K..A.........N.............Q..........L........P............L............V........I........E.................F.....T.....E................Q...........T......A..P...........K.....I....F.........G.....G.....E......I.......K..........S.......H....I..L....M.......F.......V.......P.....K....T.....A...TD..F.......................Q...D...K.M..D.QF.......KKAA....E.GF..................................K...G...............K.........IL.....FI..................................FIDSDv........dDN.QR...IL....E....F....F....G....L....K......K.....E...........E........C....P....T....I..R.L.ITLEE...E....M......T.KY..K...P...E...SS...E....I.TA.......ENIITFCTD........................................................................................
W5PSR4_SHEEP/180-365                   ......................................................................................................FQDLEEEVAELFYEMI.KD.......FP-E......LTF.G.....V...I...S.....I...RH......................STGR.............YHV.TL.....D.S....V..I...V..FK..................................K.......--.G.....R.I...V.N...R..QELi.....................ndNV..NK...Q.I....L..N....K....L...I.........K..E.........Q.............L..........T........D............L............V........I........E.................Y.....N.....T................E...........N......R..D...........L.....I....Y.........E.....L.....N......I.......L..........N.......H....M..L....L.......F.......V.......S.....K....S.....S...ES..F.......................R...V...I.M..Q.HY.......KSAS....K.IF..................................Q...N...............K.........IL.....FI..................................LVDTDv........pRN.RR...VF....K....Y....F....Q....I....T......E.....V...........D........V....P....S....I..Q.I.LNLSS...D....A......R.YK..M...P...-...FE...E....I.TY.......ANLQKF---gqs.....................................................................................
A8XBT0_CAEBR/154-342                   .....................................................................................................fFES-ESKLKDSFLKVA.DT.......ERDR......FAF.A.....H...T...S.....N...KD......................IIKK.............AGY.SD.....D.V....V..V...F..VPkk.............................lhnK.......FD.T.....N.E...F.K...Y..DGN........................-Y..DT...D.K....I..K....N....F...L.........V..H.........E.............T..........V........G............L............A........G........I.................R.....T.....Q................G...........N......L..F...........Q.....F....E.........Q.....K.....P......I.......V..........I.......V....Y..Y....N.......V......dY.......V.....K....D.....P...KG..S.......................N...Y...W.R..N.RV.......LKVA....Q.NY..................................K...R...............K.........VQ.....FA..................................VSNKE..........EF.SS...EI....Et..nG....L...gE....R....K......D.....S...........D........K....P....I....V..A.V.LT---...N....E......G.KF..P...M...-...DQ...E....F.SM.......DNLQQFVDE........................................................................................
W5N2M2_LEPOC/1-181                     .....................................................................................................g--------FQEFLSVA.SR.......LQ-T......LPF.A.....L...C...S.....E...PE......................VWQL.............YNI.TG.....D.T....V..S...I..FR..................................Q.......TD.S.....H.Q...E.N...L..QLQe.....................rmKI..DS...D.G....L..T....R....F...I.........R..T.........N.............E..........L........Y............Y............L........T........E.................Y.....N.....D................M...........T......A..V...........G.....L....F.........S.....S.....P......V.......R..........A.......H....L..L....L.......L.......A.......D.....K....R.....S...AG..F.......................A...Q...L.R..E.LL.......RALA....P.QY..................................R...G...............Q.........LL.....FV..................................LIDGAv........sSN.RR...SL....E....Y....F....G....L....K......S.....H...........D........L....P....A....V..G.L.YDTQT...D....R......K.WL..M...Q...-...AQ...E....V.TT.......EHVQEFC--ys......................................................................................
G1RPI0_NOMLE/533-711                   ......................................................................................................FSPTMKTAKEDFSEAG.NY.......LKGY......VIT.G.....I...Y...S.....E...EDv...................llLSTK.............YAA.SL.....P.A....L..L...L..AR..................................H.......TE.G.....K.I...E.S...V..PLA........................ST..HA...Q.D....I..V....Q....I...I.........T..D.........A.............L..........L........E............M............F........P........E.................I.....T.....V................E...........N......L..P...........S.....Y....F.........R.....L.....Q......K.......P..........-.......L....L..I....L.......F.......S.......D.....-....G.....S...VN..P.......................Q...Y...K.K..A.IL.......TLVK....Q.KY..................................L...D...............S.........FT.....PC..................................WLNLKn........tPV.GR..gIL....R...aY....F....D....P....L......-.....P...........P........L....P....L....L..V.L.VNLHS...G....D......-.--..-...-...-...--...-....-.--.......---------nlvlwleklee.............................................................................
A0A182GFX8_AEDAL/163-346               ......................................................................................................FKDRESAECKAFLTTA.NA.......VD-D......YPF.A.....V...T...S.....S...ED......................VYAK.............YEA.KC.....G.S....V..V...L..FK..................................H.......FD.D.....G.K...A.V...F..DGE........................-Y..TE...E.A....L..K....K....F...V.........A..A.........Q.............A..........L........P............L............I........V........D.................F.....S.....H................E...........T......A..Q...........K.....I....F.........G.....G.....E......I.......K..........N.......H....L..L....F.......F.......I.......S.....K....-.....E...AG..H.......................M...E...Y.I..E.AA.......KEVA....K.KF..................................R...E...............K.........IL.....FV..................................TIDADq........eDH.QR...IL....E....F....F....G....M....K......K.....D...........E........V....P....S....M..R.I.IHLEE...D....M......A.KY..K...P...E...TN...D....L.AA.......EKVEDFVSK........................................................................................
A0A1D6J739_MAIZE/225-409               ...................................................................................................fpe---FAGVEYENFMAVA.ER.......KRSD......YDF.F.....H...T...S.....D...AS......................ILPRg...........dVAI.KG.....P.A....V..R...L..FK..................................P.......FD.E.....L.F...V.D...S..QD-........................-F..DT...D.A....L..E....K....F...I.........E..V.........S.............G..........F........P............A............V........V........T.................F.....DadptnH................K...........F......L..E...........R.....Y....Y.........S.....T.....P......-.......S..........A.......K....A..M....L.......F.......L.......N.....F....S.....D...DR..I.......................E...A...F.K..S.QI.......QEAA....T.KF..................................S..aN...............N.........IS.....FL..................................IGDVE..........SA.DR...AF....Q....Y....F....G....L....K......E.....D...........D........V....P....L....L..F.V.IA--Q...G....G......K.YL..N...-...-...-P...T....I.DP.......DQVIPWL--kq......................................................................................
A0A1Y1VFW4_9FUNG/317-509               ..................................................................................................ysnp----NVDEIKLFISVI.NE.......LNIM.....sAKI.Y.....L...T...P.....D...EE......................LMTS.............FNI.DSg...tT.G....I..V...V..SR..................................D.......FG.R.....G.F...Y.K...Y..EGG........................-F..NS...E.E....L..K....P....W...I.........T..K.........Y.............M..........Y........P............F............V........I........E.................I.....T.....P................L...........N......S..E...........Q.....Y....L.........N.....S.....E......N.......Y..........V.......V....L..A....I.......F.......P.......T.....S....D.....T...KSviY.......................D...N...V.R..I.AS.......RAWA....A.QHevdp.........................tlrqsE...-...............K........yIHa...dFV..................................WLDGS..........KF.PK...YI....Q...sS....F....G....I....S......V.....A...........E........L....P....R....V..F.I.LNPSA...G....K......Y.Y-..-...-...-...--...-....-.--.......---------dkgvsgkylhd.............................................................................
A0A0V0TX29_9BILA/195-370               ...........................................................................................hdtasplwhsi------------KKLA.SS.......FRED......CVF.F.....A...L...L.....-...--......................---Q.............VPI.EK.....Q.K....L..L...Y..YS..................................M.......-T.A.....N.T...E.E...Y..PDS.......................lD-..NL...D.A....V..H....S....W...V.........S..N.........K.............C..........L........P............L............V........R........E.................I.....T.....F................E...........N......A..E...........E.....L....T.........E.....E.....G......L.......P..........-.......F....L..I....L.......F.......Y.......K.....P....N.....D...KD.iI.......................K...V...Y.T..D.QV.......MQQL....L.DQ..................................K...S...............S.........IN.....FL..................................YADGN..........TF.AH...PL....Q....H....L....G....K....S......I.....K...........D........L....P....V....L..A.-.IDSFR...H....M......Y.LF..P...N...I...KD...L....T.VP.......GKLKQFV--ld......................................................................................
A0A1V6RGD3_9EURO/162-343               ...................................................................................................vas---DDKTANTSFTSFA.ES.......QRDN......FLF.A.....A...S...N.....D...AA......................LAKA.............EGA.KQ.....P.S....I..V...L..YK..................................D.......FD.E.....K.K...A.V...Y..DGK........................-L..EE...E.A....I..L....E....W...V.........K..T.........A.............S..........T........P............L............V........G........E.................L.....G.....P................E...........T......Y..S...........K.....Y....M.........A.....A.....G......I.......P..........-.......-....L..A....Y.......I.......F.......A.....E....T.....P...EE..R.......................E...Q...F.A..A.DF.......RPIA....E.NY..................................R...G...............A.........IN.....IV..................................TLDAK..........LF.GA...HA....G....N....L....N....L....E......P.....E...........K........F....P....A....F..A.I.QDTTK...N....A......K.YP..Y...D...Q...NK...K....V.DA.......KDVGKFIKD........................................................................................
A0A2P4TGL8_BAMTH/73-259                ......................................................................................................FQEPESPEVSQLRLVA.AR.......IP-E......VHF.A.....L...S...S.....S...SA......................VREH.............YGV.TE.....D.T....L..T...L..FR..................................R.......AD.K.....D.R...R.D...L..NMEs......................eEI..DA...D.K....M..S....R....F...I.........R..I.........N.............E..........L........R............L............V........T........E.................Y.....N.....P................T...........T......A..V...........G.....V....L.........H.....S.....S......L.......L..........L.......N....L..L....L.......F.......T.......D.....K....K.....S...PE..H.......................P...E...R.M..R.RY.......REAA....E.LF..................................E...G...............K.........IL.....FI..................................LVDINl........kSN.EQ...VM....A....Y....F....K....L....K......K.....S...........Q........L....P....A....L..A.I.FHTPD...E....K......H.DV..L...P...-...LE...E....V.SI.......ESVKDFCN-a.......................................................................................
A0A0Q9X0P2_DROWI/733-856               .......................................................................................htlnalesiddelde----------------.--.......---A.....gIIF.V.....T...T...E.....D...TG......................VAKK.............YNV.KT....yP.R....L..V...F..FR..................................N.......R-.-.....D.P...L.H...F..TGD.......................lD-..DE...D.E....V..L....A....W...I.........T..Ddd.....tlE.............I..........P........G............K............I........E........E.................V.....N.....V................K...........M......L..D...........K.....I....L.........S.....E.....N......-.......D..........H.......V....V..V....F.......F.......Y.......A.....E....G.....D...KK..A.......................Q...K...I.L..N.EL.......ENID....-.--..................................-...-...............-.........--.....--..................................-----..........--.--...--....-....-....-....-....-....-......-.....-...........-........-....-....-....-..-.-.-----...-....-......-.--..-...-...-...--...-....-.--.......---------deceek..................................................................................
A0A6A4VRP1_AMPAM/166-346               ................................................................................................gagags-----------FLEWA.ER.......EE-S......LPC.A.....L...A...T.....T...TE......................VADK.............LDA.AD.....G.S....V..A...I..FK..................................K.......YD.E.....L.R...H.D...L..SGP........................VD..SV...D.E....L..A....A....W...V.........D..R.........L.............A..........P........P............L............L........L........R.................F.....G.....D................N...........T......A..D...........D.....V....F.........D.....S.....S......G.......D..........G.......T....L..L....L.......F.......T.......P.....A....D.....G...EL..F.......................E...E...T.T..A.VT.......RAVA....R.DH..................................R...G...............E.........ML.....FT..................................WVDVNe........kSF.SR...VL....E....F....F....G....V....K......P.....S...........D........A....P....T....V..R.V.VR-PS...D....M......T.KY..R...S...E...KG..gP....P.TR.......ESLQELV--ta......................................................................................
A0A6I8VRB8_DROPS/531-687               ....................................................................................................dq----------------.--.......--ND......IAF.V.....K...I...D.....D...DK......................EAKE.............WGI.DE....iP.S....I..V...L..FE..................................R.......GI.P.....H.-...-.I...Y..EGD........................LM..KE...D.E....L..L....G....W..lV.........H..Q.........K.............R..........Y........S............E............I........P........E.................V.....T.....D................E...........M......K..D...........K.....L....V.........E.....N.....T......-.......E..........H.......L....A..V....I.......F.......Y.......D.....K....D.....D...KQ..D.......................M...R...I.L..N.EL.......ENID....D.EL..................................E...K...............E........gIV.....IV..................................RID--..........-N.AA...EA....K....E....Y....G....L....D......-.....-...........H........L....P....A....L..I.Y.FE---...N....K......I.PA..L...Y...E...GD...L....M.NE.......DEVLEWL--........................................................................................
A0A238BT48_9BILA/16-137                .................................................................................................lgria----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.-....-..-...-..--..................................-.......--.-.....-.-...-.-...-..---........................--..--...-.-....-..-....-....-...-.........E..T.........K.............K..........K........N............L............V........T........E.................F.....V.....K................E...........S......G..S...........S.....I....F.........D.....G.....N.....eN.......T..........E.......F....A..I....L.......I.......E.......S.....K....Q.....S...DD..Y.......................D...D...Y.F..D.EF.......KKAA....E.QF..................................E...N...............K.........VR.....FI..................................YINSDi........eEN.WQ...LI....E....F....L....G....L....I......A.....E...........D........V....P....G....V..L.F.VGLKK...H....F......K.KY..R...A...E...MN...E....I.TK.......AEIISFVQ-s.......................................................................................
A0A1B8E8I2_9PEZI/153-334               ...................................................................................................vea---EDKASADIFNAIA.EA.......QRDS......FLF.G.....T...T...I.....D...AA......................LAEA.............EGV.TA.....P.A....V..V...V..YK..................................K.......FD.E.....G.K...N.T...Y..TEK........................-F..VS...E.D....I..D....A....F...I.........K..T.........S.............S..........T........P............L............V........G........E.................V.....G.....P................D...........T......Y..A...........G.....Y....M.........A.....A.....N......I.......P..........-.......-....L..A....Y.......I.......F.......A.....E....T.....P...EE..R.......................T...E...L.S..E.LL.......KPLA....E.QY..................................K...G...............I.........VN.....FA..................................TIDAK..........SF.GA...HA....G....N....L....N....L....K......A.....D...........S........F....P....A....F..A.I.QEVAK...N....Q......K.FP..F...D...Q...EK...K....I.TL.......AEITTFVK-s.......................................................................................
D7KKU1_ARALL/168-353                   ......................................................................................................FPKLSGSEFDSFMAIA.EK.......LRSE......LDF.A.....H...T...S.....D...AK......................LLPRg...........eSSV.TG.....P.V....V..R...L..FK..................................P.......FD.E.....Q.F...V.D...T..KD-........................-F..DG...E.A....L..E....K....F...V.........K..E.........S.............S..........I........P............L............I........T........V.................F.....Dk...dP................N...........Nh...pyV..I...........K.....F....F.........E.....S.....T......-.......N..........I.......K....A..M....L.......F.......M.......N.....F....T.....G...EG..A.......................E...S...L.K..S.KY.......REVA....T.SN..................................K...G...............Q........gLS.....FL..................................LGDAE..........NS.QG...AF....Q....Y....F....G....L....E......E.....S...........Q........V....P....L....I..I.-.IQTAD...D....K......K.YL..-...-...-...KT...N....V.EV.......DQIESWVKD........................................................................................
PDI52_ARATH/178-347                    ...................................................................................................lgr----------------.-K.......YKKK......AWF.A.....V...S...-.....-...KE......................VSEDtm.........vsYDF.DK....aP.A....L..V...A..NH..................................P.......TY.N.....E.H...S.V...F..YGP........................-F..ED...G.F....L..E....E....F...V.........K..Q.........S.............F..........L........P............L............I........L........P.................I.....N.....H................D...........T......L..K...........L.....L....K.........D.....D.....E......R.......K..........I.......V....L..T....I.......V.......E.......D.....E....T.....H...ES..L.......................E...K...L.Y..K.AL.......RAAA....H.AN..................................R...D...............-.........LV.....FG..................................YVGVK..........QF.EE...FV....D....S....F....H....V....D......K....kT...........N........L....P....K....I..V.V.WDGD-...-....-......-.--..-...-...-...--...-....-.--.......---------eeydqvtgietitqeedhltq...................................................................
A0A087YN41_POEFO/174-355               ...................................................................................................vga----ESPLKEKYNDAA.SE.......LI-V......YTY.F.....F...S...A.....S...EE......................ALPE............sVSL.SE....lP.A....V..V...V..FK..................................D.......--.G.....S.H...F.T...Y..DE-........................-Y..ED...G.S....L..S....S....W...V.........N..R.........E.............R..........F........Q............G............Y........L........H.................I.....D.....G................F...........T......L..Y...........E.....L....G.........E.....T.....G......K.......L..........V.......A....I..A....I.......I.......D.......E.....K....D.....P...TE..Q.......................S..gR...L.K..T.LM.......QQVA....K.EY..................................R...E...............Q.........FNr...dFQ..................................FGHMD..........-G.ND...YI....N....G....L....I....M....G......E.....V...........T........V....P....S....V..I.I.LNTSN...E....Q......-.YF..M...P...S...EL...I....E.ST.......DQLVQFIS-s.......................................................................................
A0A328D3I3_9ASTE/226-412               ..........................................................................................fldslvgsysde-----------L-ASA.AK.......LEDD......VIF.Y.....Q...T...S.....N...SD......................VAKLfh.........ldPEV.KR.....P.A....L..V...M..IK..................................T.......EA.E.....K.I...N.L...F..DGM........................-F..TK...S.A....I..S....E....F...V.........Y..E.........N.............K..........V........P............L............V........N........Y.................F.....T.....R................E...........T......A..P...........Q.....I....F.........E.....N.....P......I.......K..........K.......Q....L..I....L.......F.......T.......S.....S....-.....-...ND..S.......................D...K...F.L..S.TF.......HEAA....K.SF..................................K...G...............K.........LV.....CV..................................FVEMDn........eDF.GK..sVS....E....Y....F....G....I....T......-.....G...........D........T....P....Q....V..I.A.YTGND...D....G......R.KF..L...L...-...EG...E....L.TS.......INIKSF---gek.....................................................................................
A0A5D3AI10_GOSMU/169-354               ......................................................................................................FPKFSGEEFESYMALA.EK.......LRSD......YDF.G.....H...T...L.....D...AK......................QLPRg...........eSSV.VG.....P.L....V..R...L..FK..................................P.......FD.E.....L.V...V.D...F..KD-........................-F..KP...E.A....L..E....K....F...I.........E..E.........S.............S..........I........P............L............V........T........L.................F.....Nn...dP................S...........Nh...pfV..A...........K.....F....Y.........N.....S.....P......N.......A..........-.......K....A..M....L.......F.......A.......D.....L....S.....T...EG..F.......................D...S...L.Q..S.KY.......REVA....E.QY..................................K...G...............K........gIS.....FL..................................LGDVE..........AS.QA...AF....Q....Y....F....G....V....E......E.....S...........Q........V....P....L....I..I.-.IQSDD...G....K......K.YF..K...P...-...--...N....L.KA.......DDIAPWVKD........................................................................................
A0A5N4E2M3_CAMDR/416-605               ......................................................................................................FSPTMTTAKEEFTEAG.KH.......LKGC......VIT.G.....V...Y...S.....E...EDv...................liLSDK.............HAV.TL.....P.A....L..L...L..AR..................................H.......QE.G.....K.I...E.S...I..PLA........................NA..HV...Q.D....I..V....Q....I...I.........T..N.........A.............L..........L........E............T............F........P........E.................I.....T.....V................E...........N......L..P...........T.....Y....L.........R.....L.....K......K.......P..........-.......L....L..I....L.......F.......S.......D.....-....G.....S...IN..P.......................Q...H...K.K..A.IL.......TLVK....E.KH..................................L...D...............S.........LT.....PC..................................WLNIKn........tPV.GR..gIL....Q...vY....F....D....A....L......-.....P...........P........L....P....L....L..V.V.VNLHS...G....G.....qV.FA..F...P...S...DQ...A....V.SE.......QNLLLWLKK........................................................................................
A0A0V1NKA3_9BILA/195-370               ...........................................................................................hdtasplwhsi------------KKLA.SS.......FRED......CVF.F.....A...L...L.....-...--......................---Q.............VPI.EK.....Q.K....L..L...Y..YS..................................M.......-T.A.....N.T...E.E...Y..PDS.......................lD-..NL...D.A....V..H....S....W...V.........S..N.........K.............C..........L........P............L............V........R........E.................I.....T.....F................E...........N......A..E...........E.....L....T.........E.....E.....G......L.......P..........-.......F....L..I....L.......F.......Y.......K.....P....N.....D...KD.iI.......................K...V...Y.T..D.QV.......MQQL....L.DQ..................................K...S...............S.........IN.....FL..................................YADGN..........TF.AH...PL....Q....H....L....G....K....S......I.....K...........D........L....P....V....L..A.-.IDSFR...H....M......Y.LF..P...N...I...KD...L....T.VP.......GKLKQFV--ld......................................................................................
H2SH82_TAKRU/148-318                   ..................................................................................................atsl-------LKGNYTAAA.EE.......LIVH......TSF.F.....S...G...S.....-...RE......................VLPK............dVSL.PS....lP.S....V..V...V..FK..................................D.......--.G.....T.Y...F.T...F..NEQ........................--..QD...G.E....L..K....A....W...I.........N..R.........E.............R..........F........P............T............Y........S........K.................I.....D.....S................Y...........S......L..Y...........A.....M....G.........E.....S.....G......-.......N..........-.......-....V..S....S.......-.......-.......V.....P....A.....D...EG..E.......................R...L...W.S..E.QI.......LKVF....V.HL..................................S...L...............R........hFL.....FG..................................FME--..........-G.ND...YI....N....G....I....V....M....S......E.....V...........P........V....P....S....F..V.V.VNLAV...D....G......Y.FL..P...S...-...VT...V....E.TE.......QHLLDFLN-g.......................................................................................
A0A060SM32_PYCCI/153-337               ................................................................................................lpsptd------APAAEFSATA.NK.......HRDD......YLF.G.....L...S...T.....D...PA......................VAEA.............AGV.TP.....P.A....I..V...L..FR..................................S.......FD.E.....P.Q...T.E...F..PYPl......................aSA..TA...K.E....I..E....D....W...I.........K..E.........L.............S..........V........P............L............L........D........E.................V.....G.....A................E...........N......Y..Q...........L.....Y....A.........Q.....S.....G......K.......P..........-.......L....A..Y....L.......F.......V.......D.....P....T.....D...EK..L.......................E...E...Y.L..A.LV.......KPVA....A.KY..................................K...G...............K.........VN.....FV..................................WIDAI..........KF.GD...HA....R....A....L....N....L....N......E.....A...........K........W....P....S....F..V.L.QDLQK...Q....L......K.YP..Y...D...Q...GA...E....I.TT.......EAID-----smia....................................................................................
A0A3Q4ANH8_MOLML/292-483               ......................................................................................................FSSEQDAAYEIYIEAC.NA.......LRED......FTF.R.....H...T...F.....T...PE......................VAKL.............LKA.SL.....G.Q....I..V...I..VQ..................................P.......-E.K.....F.R...S.K...Y..EPAsrtl................tmkdST..SV...S.E....V..E....E....F...F.........K..K.........H.............V..........I........P............L............V........G........H.................R.....K.....P................S...........N.....dA..K...........R.....Y....T.........K.....R.....P......L.......V..........V.......V....YygV....D.......F.......S.......F.....D....Y.....R...KA..T.......................Q...F...W.R..S.KV.......LEVA....K.DF..................................P...E...............-.........YA.....FA..................................IADEE..........DF.AD...EL....K....S....L....G....L....S......E.....S...........G........E....E....V....N..V.G.IL-GE...G....G......K.KF..A...M...E...PE...E....L.DA.......EVLRDFV--v.......................................................................................
A0A6P7Y5C4_9AMPH/317-508               ......................................................................................................FNGEQDKAYQLYQDAA.NN.......LRED......YKF.H.....H...T...F.....S...NE......................ITKF.............LSA.SP.....G.Q....L..V...V..MQ..................................P.......-E.K.....F.Q...S.K...Y..EPKkhll................tfkdST..TD...S.D....V..K....E....H...V.........T..K.........Y.............T..........L........P............L............V........G........H.................R.....K....lS................N...........D......M..K...........R.....Y....T.........K.....R.....P......L.......V..........V.......V....YytI....D.......F.......G.......F.....D....Y.....R...VA..T.......................Q...Y...W.R..S.KV.......LEVA....K.DF..................................P...E...............-.........YT.....FT..................................IANEE..........DY.SS...EL....N....D....L....G....L....G......D....sG...........E........E....V....N....V..A.I.LD--V...G....G......K.KY..A...M...E...PD...E....F.DS.......DTLRNFV--l.......................................................................................
A0A671S0D6_9TELE/118-281               ...................................................................................................vgd----ESPLKEKYTEVA.SE.......LI-V......YTY.F.....F...S...A.....S...ED......................VLPE............sVTL.HE....lP.S....V..V...V..FK..................................D.......-G.T.....-.Y...F.T...Y..DE-........................-Y..ED...S.S....L..S....S....W...V.........N..R.........E.............R..........F........Q............S............Y........L........P.................I.....D.....G................F...........T......L..Y...........E.....L....G.........E.....T.....G......K.......L..........V.......A....I..A....V.......T.......D.......E.....K....D.....P...--..-.......................-...-...-.-..-.--.......--TE....R.SS..................................R...D...............-.........FQ.....FG..................................HMDGN..........--.-D...YI....N....S....L....I....M....G......E.....V...........S........V....P....S....I..I.I.LNTSN...E....Q......Y.FV..P...A...-...EP...V....E.DL.......QQLLQF---fss.....................................................................................
A0A179FDI1_METCM/157-337               ...................................................................................................aad----DKASNETFTTVA.EK.......LRDN......YLF.G.....G...V...N.....D...AA......................VAEA.............EGV.KF.....P.S....I..V...L..YK..................................S.......FD.E.....G.K...N.T...Y..TEK........................-F..EA...E.A....I..E....K....F...A.........K..V.........A.............A..........T........P............L............I........G........E.................V.....G.....P................E...........T......Y..A...........D.....Y....M.........S.....A.....G......I.......P..........-.......-....L..A....Y.......I.......F.......A.....E....T.....Q...EE..R.......................D...S...L.A..K.DL.......KPIA....E.EY..................................K...G...............K.........IN.....FA..................................TIDAK..........SF.GA...HA....G....N....L....N....L....K......T.....D...........K........F....P....A....F..A.I.HNIEK...N....L......K.YP..Y...D...Q...EK...K....I.TH.......DAIAKFSK-e.......................................................................................
A0A671DNB4_RHIFE/536-725               ......................................................................................................FSPTMTTAKEDFTEAG.KY.......LKGC......VIT.G.....I...Y...S.....E...ED......................VLILs..........nrYTA.TL.....P.A....L..L...L..AR..................................H.......KE.D.....K.V...E.S...L..PLA........................NT..HA...Q.D....I..V....Q....M...I.........T..N.........S.............L..........L........E............T............F........P........E.................I.....T.....V................E...........N......L..P...........T.....Y....L.........R.....L.....Q......K.......P..........-.......L....L..V....L.......F.......S.......D.....-....G.....S...IN..P.......................Q...Y...K.K..A.ML.......TLIK....E.KH..................................V...D...............S.........LT.....PC..................................WLNLKt........tPV.GR..gVL....Q...tY....F....D....V....L......-.....P...........P........L....P....L....L..V.V.VNLHS...G....G.....qV.FA..F...P...S...DQ...A....V.TE.......QNLLLWLKK........................................................................................
A0A3B1IWY6_ASTMX/158-352               ......................................................................................................FESSDSPQLVEFLKGA.NL.......MRES......FRF.A.....H...T...T.....D...LQ......................LGLK.............YNL.TS.....E.G....I..L...L..FRppr............................lasK.......FE.E.....S.V...V.S...H..TGP........................-F..SV...T.A....L..R....R....F...I.........R..D.........N.............I..........F........G............I............C........P........H.................L.....T.....K................E...........N......I..D...........Q.....L....R.........K.....R.....D......L.......L..........T.......A....Y..Y....D.......L......dY.......V.....H....N.....P...KG..S.......................N...Y...W.R..N.RV.......MKVA....S.QY..................................S...S...............R........gLL.....FS..................................VANRK..........DF.ED...EL....E...eD....Y....G....L....G......St..egS...........E........V....P....F....V..T.I.RTRLG...H....K......Y.SM..R...E...-...EF...T....R.DG.......KSLERFLED........................................................................................
A0A493TQY5_ANAPP/120-295               ..................................................................................................fkel----RNNSMEVFCETA.KD.......VP-E......MPF.G.....M...T...S.....R...ED......................VCAN.............YGI.QK.....N.T....L..V...V..FK..................................K.......VG.V.....Q.-...-.-...-..---........................--..NK...L.D....L..T....R....L...I.........K..T.........F.............T..........L........D............L............V........T........E.................Y.....N.....L................E...........T......S..V...........K.....I....F.........D.....V.....P......V.......E..........N.......H....I..L....L.......F.......I.......P.....T....N.....S...KT..F.......................N...A...T.Y..E.NY.......KSAA....M.EF..................................R...G...............K.........IT.....FV..................................LVNTNe........tRN.GR...VF....E....Y....F....R....I....R......D.....I...........D........V....P....A....V..R.I.LNLTS...N....A......K.YK..M...P...-...AD...E....V.TL.......ENLRHFCQ-s.......................................................................................
A0A5J5DMR4_9PERO/93-276                ......................................................................................................FKDADSEGAKAYEKAA.ET.......TD-D......IPF.A.....V...T...A.....D...DA......................VFAK.............FEV.SK.....D.S....V..V...L..FK..................................K.......FD.E.....G.R...N.T...F..DGE........................-L..TK...E.N....L..L....A....F...V.........K..A.........N.............Q..........L........P............L............V........I........E.................F.....T.....E................Q...........T......A..P...........K.....I....F.........G.....G.....E......I.......K..........S.......H....I..L....M.......F.......L.......P.....K....T.....A...KD..F.......................Q...D...K.M..D.QF.......KKAA....K.GF..................................K...G...............R.........IL.....FI..................................FIDSDv........dDN.QR...IL....E....F....F....G....L....K......K.....E...........E........C....P....A....I..R.L.ITLED...E....M......T.KY..R...P...E...SD...A....I.TA.......ESIISFCE-........................................................................................
A0A1S3CNJ1_CUCME/235-338               ................................................................................................gsesde------------LAAA.SR.......LEDD......VNF.Y.....Q...T...V.....D...PE......................VAKLfh.........ieASA.KR.....P.A....L..V...L..LK..................................K.......EA.E.....K.L...S.R...F..DGE........................-F..SK...S.A....I..V....E....F...V.........F..A.........N.............K..........L........P............L............V........T........T.................F.....T.....K................E...........S......A..P...........L.....I....F.........E.....S.....S......I.......K..........K.......Q....L..I....L.......F.......A.......-.....-....-.....-...--..-.......................-...-...-.-..-.--.......----....-.--..................................-...-...............-.........--.....--..................................-----..........--.--...--....-....-....-....-....-....-......-.....-...........-........-....-....-....-..-.-.-----...-....-......-.--..-...-...-...--...-....-.--.......---------isnd....................................................................................
A0A667Z3I0_9TELE/154-335               ...................................................................................................vgg----ESPLKEKYIDVA.SE.......LI-V......YTY.F.....F...S...A.....S...ED......................VLPE............tVTL.PE....lP.S....V..V...V..FK..................................D.......--.G.....A.Y...F.T...Y..DE-........................-Y..ED...G.T....L..S....S....W...V.........N..K.........E.............R..........F........Q............G............Y........L........E.................I.....D.....G................F...........T......L..Y...........E.....L....G.........E.....T.....G......K.......L..........V.......A....I..A....V.......I.......N.......E.....K....D....pT...EE..S.......................S...R...L.K..T.LI.......QRVA....K.EY..................................R...E...............H.........FNr...dFQ..................................FGHMD..........-G.ND...YI....N....S....L....I....M....G......E.....V...........T........V....P....S....V..I.I.LNTSN...E....Q......Y.-F..L...P...S...EP...T....E.TM.......EQLVQFIN-s.......................................................................................
X0CDJ3_FUSOX/155-336                   ..................................................................................................lnad----DKSSNETFSKLA.EG.......LRDT......YLF.G.....G...V...N.....D...AA......................VAEA.............EGV.KA.....P.A....L..V...V..YK..................................S.......FD.E.....G.K...N.T...F..TEK........................-F..EE...D.A....I..A....S....F...I.........T..T.........S.............A..........T........P............L............I........G........E.................V.....G.....P................E...........T......Y..A...........G.....Y....M.........S.....A.....G......I.......P..........-.......-....L..A....Y.......I.......F.......S.....E....T.....P...EE..R.......................K...E...L.G..D.AL.......KPIA....E.KF..................................K...G...............K.........IN.....FA..................................TIDAK..........AF.GA...HA....G....N....L....N....L....K......A.....D...........K........F....P....S....F..A.I.QEVVK...N....Q......K.FP..F...D...Q...EK...E....I.TH.......DNIAKFVED........................................................................................
A0A6I9UB38_SESIN/197-304               ............................................................................................mpsvnsqlyr----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.-....-..-...-..--..................................-.......--.-.....-.-...-.-...-..---........................--..--...-.-....-..-....-....-...-.........-..-.........-.............-..........-........-............-............-........-........-.................-.....-.....-................-...........-......-..K...........E.....I....V.........D.....N.....G......M.......T..........-.......W....L..L....F.......F.......Y.......T.....S....N.....L...RG..I.......................Q...Y...Y.E..S.VI.......EEVG....T.SL..................................Q...G...............A.........LK.....VG..................................SMNCE..........SD.AS...FC....K....E....L....G....V....Y......P.....R...........R........E....P....K....I..F.V.YSYAS...S....E.....kG.SL..V...E...Y...DG...D....L.DV.......KSLKSFCQD........................................................................................
A0A0E0FZQ5_ORYNI/214-404               ..............................................................................................sgahsdei-------------AAA.SR.......LEDA......INF.Y.....Q...T...S.....N...PD......................VAKLfh.........ldPAA.KR.....P.S....L..V...L..LK..................................K.......QE.E.....E.K...L.T...F..YDG........................PF..KA...S.A....I..A....D....F...V.........S..A.........N.............K..........L........P............L............V........N........T.................L.....T.....Q................E...........T......A..P...........S.....I....F.........D.....N.....P......I.......Kkqac..lidiA.......S....I..L....L.......F.......V.......V.....-....-.....A...NE..S.......................S...K...F.L..P.IF.......KEAS....K.SF..................................K...G...............K.........LL.....FV..................................FVERDn........eEV.GE..pVA....N....Y....F....G....I....T......G.....Q...........E........T....T....V....L..A.Y.TGNED...A....R......-.KF..F...L...-...DG...E....I.SV.......ENIKRFAED........................................................................................
I3KEV4_ORENI/150-335                   ...................................................................................................lve----ETSLKAEFLKAA.SA.......LRDN......YRF.A.....H...T...N.....S...EA......................LLKI.............ILF.RP.....P.Q....L..N...-..-N..................................K.......FE.D.....S.S...V.K...F..SDD........................KY..TS...N.K....I..K....R....F...I.........Q..D.........N.............I..........F........G............F............C........P........H.................M.....N.....D................N...........N......K..D...........Q.....L....K.........G.....K.....D......L.......L..........V.......A....Y..Y....D.......V......dY.......E.....K....N.....P...KG..S.......................N...Y...W.R..N.RV.......MKVA....K.GF..................................L...Dq............gkK.........LN.....FA..................................VANKN..........MF.NH...EL....S....E....F....G....L....N......P....sG...........E........L....P....V....V..A.I.RT-AK...G....D......K.YT..M...T...E...EF...S....R.DG.......KALERFLQD........................................................................................
A0A2I3SI55_PANTR/299-491               ......................................................................................................FKGESDRAYQQYQDAA.NN.......LRED......YKF.H.....H...T...F.....S...TE......................IAKF.............LKV.SQ.....G.Q....L..V...V..MQ..................................P.......-E.K.....F.Q...S.R...Y..EPRshmm................dvqgST..QD...S.A....I..K....D....F...V.........L..K.........Y.............A..........L........P............L............V........G........H.................R.....K.....A................S...........N.....dA..K...........R.....Y....T.........R.....R.....P......L.......V..........V.......V....Y..Y....Sv.....dF.......S.......F.....D....Y.....R...AA..T.......................Q...F...W.R..S.KV.......LEVA....K.DF..................................P...E...............-.........YT.....FA..................................IADEE..........DY.AG...EV....K....D....L....G....L....S......E....sG...........E........D....V....N....A..A.I.LD-ES...G....K......K.FA..M...E...-...PE...E....F.DS.......DTLREFVT-a.......................................................................................
A0A7N6A4T0_ANATE/130-312               .................................................................eedlktfvnnydasivgvfsgpdssllaeylkaavqt----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.-....H..T...R..VE..................................V.......TR.D.....S.V...V.A...F..TDY........................-L..TI...S.S....L..R....R....F...V.........R..D.........H.............I..........Y........G............L............C........P........H.................M.....T.....L................E...........N......R..D...........R.....L....R.........V.....R.....D......L.......L..........T.......A....Y..Y....D.......L......dY.......H.....H....N.....I...RG..S.......................N...Y...W.R..N.RV.......MKVV....S.KY.................................aR...R...............G.........LT.....FS..................................VANKK..........DF.LS...EL....E...dD....F....G....L....G......T.....S...........Dg.....geL....P....F....I..T.I.RSKLG...H....K......Y.-T..M...R...E...EF...T....R.DG.......RSLERFLDD........................................................................................
E2RD86_CANLF/160-355                   ......................................................................................................FQDLFSEAHSEFLKAA.SN.......LRDN......YRF.A.....H...T...N.....V...ES......................LVNK.............YDD.DG.....E.G....I..T...L..FRpsh............................lmnK.......FE.D.....K.T...V.A...Y..IEQ........................KM..TS...G.K....I..K....K....F...I.........Q..E.........N.............I..........F........G............I............C........P........H.................M.....T.....E................D...........N......K..D...........L.....I....Q.........G.....K.....D......L.......L..........V.......A....Y..Y....D.......V......dY.......E.....K....N.....A...KG..S.......................N...Y...W.R..N.RV.......MMVA....K.KF..................................L...Da............gnK.........LN.....FA..................................VASRK..........TF.SH...EL....S....D....F....G....L....E......St...aG...........E........I....P....V....V..A.-.IRTAK...G....E......K.FV..M...Q...E...EF...S....R.DG.......KALERFLQD........................................................................................
A0A3B6NIJ7_WHEAT/237-416               ................................................................................................ahsdel-------------AAA.SR.......LEDT......ISF.Y.....Q...T...T.....S...PD......................VAKLfh.........idLEA.KR.....P.S....V..V...L..LK..................................K.......EE.E.....K.L...T.V...F..DGE........................-F..RA...S.A....I..A....E....F...V.........S..A.........N.............K..........I........P............L............I........T........T.................L.....T.....Q................E...........T......A..P...........A.....I....F.........D.....N.....P......I.......K..........K.......Q....I..L....L.......F.......A.......V.....-....-.....A...KE..S.......................S...K...F.L..P.II.......KETA....K.SF..................................K...G...............K.........LL.....FV..................................FVERDn........eEV.GE..pVA....N....Y....F....G....I....T......G.....H...........E........T....T....V....L..A.Y.TG-NE...D....A......K.KF..F...F...-...SG...E....I.SL.......DTIKEFAQD........................................................................................
A0A287AX21_PIG/186-373                 ......................................................................................................FQDLQDKDVATFLAVA.QD.......AL-D......MAF.G.....L...T...D.....R...PQ......................LFQK.............FGL.TK.....D.T....V..V...L..FK..................................K.......YD.E.....G.R...A.D...F..PVDk.....................elGL..DQ...G.D....L..S....R....F...L.........L..T.........H.............S..........M........H............L............V........T........E.................F.....T.....P................Q...........T......S..P...........K.....I....F.........A.....A.....R......I.......P..........N.......H....L..L....L.......F.......I.......N.....Q....T.....L...AA..H.......................L...E...R.L..S.GF.......REAA....P.RF..................................R...G...............Q.........VL.....FV..................................VVDVG.........aNN.DH...VL....Q....Y....F....G....L....K......A.....E...........E........A....P....T....L..R.F.VNMET...T....K......K.YA..P...A...D...KE...P....V.TA.......TSVAAFCR-a.......................................................................................
A0A178EHJ9_9PLEO/150-331               .....................................................................................................f-AADDKAANETFTSVA.NG.......LRDN......FLF.G.....A...T...N.....D...AA......................LAKA.............EGV.EQ.....P.G....L..V...L..YK..................................S.......FD.D.....G.K...D.V...F..TEK........................-F..DA...D.A....I..R....E....F...A.........K..V.........A.............S..........T........P............L............I........G........E.................V.....G.....P................E...........T......Y..S...........G.....Y....M.........A.....A.....G......L.......P..........-.......-....L..A....Y.......I.......F.......A.....E....T.....A...EE..R.......................E...E...F.A..K.EL.......KPLA....L.KH..................................K...G...............A.........IN.....FA..................................TIDAK..........SF.GQ...HA....G....N....L....N....L....K......V.....G...........T........W....P....A....F..A.I.QRTDK...N....E......K.FP..Y...D...Q...EL...K....I.TE.......KEIGTFVED........................................................................................
A0A4S4L5S1_9AGAM/354-493               ............................................................................................pfrhgtgddd----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.-....-..-...-..--..................................-.......--.-.....-.-...-.-...-..---........................--..NS...D.V....L..A....E....W...L.........M..R.........H.............R..........L........P............S............V........L........A.................L.....T.....Q................D...........T......F..Q...........D.....V....M.........N.....A.....P......H.......H..........P.......L....V..V....L.......A.......A.......V.....-....A.....P...AA..E.......................A...Q...V.R..D.VM.......GTTA....R.AWrrlse.......................edglspM...R...............D.........VV.....FA..................................WMDAD..........KW.AS...WM....K...sM....Y....G....I....K......E.....T...........D........L....P....A....V..I.V.TDHHA...S....-......-.--..-...-...-...--...-....-.--.......---------shssifignkieldtdai......................................................................
A0A5F5Y659_FELCA/177-364               ......................................................................................................FQDLQDEDVATFLALA.QD.......AL-D......MTF.G.....L...T...D.....R...PK......................LFQK.............FGL.TK.....D.T....V..V...L..FK..................................K.......FD.E.....G.R...A.D...F..PVDe.....................elGL..DQ...G.D....L..S....H....F...L.........L..T.........H.............S..........M........R............L............V........T........E.................F.....N.....S................R...........T......S..P...........K.....I....F.........S.....A.....R......I.......L..........N.......H....L..L....L.......F.......V.......N.....Q....T.....L...AS..H.......................R...E...L.L..A.GF.......GEAA....P.PF..................................R...G...............Q.........VL.....FV..................................VVDVG.........aDN.GH...VL....Q....Y....F....G....L....K......A.....E...........E........A....P....T....L..R.F.INMET...T....K......K.YA..P...A...H...GG...P....L.TA.......TSVTAFCH-a.......................................................................................
A0A1V9YW66_9STRA/182-347               ...............................................................................................ediaviv----------------.--.......----......---.-.....-...-...A.....T...TD......................ASVH.............ADL.KE....aG.S....V..V...L..LK..................................K.......FD.D.....K.K...V.L...Y..DGE........................-F..TK...E.K....I..S....D....F...I.........K..E.........H.............H..........K........P............L............V........M........T.................F.....S.....Q................D...........K......A..S...........Q.....I....F.........G.....G.....E......V.......D..........V.......H....L..L....V.......F.......S.......D.....E....T.....K...DY..H.......................E...S...I.L..E.SV.......TEAA....A.VT..................................K...G...............K.........IL.....HV..................................VIPVS..........-E.SR...IV....D....Y....F....G....L....K......E.....S...........D........L....P....S....M..V.L.VNMGA...G....M......K.KY..P...F...-...--...-....-.--.......---------ptkaaelteklttadlksf.....................................................................
A0A507FPX9_9FUNG/181-377               ..................................................................................................sddv--------ITNFLKVA.ES.......VQSI......ASI.Y.....L...T...P.....D...SD......................AALKalk.......lddVSV.DE....eP.R....L..V...A..VK..................................Dg.....gMD.T.....K.V...Y.N...L..PLSpl....................kdVT..QK...K.R....V..R....T....W...I.........L..D.........N.............K..........H........P............L............V........P........S.................F.....S.....D................S...........S......S..R...........E.....I....M.........S.....S.....S......D.......S..........R.......K....V..V....V.......F.......G.......M.....F....D.....G...PH..P.......................T...N...E.L..N.AL.......RTSA....R.AYnta...........................hkdsD...T...............T.........VI.....FT..................................YIDAR.........aRF.EY...VS....K....V....Y....G....V....K......S....lE...........D........L....P....I....V..L.V.VEPKE...E....Q......I.W-..-...-...-...--...-....-.--.......---------rvdkegnalsvkd...........................................................................
A0A1S3ADE4_ERIEU/64-251                ......................................................................................................FQDLEIPAVPIFHSMV.QK.......FQ-D......VSF.G.....I...S...T.....D...PE......................VLSH.............YNI.TG.....N.T....I..V...L..FR..................................V.......VD.N.....E.Q...L.Y...L..ASEe.....................lqNI..DD...A.K....L..S....R....F...I.........E..I.........H.............S..........L........H............L............V........T........E.................Y.....N.....P................M...........S......V..I...........G.....L....F.........N.....S.....M......V.......Q..........I.......H....L..L....L.......I.......M.......N.....K....A.....S...PQ..Y.......................E...E...S.V..N.RY.......REAA....K.LF..................................Q...R...............K.........IL.....FV..................................LVDSSk........kEN.AK...VI....A....F....F....K....L....K......E.....S...........Q........L....P....A....L..A.I.YQTVD...E....E......W.DM..L...P...-...LE...D....V.SV.......EHVQSFCD-g.......................................................................................
A0A287B4Y1_PIG/128-311                 ......................................................................................................FEQKDSENYRVFERVA.KI.......LHDD......CTF.L.....S...A...F.....-...GA......................VSKP.............ERY.SG.....D.N....I..V...-..YK..................................P.......PG.H.....S.A...P.D...M..VYLg......................yMT..NF...D.G....T..F....N....W...I.........Q..D.........K.............C..........V........P............L............V........R........E.................I.....T.....F................E...........N......G..E...........E.....L....T.........E.....E.....G......L.......P..........F.......L....I..L....F.......H.......M.......K.....E....D.....T...ES..L.......................E...I...F.Q..N.EV.......ARQL....I.SE..................................K...G...............T.........IN.....FL..................................HADCD..........KF.RH...PL....L....H....I....Q....K....T......P.....A...........D........C....P....V....I..A.-.IDSFR...H....M......Y.VF..G...D...F...RD...V....L.IP.......GKLKQFVFD........................................................................................
A0A1E3HNX6_9TREE/159-334               ..................................................................................................eqyk-------------TFS.SS.......ARDS......YLF.G.....Q...Y...L.....S...PS......................LPNI.............PES.PS....lP.A....I..V...L..YK..................................D.......FD.E.....G.Y...A.V...F..PSN.......................vEP..TT...E.N....L..A....E....F...V.........K..Q.........N.............S..........I........P............L............F........D........E.................I.....S.....P................E...........N......F..G...........S.....Y....A.........E.....Q.....G......L.......P..........I.......A....Y..L....F.......A.......D.......P.....N....D.....A...AN..R.......................D...S...I.V..K.DL.......RDVA....K.SL..................................K...G...............E.........VN.....FV..................................YIDAV..........KF.VD...HG....K....S....L....N....L....P......G.....D...........S........W....P....A....F..V.I.QDLAE...Q....T......-.KY..P...L...-...TG...K....A.TA.......KTIKEFVDK........................................................................................
S0E6F9_GIBF5/145-319                   ...................................................................................................lgs---DHKPEHKTFGAVA.ER.......WRAH......YSF.G.....S...V...H.....G...LE......................----.............KDS.KG.....P.S....I..A...V..YT..................................Q.......EE.E.....D.P...A.Y...Y..RGP........................-F..TV...T.G....V..E....A....F...L.........R..D.........A.............T..........Q........P............L............I........R........E.................Y.....D.....P................I...........V......H..E...........E.....A....M.........K.....D.....E......R.......P..........L.......A....Q..I....F.......F.......S.......K.....R....-.....-...DD..R.......................A...E...L.V..K.SL.......APLA....R.KY..................................K...D...............Q.........LS.....FV..................................TVLAP..........DY.PK...RC....E....Q....M....H....L....N......K.....E...........I........K....R....G....F..A.I.AN-QQ...G....R......-.AY..P...M...S...EK...V....F.NA.......NRVA-----khva....................................................................................
A0A182XYR3_ANOST/156-341               ....................................................................................................ff--QKESDLKGVFLKYA.DS.......QRER......LRF.G.....H...S...S.....A...AE......................VLEK.............QGA.T-.....D.A....V..Y...L..FRarq............................lanK.......FE.P.....D.F...V.K...F..EG-........................-T..TK...Q.E....L..A....D....F...V.........K..A.........N.............Y..........H........G............L............A........G........V.................R.....S.....R................D...........T......T..S...........D.....F....K.........N.....P.....L......V.......V..........V.......Y....Y..A....V.......D.......Y.......V.....K....N.....P...KG..T.......................N...Y...W.R..N.RV.......LKVA....K.EF..................................V...G...............R.........VN.....FA..................................VSAKD..........DF.QH...EL....N....E....Y....G....Y....D......Y....tG...........D........K....P....L....V..L.A.RD-AK...N....Q......-.KF..I...M...-...KD...E....F.SV.......ENLQAFAT-e.......................................................................................
A0A067GVX5_CITSI/185-363               ...........................................................................................vmsnlalkykk----------------.--.......---K......AWF.A.....V...A...K.....-...-D......................FSEDtm.........vlYDF.DK....vP.A....L..V...A..LQ..................................P.......SY.N.....E.H...N.I...F..YGP........................-F..DE...E.F....L..E....E....F...I.........K..Q.........N.............F..........L........P............L............S........V........P.................I.....N.....Q................D...........T......L..N...........L.....L....K.........D.....D.....K......R.......K..........I.......V....L..A....I.......V.......E.......D.....-....E.....T...EE..K.......................S...Q...K.L..V.TT.......LKAA....A.SA..................................N...R...............E.........LV.....FC..................................YVGIK..........QF.AD...FA....D....T....F....E....A....N......K....kS...........K........L....P....K....M..V.V.WDGNE...N....Y......L.TV..I...G...-...SE...S....I.DE.......E--------dqgsqisrfle.............................................................................
A0A484BYW3_PERFV/544-741               ..............................................................................................fethrgap----------LFTEAA.KS.......LRGE......VLT.G.....L...L...T.....D...G-......................LAEKla.........aeHSV.DL.....P.A....V..L...V..FPs................................wR.......TH.A.....H.P...S.A...L..PVS........................-N..SA...E.E....L..L....S....H...I.........N..T.........A.............L..........L........H............P............L........P........E.................L.....T.....V................E...........N......L..P...........S.....F....L.........S.....L.....G......K.......A..........-.......L....L..L....L.......F.......V.......G.....E....E.....E...DE..F.......................G...R...R.Q..N.--.......QVLV....E.EMrgvv.........................elggrR...-...............Me.......pYL.....AC..................................WIHLGr.......tpAG.MS...VL....G....S....Y....L....G....S......M.....P...........P........L....P....A....L..V.L.THLPS...R....Ge....iY.QY..P...P...-...NM...P....I.GA.......PSVLQWLQ-r.......................................................................................
A0A2I0KGC2_PUNGR/175-360               ......................................................................................................FPKFSGEEYENFTALA.EK.......LRSD......YEF.G.....H...T...L.....D...AK......................LLPRg...........eSSV.AG.....P.V....V..R...L..FK..................................P.......FD.E.....L.F...V.D...F..KD-........................-F..HV...D.A....L..E....K....F...V.........E..E.........S.............S..........V........P............V............V........T........V.................F.....Nn...dP................S...........Nh...pfV..I...........K.....F....F.........N.....N.....V......-.......N..........A.......K....A..M....L.......F.......M.......N.....F....T.....N...EL..A.......................E...S...F.K..S.KY.......RDVA....E.QF..................................K...G...............E........gIS.....FL..................................LGDLD..........AS.QG...AF....Q....Y....F....G....L....K......E.....D...........Q........V....P....L....I..I.-.IQTTD...G....Q......K.YL..-...-...-...KA...N....V.EP.......DHIAPWVKD........................................................................................
A0A1S2ZJW9_ERIEU/175-358               ................................dsfkqyfsempwlavpytdearrsrlnrlygiqgiptlivldpqgevitrqgrvevlndedcqefpwhpk----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.-....-..-...-..--..................................-.......--.-.....-.-...-.-...-..---........................--..--...-.-....-..-....-....-...-.........-..-.........-.............-..........-........-............P............V........L........E.................L.....S.....D................S...........N......A..V...........Q.....L....N.........E.....G.....P......-.......-..........C.......L....V..L....F.......V.......D.......S.....E....D.....D...GE..S.......................E...A...A.K..Q.LI.......QPIA....E.KIiaky.........................kakeeE...A...............P.........LL.....FF..................................VAGED..........DM.TD...SL....R....D....Y....T....N....L......P.....E...........A........A....P....L....L..T.I.LDMSA...R....A......K.YV..M...D...-...VE...E....I.TP.......AIVEAFVND........................................................................................
Q4WH99_ASPFU/160-341                   ......................................................................................................FASDDKAANDVFTSFA.ES.......QRDN......YLF.A.....A...T...S.....D...SA......................IAKA.............EGV.KQ.....P.S....I..V...L..YK..................................D.......FD.E.....K.K...A.V...Y..DGA........................-I..EQ...E.A....I..L....S....W...V.........K..T.........A.............S..........T........P............L............V........G........E.................I.....G.....P................E...........T......Y..S...........S.....Y....I.........T.....A.....G......I.......P..........-.......-....L..A....Y.......I.......F.......A.....E....T.....K...EE..R.......................D...Q...Y.A..E.DF.......KPVA....E.KH..................................K...G...............A.........IN.....IA..................................TIDAK..........MF.GA...HA....G....N....L....N....L....D......P.....Q...........T........F....P....A....F..A.I.QDPEK...N....A......K.YP..Y...D...Q...SR...E....F.NA.......KEIGKFIQD........................................................................................
A0A2A2L7S1_9BILA/276-473               ......................................................................................................FASEDSTTFEAYSDSA.EM.......LREE.....fKTM.G.....Y...T...L.....D...KA......................AFKK.............YDA.KP.....N.D....I..I...I..FYpal............................fhsK.......FE.P.....K.S...R.T...Y..NKV........................GA..TA...E.D....L..L....A....F...F.........R..E.........H.............S..........A........P............L............V........G........K.................M.....T.....R................A...........N......A..A...........T....rY....S.........K.....F.....P......L.......V..........V.......V....Y..-....Yn....adF.......S.......I.....Q....Y.....R...EG..S.......................E...Y...W.R..Q.KV.......LNIA....Q.KY.................................qK...D...............K.........YR.....FA..................................VADEE..........EF.AK...EL....E....E....V....G....L....G......D.....S...........G........L....E....H....N..V.I.VFGFD...G....K......K.-Y..P...M...Y...PN...E....F.DEe....ldENLEAFMKK........................................................................................
A0A6P4XWQ7_BRABE/158-342               ......................................................................................................FKDQESDAAKAFLEVA.RS.......DD-E......TTF.A.....I...T...S.....T...DE......................VFEK.............LEG.KD.....G.G....V..V...L..FK..................................K.......FD.E.....G.R...N.D...Y..EGD........................-I..AE...E.E....L..K....Q....F...I.........K..G.........N.............S..........L........P............L............V........V........E.................F.....T.....E................S...........T......A..Q...........K.....V....F.........G.....G.....E......V.......K..........N.......H....N..L....L.......F.......I.......S.....K....D.....H...EN..F.......................D...S...I.L..E.QF.......KGAA....A.DF..................................K...G...............K.........VL.....FI..................................YINVDn........eDH.AR...IL....E....F....F....G....L....N......K.....D...........E........C....P....Q....V..R.L.ISLDE...D....M......T.KY..K...P...E...TE...E....I.TT.......DNMKAFVQ-g.......................................................................................
A0A1E4RNQ6_9ASCO/379-505               ...........................................................................................fdrslflastl----------------.--.......----......---.-.....-...-...-.....-...--......................----.............--T.TK.....P.T....L..Y...V..FR..................................D.......NT.L.....F.T...S.V...Y..QSFap....................edIR..DV...D.K....L..D....N....F...I.........K..A.........N.............Q..........Y........P............L............Y........Q........E.................L.....T.....P................E...........L......F..E...........H.....Y....F.........N.....G.....K......Gt....ddK..........I.......V....V..T....F.......I.......D.......S.....E....D.....A...QR..T.......................N...K...E.F..Y.NI.......SIAA....H.EYh...............................ymK...K...............Q.........YY.....FE..................................KLNND..........--.--...--....-....-....-....-....-....-......-.....-...........-........-....-....-....-..-.-.-----...-....-......-.--..-...-...-...--...-....-.--.......---------renkyekv................................................................................
M7YXL3_TRIUA/3-182                     ................................................................................................ahsdel-------------AAA.SR.......LEDT......ISF.Y.....Q...T...T.....S...PD......................VAKLfh.........idPEA.KR.....P.S....I..V...L..LK..................................K.......EE.E.....K.L...T.V...F..DGE........................-F..RA...S.A....I..A....E....F...V.........S..A.........N.............K..........I........P............L............I........T........T.................L.....T.....Q................E...........T......A..P...........A.....I....F.........D.....N.....P......I.......K..........K.......Q....I..L....L.......F.......A.......V.....-....-.....A...KE..S.......................S...K...F.L..P.II.......KETA....K.SF..................................K...G...............K.........LL.....FV..................................FVERDn........eEV.GE..pVA....N....Y....F....G....I....T......G.....Q...........E........T....T....V....L..A.-.YTGNE...D....A......K.KF..F...F...-...SG...E....I.SL.......DTMKEFAQD........................................................................................
A0A4D8ZV89_SALSN/617-798               ..............................................................................................nesvilds--------------AV.KH.......KKKA.....wFSV.A.....N...V...F.....S...DE......................IVTP.............YGL.NK....vP.A....L..L...A..IY..................................P.......AY.D.....E.K...S.V...F..YGP........................-F..EE...N.A....L..E....D....Y...I.........S..K.........S.............L..........L........P............L............I........F........P.................I.....S.....Q................G...........S......L..K...........L.....L....Q.........D.....D.....E......R.......K..........V.......L....L..T....I.......I.......K.......D.....E....K.....E...EK..S.......................R...E...L.F..Q.VL.......KAAA....S.AN..................................R...D...............-.........LL.....FG..................................YVGLQ..........QW.ED...FA....Q....S....F....E....V....D......M....kT...........E........F....P....R....M..V.V.WDGNE...N....Y......Y.LV..T...-...-...--...-....-.--.......---------gsengdktdmaaqvsrfle.....................................................................
A0A6P7Z753_9AMPH/541-730               ......................................................................................................FSSDMNEAREAFVEVG.SI.......LKGY......SAL.G.....I...Y...F.....E...EN......................VQHLs..........hrYAV.TL.....P.A....L..L...L..AR..................................H.......NE.H.....R.I...D.G...I..SLS........................NY..NA...E.D....I..L....K....L...I.........T..Q.........K.............S..........L........A............S............F........S........E.................I.....T.....V................E...........N......L..P...........A.....Y....L.........R.....L.....Q......K.......P..........-.......L....L..I....L.......F.......S.......D.....-....G.....N...IR..H.......................S...D...Q.T..V.IL.......KLVR....D.KH..................................L...E...............T.........YA.....TC..................................WLNLKn........tPV.GR..gIL....K....S....Y....F....G....S......V.....P...........L........L....P....Q....L..V.L.VDLHS...K....G.....qA.FA..F...P...S...DQ...T....V.TE.......ANVLHWLKK........................................................................................
A0A3Q1E912_9TELE/160-343               ......................................................................................................FKDASSEGAKAYEKAA.EA.......ID-D......IPF.A.....M...T...S.....N...DA......................VYSK.............FEV.SK.....D.S....V..V...L..FK..................................K.......FD.E.....G.R...N.T...F..DGE........................-L..TK...E.K....L..L....A....F...V.........K..A.........N.............Q..........L........P............L............V........I........E.................F.....T.....E................Q...........T......A..P...........K.....I....F.........G.....G.....D......I.......K..........S.......H....I..L....M.......F.......L.......P.....K....V.....A...SD..F.......................Q...D...K.M..D.QF.......KKAA....E.GF..................................K...G...............Q.........IL.....FI..................................FIDSDi........dDN.QR...IL....E....F....F....G....L....K......K.....E...........E........C....P....A....I..R.L.ITLED...E....M......T.KY..K...P...E...SD...A....I.TA.......ESITQFC--t.......................................................................................
A0A3S3P4Z5_9ACAR/164-360               ......................................................................................................FDSESDDLAKKFLKTA.DR.......MRES......VLF.A.....H...I...F.....A...STstgd.............andvaAFKD.............LSV.SA.....P.A....V..V...L..VRpsi............................lknK.......FE.P.....S.S...V.L...Y..D--........................--..TS...K.S....I..E....D....F...I.........N..E.........N.............Y..........H........G............L............V........G........H.................R.....T.....Q................N...........N......M..Q...........D.....F....R.........T.....P.....Y......V.......V..........-.......S....Y..Y....D.......V......dY.......V.....K....N.....P...KG..T.......................N...Y...W.R..N.RI.......LKVA....K.DH..................................T...D...............-.........IT.....FA..................................VSNSQ..........LF.AG...EL....E....E....Y....G....L....E......Pak.egR...........D........A....P....P....M..V.V.AR-DA...K....G......R.KY..V...M...-...TE...K....F.SV.......DALAQFVKD........................................................................................
A0A6P8WZ59_DROAB/157-352               ...............................................................................................aqqgvvw---------DTYYAAA.EG.......YQEH......GFF.Y.....A...T...S.....E...DI......................AAQH.............FDF.EQ....lP.A....V..I...V..YK..................................E.......EQ.-.....-.H...H.F...Y..PHGhv....................ahQM..DP...Q.DvnetI..F....Q....W...V.........N..V.........E.............R..........F........T............L............F........P........K.................V.....T.....R................F...........N......I..H...........Q.....L....L.........K.....T.....Q......K.......Y..........-.......-....L..V....L.......A.......V.......V.....Q....E.....D...KL..Nqiath.............elefrD...M...V.E..G.VI.......RKHR....A.RY..................................H...D...............Q.........FQ.....FG..................................WIG--..........-E.PS...IA....H....S....I....I....L....D......Q.....L...........P........T....P....H....L..I.A.LNSTT...Q....H......H.YI..P...D...D...EP..lQ....L.TP.......QALHLFLE-s.......................................................................................
A0A4V1XMQ0_9PEZI/363-541               ..................................................................................................ldgg----DETLRAAFLEVA.AK.......YREE......FTF.G.....L...V...T.....D...AG......................AIEA.............EKV.TG.....P.T....V..R...C..VK..................................P.......LD.E.....D.S...R.D...L..HGF........................-T..DV...E.S....L..E....K....F...V.........K..E.........N.............S..........R........P............L............I........G........E.................L.....L.....P................H...........N......H..Q...........R.....F....L.........E.....R.....G......W.......P..........-.......M....V..Y....V.......F.......A.......A.....-....T.....E...SE..R.......................S...E...I.R..T.TL.......KETA....R.GY..................................Y...E...............S.........LT.....MV..................................TVDPQ..........EF.PD...LP....A....K....L....G....L....E......A.....S...........V........F....P....S....G..A.V.HQLST...D....R......I.YP..Y...P...K...GR...G....L.TT.......NE-------llsw....................................................................................
A0A1U7YJ27_NICSY/162-348               ......................................................................................................FQELSGEKFENYTTLA.EK.......LRAD......YDF.A.....H...T...V.....D...AK......................FLPR............gEQV.DK.....P.T....L..R...L..LK..................................P.......FD.E.....L.F...V.D...F..ED-........................-F..EV...E.A....M..E....K....F...I.........A..E.........S.............S..........I........P............I............V........T........Y.................F.....Dk...dP................E...........Ns...iyV..S...........K.....F....F.........N.....G.....I......G.......A..........-.......K....A..M....L.......F.......V.......N.....-....F.....S...TE..L.......................D...A...F.Q..S.KY.......KDVA....V.LN..................................K...E...............Ngl.....kgLS.....FL..................................LGDVE..........AG.EG...AF....S....Y....F....G....L....K......P.....E...........Q........A....P....L....I..I.I.MENDG...Q....K......Y.-L..-...-...-...KA...H....V.EP.......DAIASWLKD........................................................................................
A0A3B6B0W6_WHEAT/173-364               ..................................................................................................fpef----AGIEYENFMAVA.NK.......MRTD......YDF.F.....H...T...S.....D...AS......................ILPRg...........dLTV.KG.....P.L....L..R...L..FK..................................P.......FD.E.....L.F...V.D...S..QD-........................-F..DD...D.A....I..K....K....F...I.........E..V.........S.............G..........F........P............T............V........V........T.................F.....DadptnH................K...........F......I..E...........R.....Y....Y.........S.....T.....P......S.......A..........-.......K....A..M....L.......F.......L.......R.....F....S.....D...DR..V.......................E...T...F.K..S.QM.......HEAA....R.QL.................................iG...N...............N.........IS.....FL..................................IGDVS..........TA.DR...AF....E....Y....F....G....L....K......E.....S...........D........V....P....L....L..L.V.LA-ST...G....K......Y.LN..P...-...-...--...-....-.--.......---------tmepdqlipwmkqyiygnlt....................................................................
A0A0V0XBY0_9BILA/172-356               ......................................................................................................FKDENANELAVFKEVA.DT.......FD-N......VKF.A.....Y...T...F.....N...PD......................VYKA.............YKI.QK.....D.G....I..Y...V..IK..................................V.......AD.D.....-.T...E.M...Y..KGN........................-G..TI...E.D....I..R....S....W...I.........V..M.........N.............S..........L........P............L............V........P........T.................Y.....G.....A................K...........Y......S..N...........L.....I....Y.........E.....S.....P......L.......K..........S.......H....V..Y....L.......M.......I.......R.....G....D.....D...ED..Y.......................D...D...L.K..I.IM.......QKAA....V.HF..................................K...N...............K.........LM.....FV..................................IIDGSt........aDA.HS...YL....D....F....F....R....L....D......Q.....A...........N........L....P....E....I..R.I.CNLTE...E....P.....fV.KY..K...P...D...FE...I....I.TT.......DKLKQFAS-d.......................................................................................
A0A3P8JFW8_TRIRE/13-68                 ..............................................................................................ryirymng----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.-....-..-...-..--..................................-.......--.-.....-.-...-.-...-..---........................--..--...-.-....-..-....-....-...-.........-..-.........-.............-..........-........-............-............-........-........-.................-.....-.....-................-...........-......-..-...........-.....-....-.........-.....-.....-......-.......-..........-.......-....-..-....-.......-.......-.......-.....-....-.....-...--..-.......................-...-...-.-..-.--.......----....-.--..................................-...-...............-.........--.....-I..................................QTDGV..........TF.SH...PL....A....H....L....G....K....S......E.....S...........D........L....P....F....I..C.-.LDSFA...H....M......Y.VY..P...G...-...--...-....-.--.......---------sidtgltrls..............................................................................
A0A287TG47_HORVV/36-147                ..........................................................................................tksevlapavkg----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.-....-..-...-..--..................................-.......--.-.....-.-...-.-...-..---........................--..--...-.-....-..-....-....-...-.........-..-.........-.............-..........-........-............-............-........-........-.................-.....T.....S................N...........V......L..K...........A.....C....S.........A.....M.....K......V.......Q..........-.......K....I..L....L.......F.......A.......V.....-....-.....A...KE..S.......................S...N...F.L..P.IL.......KETA....K.SF..................................K...G...............K.........LL.....FV..................................FVEGDn........eEV.GE..pVA....N....Y....F....G....I....T......G.....Q...........E........T....T....V....L..A.-.YTGNE...D....A......K.KF..F...F...-...SG...E....I.SL.......DNIK-----vlle....................................................................................
A0A3S7RNE6_GIAMU/143-324               ..................................................................................................egpi-------LKDIHEDFF.AP.......LKGK......HFF.G.....F...V...K.....G...--......................----.............--V.-E.....E.K....L..Y...A..IR..................................D.......--.G.....V.R...I.D...F..KGK........................-F..DR...H.S....V..Q....K....F...L.........R..Q.........N.............R..........H........S............F............F........P........E.................L.....G.....T................D...........N......F..Q...........E.....L....L.........Q.....T.....P......G.......H..........N.......L....T..F....L.......A.......I.......-.....-....D.....P...SK..H.......................D...T...I.R..R.YI.......SEFA....K.KLmlsen.......................dpnkfvT...D...............K.........YT.....LS..................................YLDGV..........RW.AQ...FV....E....T....F...nG....I....K......T.....E...........D........L....P....Q....L..I.I.YDVLN...G....P......K.KY..Yt.aP...I...SE...D....N.IV.......GDITNFLR-k.......................................................................................
A0A0E0NG92_ORYRU/192-367               ..........................................................................................ygakyknrawfs----------------.--.......----......---.-.....-...-...V.....A...KD......................FSEDmm.........vfYDF.DK....vP.A....L..V...S..VN..................................P.......KY.R.....E.Q...S.I...F..YGP.......................fD-..DG...A.F....L..E....D....F...I.........R..N.........S.............L..........L........P............L............V........V........P.................M.....N.....R................E...........T......V..K...........M.....L....N.........D.....D.....G......R.......K..........V.......V....L..M....I.......L.......Q.......D.....D....E....sD...EN..S.......................P...R...L.I..K.VL.......RSAA....S.AN..................................R...D...............-.........LV.....FG..................................YVGVN..........QW.EE...FT....E....T....F....D....V....K......S.....S...........E........L....P....T....M..I.V.WD-KK...E....E......Y.EI..V...-...-...--...-....-.--.......---------egserleegdygsqisrfle....................................................................
A0A2U1L9W6_ARTAN/97-325                dvrsaelmprfaeaaselrelesgvlmskvdaerypkaasglgikgyptlllfvngssqaytggfsatsntplrsvisxrlkqtissetfmlriglfdklkd----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.-....-..-...-..--..................................-.......--.-.....-.-...-.-...-..---........................AF..EK...D.K....I..L....Q....F...L.........S..D.........N.............K..........F........P............L............V........T........F.................L.....T.....E................V...........N......S..V...........K.....V....Y.........A.....C.....E......K.......P..........-.......Q....V..Y....V.......F.......A.......-.....-....E.....A...DN..F.......................K...K...L.L..E.PF.......QDAA....R.KF..................................K...S...............Kvd....nlnIM.....FV..................................FVDIKd........dNL.AK..pFL....T....L....F....G....L....E......D.....S...........E........D....T....L....V..T.A.FDYKT...G....A......K.YL..-...L...-...ES...D....P.TP.......ARIEEF---gs......................................................................................
A0A4P9YV19_9FUNG/169-351               ......................................................................................................FASEDDDGYKQYKKVA.GE.......LRDS......TVF.G.....A...T...F.....D...KK......................VAKK.............VDI.KK....aP.S....V..T...V..FQ..................................Q.......FD.D.....G.R...V.D...F..AED........................EF..TQ...D.A....L..T....S....F...V.........K..D.........N.............S..........I........P............L............L........N........E.................L.....G.....P................E...........N......F..M...........S.....Y....I.........E.....S.....G......K.......P..........-.......L....A..Y....L.......F.......V.......T.....-....S.....D...DE..R.......................K...E...L.G..D.KL.......RPVA....K.KY..................................K...G...............K.........IN.....FV..................................FIDAN..........QF.GE...HA....S....T....L....N....L....K......-.....Q...........E........W....P....A....F..A.I.QE-PV...N....Q......F.KY..P...F..sQ...DK...E....I.EG.......DAIEEFVQD........................................................................................
I3J5R9_ORENI/197-385                   ......................................................................................................FESLDSEAAQVFKEVA.MD.......MP-D......QEF.G.....V...T...A.....T...PE......................VFQK.............YEV.KG.....S.S....V..V...L..FK..................................K.......FD.D.....G.R...A.D...F..VLSe.....................egKL..EK...N.N....L..T....T....F...I.........K..Q.........N.............S..........L........Q............L............I........I........R.................F.....S.....Q................E...........V......A..D...........K.....V....F.........N.....S.....G......I.......N..........V.......H....C..L....L.......F.......M.......N.....S....T.....V...ES..Q.......................M...R...L.L..E.RF.......KAVA....K.EF..................................K...G...............K.........VTl...lFI..................................LIDVS.........ePL.SH...VL....S....Y....F....A....V....S......K.....D...........D........A....P....T....L..R.I.INMDT...G....K......K.YA..S...D...-...SE...E....L.TI.......DSLRQLCQE........................................................................................
A0A6J3AIF9_VICPA/258-416               ......................................................................................................FEQKDSENYRVFERVA.NI.......LHDD......CAF.L.....S...A...F.....-...GA......................VSKP.............ERY.SG.....D.N....I..I...-..YK..................................P.......PG.H.....S.A...P.D...M..VYLg......................sMT..NF...D.G....T..Y....N....W...I.........Q..D.........K.............C..........V........P............L............V........R........E.................I.....T.....F................E...........N......G..E...........E.....L....T.........E.....E.....G......L.......P..........F.......L....I..L....F.......H.......M.......K.....E....D.....T...ES..L.......................E...I...F.Q..N.EV.......ARQL....I.SE..................................K...G...............T.........IN.....FL..................................HADCD..........KF.RH...PL....L....I....P....G....K....-......-.....-...........-........-....-....-....-..-.-.-----...-....-......-.--..-...-...-...--...-....-.--.......---------lkqfvfdlhsgk............................................................................
A0A2T2NT54_CORCC/195-373               .....................................................................................................e--DHEDTLLATFRTVA.EK.......HHYE......FVF.A.....Y...T...T.....D...VE......................AADA.............EGL.AV.....P.S....I..V...C..WK..................................N.......ED.G.....D.H...K.V...L..TGK........................-F..EE...A.G....V..E....G....V...L.........A..K.........A.............K..........V........G............V............I........G........T.................F.....R.....E................K...........E......M..D...........K.....Y....M.........V.....P.....N......K.......L..........-.......T....T..Y....L.......F.......T.......-.....K....N.....P...AH..S.......................R...A...L.R..H.AL.......TPVA....K.KY..................................E...K...............I.........VT.....FA..................................VADAV..........EF.RP...MA....Q....N....F....G....L....K......E.....D...........L........W....P....A....V..A.V.HSPGK...D....Q......V.FL..W...R...Q...GK...G....I.TV.......GEME-----aml.....................................................................................
A0A6P7IU58_9TELE/48-234                ................................................................................................egvesh-------GYKELLEAA.KR.......VD-S......VPV.A.....I...C...T.....V...KE......................VWAD.............YSL.SS.....D.T....I..T...L..FR..................................K.......AD.N.....H.Q...E.N...L..VVAe.....................akKL..DA...D.G....L..V....N....F...I.........T..I.........N.............E..........V........R............Y............I........T........E.................Y.....N.....Q................V...........T......A..V...........G.....L....F.........N.....S.....E......V.......K..........T.......H....L..L....L.......F.......V.......N.....R....G.....T...KE..Y.......................T...E...L.K..Q.QL.......GALA....P.EF..................................T...E...............K.........FL.....FV..................................LINGAv........kSN.FR...SL....N....Y....F....G....L....K......S.....H...........D........L....P....R....V..G.I.YDGDS...D....M......K.WL..L...P...-...EG...E....I.ST.......ERVREFCQ-s.......................................................................................
A0A653CNU9_CALMS/168-354               ......................................................................................................FDRRDQPEYSIFRRVA.TN.......MKDE......CRF.Y.....V...G...F.....-...EE......................ASRQ.............MHP.PG.....Q.P....I..V...V..FR..................................Pdk...drSN.D.....L.D...E.T...Y..PGS........................LS..SF...D.E....L..H....I....W...A.........S..E.........K.............C..........V........P............L............V........R........E.................I.....T.....F................E...........N......A..E...........E.....L....T.........E.....E.....G......L.......P..........F.......L....I..L....F.......H.......A.......P.....E....D.....K...ES..V.......................K...R...F.N..E.IV.......QTEL....L.SE..................................K...Q...............N.........IN.....FL..................................TADGQ..........RF.SH...PL....H....H....L....G....K....S......S.....R...........D........L....P....L....I..A.-.IDSFR...H....M......Y.LF..P...D...Y...KD...I....E.KP.......GKLKGFIQD........................................................................................
A0A0Q3E8K2_BRADI/92-268                .....................................................................................eyggkykkrawfaiaqd----------------.--.......----......---.-.....-...-...F.....S...EE......................LMMA.............YGF.DK....aP.A....L..V...A..LH..................................P.......KY.N.....E.Q...S.V...F..YGP........................-F..EG...R.F....L..E....D....F...I.........R..Q.........S.............L..........L........P............L............T........V........P.................I.....N.....T................E...........T......L..K...........L.....L....D.........D.....D.....D......R.......K..........-.......V....V..L....A.......I.......L.......E.....D....D.....S...DE..N.......................S...A...Q.L..V.TV......lRSAA....N.AN..................................R...D...............-.........LV.....FG..................................YVGVK..........QW.EE...FV....E....T....F....D....V....S......K....sS...........Q........L....P....K....L..L.V.WD-RN...E....E......Y.EQ..V...D...G...SE...R....L.EEgd...qaSQISQFL--eg......................................................................................
A0A0G4GLE0_VITBC/143-290               ...........................................................................................hadehrhlvrp-----------FQHVS.RH.......HD-T......VLF.G.....H...V...D.....E...AHed.................vidFIKKt..........yqLDV.KL.....P.S....V..I...I..FK..................................P.......HD.E.....K.M...A.V...F..AGY.......................lN-..DL...N.G....L..D....L....F...V.........K..R.........H.............K..........L........P............A............I........S........N.................F.....T.....Q................D...........T......G..A...........K.....V....F.........P.....D.....G......R.......P..........-.......-....I..I....F.......L.......F.......K.....D....Y.....S...--..D.......................A...S...W.K..-.--.......----....-.--..................................-...-...............-.........--.....--..................................-----..........--.--...--....-....-....-....-....-....-......-.....-...........-........-....-....-....-..-.-.-----...-....-......-.--..-...-...-...--...-....-.--.......---------aeltgvdniedelpvvmmvamnpggdehyyp.........................................................
A0A672GGU9_SALFA/303-500               ......................................................................................................FSSEQDAAYETYIEAC.NM.......LRED......FTF.R.....H...T...F.....S...AE......................VFKL.............LKA.SP.....G.Q....V..V...V..IQ..................................P.......-E.K.....F.R...S.K...Y..EPSsqtl................tvkdST..LV...S.D....I..Q....D....F...F.........K..K.........H.............V..........I........P............L............V........G........H.................R.....K.....P................S...........N.....dA..K...........R.....Y....T.........K.....R.....P......L.......V..........V.......V....Y..Yg..vD.......F.......S.......F.....D....Y.....R...KG..Esv..................flhQ...F...W.R..S.KV.......LEVA....K.DF..................................P...E...............-.........YT.....FA..................................IADEE..........DY.AD...EL....K....S....L....G....L....S......E.....S...........G........E....E....V....N..A.G.IM-AE...G....G......K.KY..A...M...E...PD...E....F.DS.......DVLREFVM-a.......................................................................................
A0A0D9VH17_9ORYZ/152-334               ................................................................................................ddgvvv--------FESFMAVA.EK.......MRAD......YEF.R.....H...T...T.....D...AG......................VLPRg...........dRTV.TG.....P.L....V..R...L..FK..................................P.......FD.E.....L.Y...V.D...S..QD-........................-F..DI...D.A....L..E....K....F...V.........E..V.........S.............G..........F........P............K............I........V........T.................FdtnptN.....Q................K...........Y......L..L...........R.....Y....F.........D.....N.....A......G.......T..........-.......K....A..M....L.......F.......L.......S.....F....S.....D...DR..A.......................D...A...F.R..T.QF.......YEAA....K.QY..................................S..aN...............N.........IS.....FM..................................IGDVT..........AS.QG...AF....Q....Y....F....G....L....K......E.....S...........D........V....P....L....I..F.I.LASKS...K....Y......I.K-..-...-...-...--...-....-.--.......---------ptvqpdqilpwlke..........................................................................
A0A3Q1ATE7_AMPOC/31-213                .................................................................................................gadss-------RLAEFLNAA.GL.......LREQ......FRF.A.....H...S...T.....-...--......................----.............---.DL.....Q.C....V..L...L..FRppr............................lsnT.......FE.D.....S.L...V.V...F..KDY........................-L..TI...G.S....L..R....R....F...I.........R..D.........H.............I..........Y........G............L............C........P........H.................M.....T.....L................E...........N......R..D...........R.....L....R.........V.....H.....D......L.......L..........T.......A....Y..Y....D.......L......dY.......H.....H....N.....V...RG..S.......................N...Y...W.R..N.RV.......MKVA....S.KY..................................G...G...............R........gLT.....YS..................................VANKK..........DF.LS...EL....E...dD....F....G....L....G......T.....S...........Dg.....geL....P....F....V..T.I.RTRLG...H....K......Y.-T..M...R...E...EF...T....R.DG.......QSLERFLDD........................................................................................
A0A3Q2DYC6_CYPVA/149-342               ......................................................................................................FADDKSTEQAEFLKAA.SA.......LRDD......YRF.A.....H...T...N.....A...EA......................L---.............LNS.HG....gE.G....V..V...L..FRppr............................lnnK.......FE.D.....S.S...V.K...F..SED........................KF..TS...N.K....V..K....R....F...I.........Q..D.........N.............I..........F........G............I............C........P........H.................L.....T.....E................D...........N......K..D...........Q.....L....K.........G.....K.....D......L.......L..........V.......A....Y..Y....D.......V......dY.......D.....K....N.....P...KG..S.......................N...Y...W.R..N.RV.......MKVA....K.GF..................................L...Dq............gkK.........MT.....FA..................................VANKN..........QF.SH...DL....S....D....F....G....L....D......Gg...sG...........E........L....P....V....V..A.I.RT-AK...G....D......K.YV..M...T...E...EF...S....R.DG.......KALERFLQD........................................................................................
G1L5C5_AILME/534-723                   ......................................................................................................FSPNMTTAKEDFTEAG.NY.......LKGC......VIT.G.....I...Y...S.....E...ED......................VLILs..........nkYAA.TL.....P.A....L..L...L..AR..................................H.......KE.G.....K.I...E.S...I..PLA........................NS..HA...Q.D....I..V....Q....I...I.........T..N.........A.............L..........L........E............T............F........P........E.................I.....T.....V................E...........N......L..P...........I.....Y....L.........R.....L.....Q......K.......P..........-.......L....L..I....L.......F.......S.......D.....-....G.....S...-I..N.......................P...Q...C.K..K.AI......lTLVK....E.KH..................................L...D...............S.........LT.....PC..................................WLNLKn........tPV.GR..gIL....Q...aY....F....N....T....L......-.....P...........P........L....P....L....L..V.V.VSLHS...G....G.....qV.FA..F...P...S...DQ...A....I.TE.......QNLLLWLKK........................................................................................
A0A5D2ZCE4_GOSMU/169-354               ......................................................................................................FPKFSGEEFESYMALA.EK.......LRSD......YEF.G.....H...T...L.....D...AK......................HLPRg...........eSSV.TG.....P.V....V..R...L..FK..................................P.......FD.E.....L.F...V.D...F..KD-........................-F..NV...E.A....L..E....K....F...V.........A..E.........S.............S..........M........P............L............V........T........H.................F.....Nk...dP................S...........Nh...qfV..I...........K.....F....Y.........N.....S.....P......N.......A..........-.......K....A..M....L.......F.......A.......N.....L....S.....V...EG..I.......................D...S...L.T..S.KY.......REVA....E.QF..................................K...G...............Q........gIG.....FL..................................LGDLE..........AS.QA...AI....Q....Y....F....G....V....Q......E.....S...........Q........V....P....L....I..I.I.QNNDR...K....K......Y.-L..-...-...-...KP...N....L.QA.......NDIAPFVKD........................................................................................
A0A319DTL7_ASPSB/157-338               ....................................................................................................ip--SEDQETYLAFEKYA.ES.......QRDN......YLF.A.....A...T...N.....D...LA......................IAKA.............EGV.DQ.....P.S....L..V...L..YK..................................D.......FD.E.....K.K...A.I...Y..EGE........................-I..EQ...E.A....I..H....N....W...V.........K..S.........A.............S..........T........P............L............V........G........E.................I.....G.....P................E...........T......Y..S...........G.....Y....I.........G.....A.....G......I.......P..........-.......-....L..A....Y.......I.......F.......A.....E....T.....Q...EE..R.......................E...K...Y.T..E.DF.......KPIA....Q.KH..................................K...G...............A.........IN.....IA..................................TIDAK..........MF.GA...HA....G....N....L....N....L....D......P.....Q...........T........F....P....A....F..A.I.QDPAK...N....A......K.YP..Y...D...Q...SK...G....L.NT.......DDVDKFIQD........................................................................................
A0A5C3NF07_9AGAM/156-341               ..............................................................................................asstsaap--------VPEFSATA.NK.......HRDD......FLF.G.....L...S...T.....D...DS......................VIET.............VGL.SP.....P.A....I..V...V..YR..................................Q.......FD.E.....P.Q...T.E...Y..PYPv......................aSA..TV...K.D....L..E....E....W...I.........K..E.........L.............A..........V........P............I............I........D........E.................V.....G.....A................E...........N......Y..Q...........T.....Y....A.........Q.....S.....G......K.......P..........-.......L....A..Y....L.......F.......L.......D.....P....T.....V...QT..K.......................Q...E...H.I..D.AI.......RPIA....A.LH..................................K...G...............K.........IN.....FV..................................WIDAI..........KF.GD...HA....R....A....L....N....L....P......E.....Q...........K........W....P....A....F..V.I.QDLTK...Q....L......K.YP..L...D...Q...AE...E....F.SA.......EAVGDWVEK........................................................................................
A0A445L569_GLYSO/1-85                  ......................................................................................................----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.-....-..-...-..--..................................-.......--.-.....-.-...-.-...-..---........................--..--...-.-....-..-....-....-...-.........-..-.........-.............-..........-........-............-............-........-........-.................-.....-.....-................-...........-......-..-...........-.....-....-.........-.....-.....-......-.......-..........-.......M....V..M....L.......F.......I.......N.....F....T.....A...EG..A.......................G...F...F.K..S.RY.......REAA....E.QY..................................R...Q...............Q........gLR.....FL..................................VGDAK..........ST.KG...SF....Q....Y....F....G....V....K......E.....G...........Q........V....P....L....I..I.-.VQRND...G....K......K.FL..K...-...-...-P...N....L.EP.......DHISTWLK-a.......................................................................................
A0A663N8T4_ATHCN/167-274               .................................................................................................vesfv----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.-....-..-...-..--..................................-.......--.-.....-.-...-.-...-..---........................--..--...-.-....-..-....-....-...-.........-..-.........-.............-..........-........-............-............-........-........-.................-.....-.....S................Q...........T......S..V...........K.....I....F.........D.....V.....P......V.......E..........N.......H....I..V....L.......F.......T.......P.....T....N.....S...ET..F.......................S...A...I.Y..E.NY.......KSAA....V.EF..................................R...G...............K.........IM.....FV..................................LVDTNe........tRN.GR...VF....E....Y....F....R....I....R......D.....I...........D........V....P....A....V..R.I.LNLTS...N....A......K.YK..M...P...-...AD...E....V.TV.......ENLKEFCQ-s.......................................................................................
A0A0P1B4I0_PLAHL/175-341               .......................................................................................letladndvlavyaa----------------.--.......----......---.-.....-...-...-.....S...TN......................VDLM.............VET.SA....vN.E....V..V...L..YK..................................K.......FD.E.....G.V...V.V...Y..NGD........................-F..EK...K.A....L..S....E....F...V.........K..A.........N.............S..........L........P............L............V........I........T.................F.....S.....Q................D...........L......A..P...........T.....I....F.........G.....G.....D......M.......T..........E.......H....V..L....A.......F.......V.......D.....M....D.....E...DY..V.......................S...G...I.E..T.AL.......RTPA....E.AN..................................K...G...............K.........LL.....HV..................................VMPST..........-E.KR...IV....D....Y....F....G....L....T......E.....E...........E........M....P....V....V..M.L.VNMAG...S....M......K.KY..G...F..nY...KA...D....-.--.......---------slvakidd................................................................................
A0A078HMI0_BRANA/168-352               ......................................................................................................FPKLSGSEFDSFLATA.EK.......LRSD......YDF.A.....H...T...S.....D...AK......................LLPR............gEAV.TG.....P.V....V..R...L..FK..................................P.......FD.E.....L.F...V.D...S..KD-........................-F..DG...E.A....L..E....K....F...V.........K..E.........S.............S..........I........P............L............I........T........V.................F.....Dk...dP................N...........Nh...pyV..I...........K.....F....F.........D.....S.....S......-.......N..........T.......K....A..M....L.......F.......I.......N.....F....T.....G...EG..A.......................E...S...L.K..S.KY.......REVA....T.SY..................................K...G...............Q........gLS.....FL..................................LGDAE..........NS.QG...AF....Q....Y....F....G....L....E......E.....S...........Q........V....P....L....I..I.-.IQTAD...D....K......K.YL..-...-...-...KT...N....I.EI.......DQIESWVKD........................................................................................
A0A1U8PXI5_GOSHI/238-418               ...............................................................................................gpeseei-------------AAA.SR.......LQDD......VSF.Y.....Q...T...V.....N...PD......................VAKLfh.........ldPQV.KR.....P.A....L..V...L..VK..................................K.......EA.E.....K.I...S.Y...F..DG-........................QF..VK...T.V....I..S....E....F...V.........F..S.........N.............K..........L........P............L............I........T........I.................F.....T.....R................E...........S......A..P...........S.....I....F.........E.....S.....D......I.......K..........K.......Q....I..L....M.......F.......A.......-.....-....A.....S...NI..S.......................E...K...Y.L..P.SF.......QEAA....K.SF..................................K...G...............K.........LI.....FV..................................YVQVDn........eDF.GR...PV....A...dY....F....G....V....S......-.....G...........D........G....P....K....L..L.A.YTGND...D....A......R.KF..V...F...-...DG...E....V.TL.......DKIKAF---ged.....................................................................................
A0A3Q1J9A0_ANATE/149-344               ......................................................................................................FADDKSTAQAEFLKAA.SA.......LRDN......YRF.A.....H...T...N.....S...ED......................LLAG.............QGI.DG.....E.G....V..V...L..FRppr............................lnnK.......FE.D.....S.S...V.K...F..AED........................KF..TS...N.K....I..K....K....F...I.........Q..D.........N.............I..........F........G............I............C........P........H.................M.....T.....D................D...........N......K..D...........Q.....L....R.........G.....K.....D......L.......L..........V.......A....Y..Y....D.......V......dY.......D.....K....N.....P...KG..S.......................N...Y...W.R..N.RV.......MKVA....K.SF..................................L...Dq............gkK.........LN.....FA..................................VASKN..........TF.SH...DV....S....E....F....G....L....D......Gs...sG...........E........V....P....I....V..A.I.RT-AK...G....D......K.YV..M...T...E...EF...S....R.DG.......KALERFLQD........................................................................................
C4VA22_NOSCE/1-152                     ...................................................................................................mki----------------.--.......----......---.F.....I...S...T.....D...KK......................LAEE.............MNT.PF.....P.G....V..Y...G..FN..................................P.......RD.K.....V.-...-.S...Y..QFQ........................-L..NE...E.T....V..K....T....I...S.........S..I.........V.............S..........L........D............L............I........G........V.................L.....S.....Y................E...........N......L..E...........A.....Y....R.........A.....T.....G......L.......H..........-.......S....Y..Y....V.......F.......I.......K.....-....-.....P...ED..I.......................P...S...F.L..Y.NF.......KSTA....T.KV..................................K...H...............L.........GK.....FC..................................IIPYK..........GD.RE...QL....K....V....F....G....M....T......E.....E...........D........L....P....G....L..L.F.IN--N...G....E......K.-Y..P...-...-...LK...K....C.TE.......NDIVKFVQD........................................................................................
A0A6P4J216_DROKI/168-354               ......................................................................................................FDRRDQPEYDIFRKVA.TN.......LKED......CQF.H.....V...G...F.....-...GE......................AAQA.............MHP.PG.....T.P....I..I...V..FR..................................Pdv...alSH.E.....N.D...E.T...Y..TGS.......................lQ-..NF...D.E....L..K....I....W...I.........Q..E.........K.............C..........V........P............L............V........R........E.................I.....T.....F................E...........N......A..E...........E.....L....T.........E.....E.....G......L.......P..........F.......L....I..M....F.......H.......R.......P.....D....D.....L...NS..I.......................K...D...Y.K..S.II.......ERQL....L.DE..................................K...Q...............N.........VN.....FL..................................TADGK..........RF.AH...PL....H....H....L....G....K....S......E.....D...........D........L....P....L....I..A.-.IDSFK...H....M......Y.LF..P...H...F...SD...M....Y.SP.......GKLKQFLQD........................................................................................
A0A195AW38_9HYME/159-343               ......................................................................................................FKDVTSDAAKIFLEVG.SI.......VD-D......HVF.G.....I...T...S.....A...DE......................VFSE.............YGI.ED.....G.K....I..V...L..FK..................................K.......FD.E.....G.K...A.V...F..DGE........................-Y..TT...T.A....V..Q....N....F...I.........S..V.........F.............S..........L........P............L............V........V........E.................F.....N.....Q................D...........T......A..Q...........K.....I....F.........S.....G.....D......I.......K..........S.......H....L..L....L.......F.......L.......S.....K....E.....A...GH..F.......................E...K...Y.I..E.GI.......QEPA....K.KY..................................R...S...............E.........VL.....FV..................................TINCDe........tDH.ER...IL....E....F....F....G....L....K......K.....D...........D........V....P....A....M..R.L.IKLEQ...D....M......A.KY..K...P...D...KP...E....I.TT.......ENVLEFVT-a.......................................................................................
A0A084VAX6_ANOSI/1413-1575             ................................................................................................vdlygi----------------.--.......----......-DF.V.....K...V...A.....S...LD......................AAHK.............YGV.TT....iP.S....L..V...Y..YR..................................K.......--.Q.....I.P...M.L...Y..DGD........................MH..DH...E.R....V..M....N....W...L.........T..S.........Q.............D..........Vfe....ikN............E............I........E........E.................V.....N.....R................K...........M......L..N...........K.....L....L.........D.....E.....N......-.......E..........F.......L....A..V....Y.......F.......F.......E.....E....D.....H...EE..S.......................E...A...V.L..E.RL.......ELID....-.SE..................................T...D...............N.........LD.....IT..................................FVKMG..........-D.PR...YA....R....K....W....G....V....T......-.....-...........K........L....P....A....I..V.Y.FR---...K....R......F.PS..I...Y...R...GD...M....Y.DE.......QDVLEWLRK........................................................................................
J9EIH3_9SPIT/4-165                     ................................................................................lslqeqrtilqnytkhtiqsrt----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.-....-..-...-..--..................................-.......--.-.....-.-...-.-...-..--L.......................vNW..TH...A.N....F..E....R....W...I.........V..Q.........K.............S..........L........P............D............V........F........E.................F.....D.....Q................N...........N......V..F...........H.....I....F.........A.....H.....K......-.......H..........I.......A....L..F....L.......F.......R.......D.....P....R.....I...KE..H.......................L...K...L.E..Q.KF.......REIA....Q.DL..................................K...Ndp..........rheE.........IF.....FV..................................TSDIG.........kPE.QK...KL....G...dF....I....G....I....D......Y.....E...........H........L....P....L....M..V.L.IH-PN...H....Geq.gleK.YI..L...Q...-...--...-....-.--.......---------eedlhekltydrldnflhh.....................................................................
A0A1Y1XVG1_9FUNG/296-468               ..........................................................................................ntvksvvntlfi----------------.--.......---H......SFF.Y.....T...S...S.....N...PK......................IAEE.............LGI.RQ....tP.A....L..V...V..FK..................................E.......GL.R.....R.Q...Y.E...N..PLD........................--..DK...A.A....V..Q....E....W...I.........T..T.........E.............Q..........F........P............L............L........T........Q.................I.....E.....S................Q...........N......S..E...........A.....L....L.........R.....S.....P......H.......L..........-.......V....V..M....G.......V.......L.......D.....P....S.....S...AD..F.......................P...Q...S.L..Q.QL.......HDSA....S.EYymqe..........................ttksL...E...............H.........VT.....FV..................................WIDGV..........QW.AR...YV....S...kV....F....S....I....T......E.....K...........S........M....P....S....V..I.L.AHLKD...D....T......Y.YD..-...-...-...--...-....-.--.......---------adaqevrl................................................................................
A0A182GZ16_AEDAL/155-352               ..................................................................................................vgkq----DGILWDVFYSAA.EV.......YQPH......SYF.Y.....A...T...S.....V...EI......................AKRH.............FDI.DT....vP.A....A..L...V..YK..................................E.......RS.H.....Y.Y...F.P...Y..SDSfel..................iepVH..LN...E.S....L..F....R....W...V.........N..E.........E.............R..........F........P............T............F........P........K.................V.....T.....R................S...........N......I..H...........H.....I....L.........Q.....T.....K......K.......Y..........-.......L....V..L....A.......V.......V.......E.....E....N.....K...LS..Eiaah...............eqefR...D...M.V..E.IF......vHKNK....H.KY..................................H...G...............R.........FQ.....FG..................................WVG--..........-T.PD...LA....H....S....I....A....M....D......K.....L...........A........T....P....H....L..I.V.LNAST...N....E......H.HI..P...E...-...DDp.lQ....L.TP.......EAIELFLD-s.......................................................................................
D8TEH2_SELML/140-323                   ......................................................................................................FDKFEGDDYKSFIGAA.KQ.......EV-G......TPF.I.....Q...T...N.....S...LN......................VAQT.............FHS.SIr...kP.P....M..V...W..IQ..................................K.......NE.P....eF.Y...V.P...F..DG-........................TF..SA...Q.N....L..L....D....F...V.........E..L.........N.............K..........F........P............V............V........V........R.................M.....T.....S................K...........N......A..A...........R.....I....N.........S.....S.....P......L.......K..........L.......Q....V..L....L.......F.......A.......N.....-....-.....E...ID..V.......................K...T...V.L..P.LF.......EDAA....M.AF..................................K...G...............K.........LI.....FL..................................VVENSd........iDF.AM..pFL....S....M....Y....G....V....Q......-.....P...........E........K....P....V....I..V.A.FNYDN...G....Q......K.-F..L...L...-...EE...D....I.NL.......QNILAFCQN........................................................................................
A0A091LA26_CATAU/148-331               ......................................................................................................FEAKDSDNYRTFERVA.NI.......LHDD......CVF.L.....S...A...F.....-...GA......................ISKA.............ERF.SG.....D.N....V..I...-..YK..................................P.......PG.E.....N.A...P.D...M..VYLg......................sLT..NF...D.L....I..Y....A....W...T.........Q..D.........K.............C..........V........P............L............V........R........E.................I.....T.....F................E...........N......G..E...........E.....L....T.........E.....E.....G......L.......P..........F.......L....I..L....F.......H.......M.......K.....D....D.....L...ES..L.......................E...K...F.Q..Q.EV.......ARQL....I.SE..................................K...G...............T.........IN.....FL..................................HADCD..........KF.RH...PL....L....H....I....Q....K....T......P.....A...........D........C....P....V....I..A.-.IDSFR...H....M......Y.VF..P...D...F...SD...L....S.VP.......GKLKQFV--ld......................................................................................
A9RDR2_PHYPA/206-388                   ................................................................................................ldsvkg------ADAEEFIAVA.KQ.......ED-G......VEF.H.....M...T...A.....D...AQ......................IAKK.............FGL.ENk...tP.G....L..V...L..LK..................................K.......QN.E.....K.V...A.I...F..DGS........................-F..QR...T.S....I..G....N....F...V.........S..E.........N.............K..........R........P............L............V........I........P.................F.....S.....R................K...........T......A..S...........L.....I....F.........K.....S.....N......V.......K..........R.......Q....L..L....L.......F.......A.......N.....-....-.....I...AD..F.......................E...K...I.R..A.NY.......EEAA....K.SF..................................K...K...............K.........IV.....FA..................................LINLSd.......edVA.TS...IL....D....F....F....A....L....D......N.....E...........R........T....R....L....L..G.F.VS-ES...G....T......K.-Y..L...Y...-...DG...D....Y.SL.......DSLKQFSE-k.......................................................................................
A0A6G0HLQ2_LARCR/305-497               ......................................................................................................FSSEQDAAYEIYIEAC.NS.......LRED......FTF.R.....H...S...F.....S...SE......................VSKL.............LKA.SP.....G.Q....I..V...I..LH..................................P.......-E.K.....F.R...S.K...Y..EPAshtl................tmkdST..SV...S.E....V..Q....E....F...F.........K..K.........H.............V..........I........P............L............V........G........H.................R.....K.....P................S...........N.....dA..K...........R.....Y....T.........K.....R.....P......L.......V..........V.......V....YygV....D.......F.......S.......F.....D....Y.....R...KA..T.......................Q...F...W.R..S.KV.......LEVA....K.DY..................................P...E...............-.........YT.....FA..................................IADEE..........DF.AD...EL....K....S....L....G....L....S......E.....S...........G........E....E....V....N..V.A.IL-AD...G....G......K.KY..A...M...E...PE...E....F.DS.......EVLSDFVK-a.......................................................................................
A0A2Y9HBJ6_NEOSC/167-350               ......................................................................................................FEQKDSENYRVFERVA.NI.......LHDD......CAF.L.....S...A...F.....-...GA......................VSKP.............ERY.SG.....D.N....I..I...-..YK..................................P.......PG.H.....S.A...P.D...M..VYLg......................sMT..NF...D.G....T..Y....N....W...I.........Q..D.........K.............C..........V........P............L............V........R........E.................I.....T.....F................E...........N......G..E...........E.....L....T.........E.....E.....G......L.......P..........F.......L....I..L....F.......H.......M.......K.....E....D.....T...ES..L.......................E...I...F.Q..N.EV.......ARQL....I.SE..................................K...G...............T.........IN.....FL..................................HADCD..........KF.RH...PL....L....H....I....Q....K....T......P.....A...........D........C....P....V....I..A.-.IDSFR...H....M......Y.VF..G...D...F...RD...V....L.IP.......GKLKQFVFD........................................................................................
A0A091I000_CALAN/112-296               ......................................................................................................FKDATSEAAKEFLSAA.EA.......VD-D......IPF.G.....I...S...S.....S...AD......................VFTK.............YQL.SK.....D.G....V..V...L..FK..................................K.......FD.E.....G.R...N.N...F..EGD........................-L..KK...D.N....L..L....N....F...I.........K..A.........N.............S..........L........P............L............V........I........E.................F.....T.....E................Q...........T......A..P...........K.....I....F.........G.....G.....E......I.......K..........T.......H....I..L....L.......F.......L.......P.....K....S.....V...SD..Y.......................Q...G...K.L..D.NF.......KSAA....G.HF..................................K...G...............K.........IL.....FI..................................FIDSDh........sDN.QR...IL....E....F....F....G....L....K......K.....E...........E........C....P....A....V..R.L.ITLEE...E....M......T.KY..K...P...E...SD...D....I.TA.......DKIKEFCNK........................................................................................
A0A0Q9X0P2_DROWI/534-691               ....................................................................................................dq----------------.--.......--ND......IAF.V.....K...I...D.....D...DK......................EAKE.............WGI.DE....iP.S....I..V...L..FE..................................R.......GI.P.....H.-...-.I...Y..EGD........................LM..KE...D.E....L..L....G....W..lV.........H..Q.........K.............R..........Y........S............E............I........P........E.................V.....T.....D................E...........M......K..D...........K.....L....V.........E.....N.....T......-.......E..........H.......L....A..V....I.......F.......Y.......D.....K....D.....D...KQ..D.......................M...R...I.L..N.EL.......ENID....D.EL..................................E...K...............E........gIV.....IV..................................RID--..........-N.AA...EA....K....E....Y....G....L....D......-.....-...........H........L....P....A....L..I.Y.FE---...N....K......I.PA..L...Y...E...GD...L....M.NE.......DEVLEWL--l.......................................................................................
A0A3M0L245_HIRRU/191-377               ......................................................................................................FKDLSGEAARAFLEVA.AE.......MV-D......VTF.G.....V...A...E.....A...AE......................LFQA.............YGL.SA.....D.T....V..C...L..FK..................................K.......FD.E.....R.Q...T.N...F..PVDp.....................arGL..DT...A.E....L..T....R....L...L.........R..V.........H.............S..........L........Q............L............V........M........E.................F.....T.....N................E...........T......S..N...........Q.....I....F.........S.....A.....K......I.......P..........H.......H....M..L....L.......F.......L.......N.....K....S.....S...PE..Q.......................L...S...L.R..D.GF.......RAAA....G.GF..................................R...G...............E.........VL.....FV..................................VVDVT.........gHG.AD...VL....S....F....F....G....M....T......A.....A...........D........A....P....T....L..R.L.VKMEN...N....R......K.YQ..M...E...-...QD...N....F.SD.......SAIRTFIQ-g.......................................................................................
A0A287WG89_HORVV/14-123                ......................................................................................tksevlahavkgtsnv----------------.--.......----......---.-.....-...-...-.....-...--......................----.............---.--.....-.-....-..-...-..--..................................-.......--.-.....-.-...-.-...-..---........................--..--...-.-....-..-....-....-...-.........-..-.........-.............-..........-........-............-............-........-........-.................-.....-.....-................-...........-......L..K...........A.....C....S.........A.....M.....K......V.......Q..........-.......K....I..L....L.......F.......A.......V.....-....-.....A...KE..S.......................S...I...F.L..P.IL.......KETA....K.SF..................................N...G...............K.........LL.....FV..................................FVERDn.......eeVG.ER...VA....N....Y....F....G....I....T......G.....Q...........E........T....T....V....L..A.-.YTGNE...D....A......K.KF..F...F...-...SG...E....I.SL.......DNIK-----li......................................................................................
A0A5J5C8Q4_9ASTE/236-417               ..............................................................................................vgpeseel-------------AAA.SR.......IEDT......VNF.Y.....Q...T...V.....D...PD......................VAKLfh.........mdPNV.KR.....P.A....L..V...M..LK..................................K.......EA.E.....K.L...S.H...F..DGQ........................-F..MK...S.A....I..A....E....F...V.........F..A.........N.............K..........L........P............L............V........T........T.................F.....T.....R................E...........S......A..P...........M.....I....F.........E.....S.....P......I.......K..........K.......Q....L..L....L.......F.......A.......T.....S....N.....-...-D..S.......................E...R...V.V..L.TF.......QEAA....K.LF..................................K...G...............K.........LI.....FV..................................YVEMDn........eDV.GR...PV....S...dY....F....G....I....D......-.....G...........D........A....P....R....V..L.A.FTGND...D....G......K.KY..Y...L...-...DG...E....V.TL.......DKIKDF---ged.....................................................................................
A0A6A6NA91_HEVBR/221-386               ........................................................................................sdskvvlgyinslv----------------.--.......----......---.-.....-...-...-.....-...--......................LFHL............dPKV.KR.....P.A....L..V...L..IK..................................N.......-E.A.....E.K...L.N...Y..FDG........................NF..SK...S.E....I..V....E....F...V.........F..A.........N.............K..........L........P............L............V........T........T.................F.....T.....R................E...........S......A..P...........S.....I....F.........E.....S.....P......I.......K..........K.......Q....L..L....L.......F.......A.......T.....S....-.....-...ND..S.......................G...K...V.