GenomeNet

Database: Pfam
Entry: Toxin_ToxA
LinkDB: Toxin_ToxA
Original site: Toxin_ToxA 
#=GF ID   Toxin_ToxA
#=GF AC   PF11584.11
#=GF DE   Proteinaceous host-selective toxin ToxA
#=GF AU   Pollington J;0000-0002-8158-8998
#=GF SE   pdb_1zld
#=GF GA   25.00 25.00;
#=GF TC   26.20 209.60;
#=GF NC   24.70 20.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF CL   CL0389
#=GF RN   [1]
#=GF RM   16214901
#=GF RT   Structure of Ptr ToxA: an RGD-containing host-selective toxin
#=GF RT   from Pyrenophora tritici-repentis. 
#=GF RA   Sarma GN, Manning VA, Ciuffetti LM, Karplus PA; 
#=GF RL   Plant Cell. 2005;17:3190-3202.
#=GF DR   INTERPRO; IPR021635;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   ToxA is produced by particular Pyrenophora tritici-repentis
#=GF CC   races and is a proteinaceous host-selective toxin. It is
#=GF CC   necessary and sufficient to cause cell death in sensitive wheat
#=GF CC   cultivars [1].ToxA adopts a single-domain, beta-sandwich fold
#=GF CC   which has novel topology. The protein is directly involved in
#=GF CC   recognition events required for ToxA action. It is thought to be
#=GF CC   distantly related to FnIII proteins, gaining entry to the host
#=GF CC   via an integrin-like receptor [1].
#=GF SQ   3
#=GS B2W5I9_PYRTR/1-113   AC B2W5I9.1
#=GS M2URZ2_COCH5/46-160  AC M2URZ2.1
#=GS Q0TVA4_PHANO/61-177  AC Q0TVA4.2
B2W5I9_PYRTR/1-113              ----MSITINPSRPSVNNIGQVDIDSVILGRPGAIGSWELNNFITIGLNRVNADTVRVNIRNTGRTNRLIITQWD.NTVTRGDVYELFGDYALIQGRGSFCLNIRSDTGRENWRMQLE
M2URZ2_COCH5/46-160             QGSCVSISRPANNPSINNIGQIDITSVVNGGPGM--TWDLNNLVRVHVSREVDGSLSFDWTNTGSANRLIVTEWNsSSSTSGNGYVLLGSYGLPTGTGNICFPVGSGQGR-TWKMQLE
Q0TVA4_PHANO/61-177             QGSCMSITINPSRPSVNNIGQVDIDSVILGRPGAIGSWELNNFVTIGLNRVNANTVRVNINNTGRTNRLIITQWD.NTLTRGDVYELFGDYALIQGRGSFCLNIRSDSGRENWRMQLE
#=GC seq_cons                   QGSCMSITINPSRPSVNNIGQVDIDSVILGRPGAIGSWELNNFVTIGLNRVNAsTVRVNIsNTGRTNRLIITQWD.NTlTRGDVYELFGDYALIQGRGSFCLNIRSDoGRENWRMQLE
//
DBGET integrated database retrieval system