GenomeNet

Database: Pfam
Entry: UEV
LinkDB: UEV
Original site: UEV 
#=GF ID   UEV
#=GF AC   PF05743.16
#=GF DE   UEV domain
#=GF PI   Tsg101; 
#=GF AU   Moxon SJ;0000-0003-4644-1816
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Pfam-B_6022 (release 8.0)
#=GF GA   27.00 27.00;
#=GF TC   27.10 27.00;
#=GF NC   26.90 26.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF CL   CL0208
#=GF RN   [1]
#=GF RM   12482969
#=GF RT   Tsg101 is essential for cell growth, proliferation, and cell
#=GF RT   survival of embryonic and adult tissues. 
#=GF RA   Wagner KU, Krempler A, Qi Y, Park K, Henry MD, Triplett AA,
#=GF RA   Riedlinger G, Rucker III EB, Hennighausen L; 
#=GF RL   Mol Cell Biol 2003;23:150-162.
#=GF RN   [2]
#=GF RM   15053872
#=GF RT   Ubiquitin recognition by the human TSG101 protein. 
#=GF RA   Sundquist WI, Schubert HL, Kelly BN, Hill GC, Holton JM, Hill
#=GF RA   CP; 
#=GF RL   Mol Cell 2004;13:783-789.
#=GF DR   INTERPRO; IPR008883;
#=GF DR   SCOP; 1kpp; fa;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This family includes the eukaryotic tumour susceptibility gene
#=GF CC   101 protein (TSG101). Altered transcripts of this gene have been
#=GF CC   detected in sporadic breast cancers and many other human
#=GF CC   malignancies. However, the involvement of this gene in
#=GF CC   neoplastic transformation and tumorigenesis is still elusive.
#=GF CC   TSG101 is required for normal cell function of embryonic and
#=GF CC   adult tissues but that this gene is not a tumour suppressor for
#=GF CC   sporadic forms of breast cancer [1]. This family is related to
#=GF CC   the ubiquitin conjugating enzymes.
#=GF SQ   2588
#=GS A0A1R2AP69_9CILI/22-141     AC A0A1R2AP69.1
#=GS A0A397UES5_9GLOM/32-156     AC A0A397UES5.1
#=GS A0A0L7LM77_9NEOP/21-141     AC A0A0L7LM77.1
#=GS A0A0D1ZAZ9_9EURO/26-148     AC A0A0D1ZAZ9.1
#=GS A0A383V8V5_TETOB/34-155     AC A0A383V8V5.1
#=GS A0A6I9NGH5_9TELE/21-141     AC A0A6I9NGH5.1
#=GS I2H0Q9_TETBL/24-146         AC I2H0Q9.1
#=GS A0A5J9WVU3_9POAL/54-177     AC A0A5J9WVU3.1
#=GS A0A482SCM0_9ARCH/1-103      AC A0A482SCM0.1
#=GS TS101_DICDI/47-167          AC Q54LJ3.1
#=GS F7AJZ9_CALJA/1-103          AC F7AJZ9.2
#=GS A0A6P9A9L0_THRPL/65-167     AC A0A6P9A9L0.1
#=GS A0A1Z5TP61_HORWE/25-154     AC A0A1Z5TP61.1
#=GS A0A452FY44_CAPHI/14-134     AC A0A452FY44.1
#=GS A0A671PG62_9TELE/24-145     AC A0A671PG62.1
#=GS A0A6P7Y1Q5_9AMPH/33-153     AC A0A6P7Y1Q5.1
#=GS A0A2U3ZWC7_ODORO/1-112      AC A0A2U3ZWC7.1
#=GS A0A0N1P0F3_9EURO/29-152     AC A0A0N1P0F3.1
#=GS A0A2K5ZMN0_MANLE/36-119     AC A0A2K5ZMN0.1
#=GS V5GA62_BYSSN/421-543        AC V5GA62.1
#=GS J3LIS8_ORYBR/41-163         AC J3LIS8.1
#=GS A0A3B1K084_ASTMX/22-142     AC A0A3B1K084.1
#=GS A0A5A9PRJ4_9TELE/21-141     AC A0A5A9PRJ4.1
#=GS F6QUZ4_CALJA/36-156         AC F6QUZ4.2
#=GS A0A1S3IWS2_LINUN/24-144     AC A0A1S3IWS2.1
#=GS V4LPT5_EUTSA/36-153         AC V4LPT5.1
#=GS C4YAB8_CLAL4/26-162         AC C4YAB8.1
#=GS B6H2Y6_PENRW/32-154         AC B6H2Y6.1
#=GS A0A2K6UNQ3_SAIBB/21-141     AC A0A2K6UNQ3.1
#=GS A0A4Q4WDR7_9PEZI/25-147     AC A0A4Q4WDR7.1
#=GS A0A287SQ79_HORVV/26-150     AC A0A287SQ79.1
#=GS A0A5N5ND42_PANHP/21-141     AC A0A5N5ND42.1
#=GS A0A0J0XPB1_9TREE/24-148     AC A0A0J0XPB1.1
#=GS A0A0H2RP71_9AGAM/27-149     AC A0A0H2RP71.1
#=GS A0A2I3HW18_NOMLE/21-142     AC A0A2I3HW18.1
#=GS A0A2X0P6C8_9BASI/47-158     AC A0A2X0P6C8.1
#=GS A0A2S5BIK5_9BASI/18-141     AC A0A2S5BIK5.1
#=GS A0A5M3N1G5_CONPW/24-146     AC A0A5M3N1G5.1
#=GS A0A5A9PBF3_9TELE/39-160     AC A0A5A9PBF3.1
#=GS A0A2B7ZLP5_9EURO/33-155     AC A0A2B7ZLP5.1
#=GS A0A6P3R6B4_PTEVA/21-141     AC A0A6P3R6B4.1
#=GS A0A2B4SSR3_STYPI/18-138     AC A0A2B4SSR3.1
#=GS A0A0B1TGM3_OESDE/7-87       AC A0A0B1TGM3.1
#=GS A0A314YNZ2_PRUYE/2-123      AC A0A314YNZ2.1
#=GS A0A5D2YZP2_GOSMU/41-162     AC A0A5D2YZP2.1
#=GS A0A0S7DFU6_9EURO/70-185     AC A0A0S7DFU6.1
#=GS A0A2K5KNR8_CERAT/7-127      AC A0A2K5KNR8.1
#=GS A0A6P3IR59_BISBI/9-129      AC A0A6P3IR59.1
#=GS A0A5N6ZAS4_9EURO/33-155     AC A0A5N6ZAS4.1
#=GS A0A1J9QR92_9EURO/33-155     AC A0A1J9QR92.1
#=GS A0A6P8U4S0_GYMAC/1-65       AC A0A6P8U4S0.1
#=GS A0A3Q7RP01_VULVU/1-80       AC A0A3Q7RP01.1
#=GS A0A7M7SZX9_STRPU/24-144     AC A0A7M7SZX9.1
#=GS Q7S4R9_NEUCR/25-147         AC Q7S4R9.1
#=GS A0A3M7PXR2_BRAPC/66-186     AC A0A3M7PXR2.1
#=GS A0A6J0CI58_PERMB/18-123     AC A0A6J0CI58.1
#=GS A0A2P6QV45_ROSCH/36-157     AC A0A2P6QV45.1
#=GS A0A4W5JZL8_9TELE/22-142     AC A0A4W5JZL8.1
#=GS A0A060W8L8_ONCMY/24-146     AC A0A060W8L8.1
#=GS A0A3Q3NAH2_9TELE/24-145     AC A0A3Q3NAH2.2
#=GS A0A0E0RUR5_GIBZE/25-147     AC A0A0E0RUR5.1
#=GS A0A0A0AWF0_CHAVO/8-128      AC A0A0A0AWF0.1
#=GS A0A200QH97_9MAGN/33-149     AC A0A200QH97.1
#=GS A0A1E4RID3_9ASCO/2-144      AC A0A1E4RID3.1
#=GS A0A4W3IEG2_CALMI/1-103      AC A0A4W3IEG2.1
#=GS A0A669QVG4_PHACC/15-135     AC A0A669QVG4.1
#=GS A0A1Y2M722_EPING/25-147     AC A0A1Y2M722.1
#=GS A0A1R1Y0H4_9FUNG/26-169     AC A0A1R1Y0H4.1
#=GS A0A2I0UT15_LIMLA/499-619    AC A0A2I0UT15.1
#=GS E4XLR9_OIKDI/18-138         AC E4XLR9.1
#=GS A0A671REU3_9TELE/21-133     AC A0A671REU3.1
#=GS A0A0M9A6L5_9HYME/32-152     AC A0A0M9A6L5.1
#=GS A0A0D2Q3U6_GOSRA/34-155     AC A0A0D2Q3U6.1
#=GS A0A0D1ZTB8_EXOME/1-49       AC A0A0D1ZTB8.1
#=GS A0A3Q0CHI7_MESAU/21-141     AC A0A3Q0CHI7.1
#=GS A0A1Y2HNI7_9FUNG/25-115     AC A0A1Y2HNI7.1
#=GS A0A094GEY4_9PEZI/26-148     AC A0A094GEY4.1
#=GS A0A6P7IHQ3_9TELE/21-141     AC A0A6P7IHQ3.1
#=GS A0A2Y9PAR5_DELLE/1-89       AC A0A2Y9PAR5.1
#=GS S2JCU0_MUCC1/20-141         AC S2JCU0.1
#=GS A0A3Q2ZW01_KRYMA/22-142     AC A0A3Q2ZW01.1
#=GS W4GT51_9STRA/25-145         AC W4GT51.1
#=GS A0A5J5MGA1_MUNRE/21-60      AC A0A5J5MGA1.1
#=GS W5PID5_SHEEP/21-141         AC W5PID5.1
#=GS A0A2G5DDC1_AQUCA/40-161     AC A0A2G5DDC1.1
#=GS A0A5B8MLP0_9CHLO/109-230    AC A0A5B8MLP0.1
#=GS A0A3B6MZ42_WHEAT/30-154     AC A0A3B6MZ42.1
#=GS C4R3M9_KOMPG/25-159         AC C4R3M9.1
#=GS A0A341D0K7_NEOAA/21-141     AC A0A341D0K7.1
#=GS A0A1L8GI47_XENLA/21-141     AC A0A1L8GI47.1
#=GS A0A183BH29_9TREM/24-104     AC A0A183BH29.1
#=GS A0A665TUK9_ECHNA/16-136     AC A0A665TUK9.1
#=GS A0A667WPS3_9TELE/22-142     AC A0A667WPS3.1
#=GS A0A6P5T4Z8_PRUAV/48-172     AC A0A6P5T4Z8.1
#=GS A0A3M7N3F4_9EURO/52-174     AC A0A3M7N3F4.1
#=GS A0A4S2JHF4_9HYME/25-145     AC A0A4S2JHF4.1
#=GS A0A663M501_ATHCN/1-47       AC A0A663M501.1
#=GS W9C8Y3_SCLBF/26-148         AC W9C8Y3.1
#=GS A0A3Q7RF78_VULVU/21-141     AC A0A3Q7RF78.1
#=GS K3W4Y0_GLOUD/25-146         AC K3W4Y0.1
#=GS F0XDK4_GROCL/25-147         AC F0XDK4.1
#=GS A0A6I8QX42_XENTR/21-141     AC A0A6I8QX42.2
#=GS A0A3Q7RE83_VULVU/21-141     AC A0A3Q7RE83.1
#=GS A0A1E5V0J5_9POAL/43-165     AC A0A1E5V0J5.1
#=GS A0A2U1LP95_ARTAN/1-59       AC A0A2U1LP95.1
#=GS A0A1B0GS10_MOUSE/64-106     AC A0A1B0GS10.1
#=GS A0A4Y7INC5_PAPSO/33-149     AC A0A4Y7INC5.1
#=GS A0A1X0NHS1_9TRYP/72-158     AC A0A1X0NHS1.1
#=GS A0A498N006_LABRO/128-248    AC A0A498N006.1
#=GS H3APP2_LATCH/21-141         AC H3APP2.2
#=GS A0A3B1JD81_ASTMX/34-146     AC A0A3B1JD81.1
#=GS A0A5K4F9H6_SCHMA/21-141     AC A0A5K4F9H6.1
#=GS A0A3Q7XMW7_URSAR/23-143     AC A0A3Q7XMW7.1
#=GS A0A4P9W483_9FUNG/7-114      AC A0A4P9W483.1
#=GS A0A671G1Y9_RHIFE/423-543    AC A0A671G1Y9.1
#=GS A0A1R2CFS4_9CILI/25-143     AC A0A1R2CFS4.1
#=GS G9NY91_HYPAI/25-147         AC G9NY91.1
#=GS A0A093GCU2_DRYPU/10-129     AC A0A093GCU2.1
#=GS Q7Q6B6_ANOGA/22-142         AC Q7Q6B6.4
#=GS W2S6U5_9EURO/28-151         AC W2S6U5.1
#=GS A0A1U8BD99_NELNU/33-152     AC A0A1U8BD99.1
#=GS A0A4U5QF48_POPAL/37-158     AC A0A4U5QF48.1
#=GS A0A177V1Y4_9BASI/25-147     AC A0A177V1Y4.1
#=GS A0A5F9DEW6_RABIT/21-72      AC A0A5F9DEW6.1
#=GS A0A2A3E0U5_APICC/22-142     AC A0A2A3E0U5.1
#=GS A0A074YKE3_AURPU/26-149     AC A0A074YKE3.1
#=GS A0A1S3EA67_CICAR/40-161     AC A0A1S3EA67.1
#=GS A0A6J0P0K1_RAPSA/37-158     AC A0A6J0P0K1.1
#=GS A0A6J5U1Y0_PRUAR/41-162     AC A0A6J5U1Y0.1
#=GS A0A383ZIC4_BALAS/21-141     AC A0A383ZIC4.1
#=GS A0A2P5D9A9_TREOI/44-165     AC A0A2P5D9A9.1
#=GS W9IHE0_FUSOX/25-147         AC W9IHE0.1
#=GS J9JJA5_ACYPI/22-142         AC J9JJA5.1
#=GS A0A6J0KE37_RAPSA/41-162     AC A0A6J0KE37.1
#=GS A0A3L8SWZ1_CHLGU/21-141     AC A0A3L8SWZ1.1
#=GS A0A182G9Q0_AEDAL/17-137     AC A0A182G9Q0.1
#=GS A0A7J6IJ73_COLFN/25-147     AC A0A7J6IJ73.1
#=GS G5A206_PHYSP/25-145         AC G5A206.1
#=GS D8PKB0_SCHCM/28-150         AC D8PKB0.1
#=GS A0A6G1B1H0_CROCR/29-149     AC A0A6G1B1H0.1
#=GS Q0CS33_ASPTN/33-155         AC Q0CS33.1
#=GS A0A669R143_PHACC/22-142     AC A0A669R143.1
#=GS A0A1V9Z0E3_9STRA/26-146     AC A0A1V9Z0E3.1
#=GS A0A665TWE7_ECHNA/21-141     AC A0A665TWE7.1
#=GS A0A3L6RCI8_PANMI/29-152     AC A0A3L6RCI8.1
#=GS A0A1S3JUC1_LINUN/24-144     AC A0A1S3JUC1.1
#=GS A0A6P6ESC1_OCTDE/21-141     AC A0A6P6ESC1.1
#=GS A0A0P1A980_PLAHL/976-1096   AC A0A0P1A980.1
#=GS A0A4W2E5C7_BOBOX/21-127     AC A0A4W2E5C7.1
#=GS A0A0D0AGP2_9AGAM/24-146     AC A0A0D0AGP2.1
#=GS A0A6A6Z769_9PEZI/26-148     AC A0A6A6Z769.1
#=GS A0A5F9CE76_RABIT/21-141     AC A0A5F9CE76.1
#=GS H6BPL4_EXODN/26-148         AC H6BPL4.1
#=GS A0A6P7L0K5_BETSP/24-145     AC A0A6P7L0K5.1
#=GS A0A2Y9RDU0_TRIMA/1-47       AC A0A2Y9RDU0.1
#=GS R0FIL7_9BRAS/36-157         AC R0FIL7.1
#=GS A0A2K5I6D8_COLAP/12-132     AC A0A2K5I6D8.1
#=GS A0A0C2TR12_AMAMU/24-146     AC A0A0C2TR12.1
#=GS A0A1G4IQB5_9SACH/31-148     AC A0A1G4IQB5.1
#=GS A0A3Q1J2S4_ANATE/22-142     AC A0A3Q1J2S4.2
#=GS O76258_CAEEL/21-141         AC O76258.2
#=GS A0A3Q7X1B8_URSAR/23-143     AC A0A3Q7X1B8.1
#=GS A0A1R3KY17_COCAP/41-162     AC A0A1R3KY17.1
#=GS A0A1Z5KPY1_FISSO/26-147     AC A0A1Z5KPY1.1
#=GS K1VD15_TRIAC/23-131         AC K1VD15.1
#=GS H0X073_OTOGA/21-141         AC H0X073.1
#=GS A0A5E4NG73_9HEMI/1-65       AC A0A5E4NG73.1
#=GS B4KZ07_DROMO/22-142         AC B4KZ07.1
#=GS F7B2L2_CALJA/18-138         AC F7B2L2.2
#=GS A0A673MLM2_9TELE/1-107      AC A0A673MLM2.1
#=GS A0A6P5AV40_BOSIN/1-102      AC A0A6P5AV40.1
#=GS A0A0B7F4L8_THACB/23-145     AC A0A0B7F4L8.1
#=GS A0A0K8LAE5_9EURO/74-190     AC A0A0K8LAE5.1
#=GS A0A1V6YVZ7_PENNA/32-154     AC A0A1V6YVZ7.1
#=GS A0A3N4K2V6_9PEZI/31-153     AC A0A3N4K2V6.1
#=GS A0A3R7GBA4_9EURO/33-155     AC A0A3R7GBA4.1
#=GS A0A7N8YG63_9TELE/3-119      AC A0A7N8YG63.1
#=GS A0A6P6JS58_CARAU/24-145     AC A0A6P6JS58.1
#=GS A0A1F8A0S3_9EURO/33-155     AC A0A1F8A0S3.1
#=GS W5LXD4_LEPOC/23-143         AC W5LXD4.1
#=GS A0A2T9Z6D2_9FUNG/27-149     AC A0A2T9Z6D2.1
#=GS A0A178Z701_9EURO/26-148     AC A0A178Z701.1
#=GS A0A674DPI4_SALTR/21-141     AC A0A674DPI4.1
#=GS A0A3N4HRU4_ASCIM/1-93       AC A0A3N4HRU4.1
#=GS A0A6I9Y497_9SAUR/21-141     AC A0A6I9Y497.1
#=GS A0A2T3B3V4_AMORE/28-150     AC A0A2T3B3V4.1
#=GS A0A7N8Y4E5_9TELE/22-142     AC A0A7N8Y4E5.1
#=GS A0A2K5ZAD9_MANLE/21-141     AC A0A2K5ZAD9.1
#=GS A0A5J5MGA1_MUNRE/61-121     AC A0A5J5MGA1.1
#=GS A0A4S8LPJ3_DENBC/21-143     AC A0A4S8LPJ3.1
#=GS A0A6P3IR03_BISBI/1-47       AC A0A6P3IR03.1
#=GS A0A671RF73_9TELE/21-141     AC A0A671RF73.1
#=GS A0A2K5ZMR4_MANLE/1-103      AC A0A2K5ZMR4.1
#=GS A0A2K6DP04_MACNE/21-141     AC A0A2K6DP04.1
#=GS A0A3Q1CD33_AMPOC/24-145     AC A0A3Q1CD33.1
#=GS A0A1Y2V0U0_9PEZI/25-147     AC A0A1Y2V0U0.1
#=GS A0A674KHA9_TERCA/21-141     AC A0A674KHA9.1
#=GS A0A5M6BYK4_9TREE/24-146     AC A0A5M6BYK4.1
#=GS A0A4U5R6X0_POPAL/33-152     AC A0A4U5R6X0.1
#=GS A0A6I9W424_9HYME/25-145     AC A0A6I9W424.1
#=GS A0A446UJL9_TRITD/43-165     AC A0A446UJL9.1
#=GS A0A6P4XUM5_BRABE/232-353    AC A0A6P4XUM5.1
#=GS A0A6J2AG84_ACIJB/4-105      AC A0A6J2AG84.1
#=GS A0A232EJM5_9HYME/25-172     AC A0A232EJM5.1
#=GS A0A024G5B4_9STRA/19-139     AC A0A024G5B4.1
#=GS A0A093HNL6_STRCA/10-129     AC A0A093HNL6.1
#=GS A0A5A7SSD8_CUCME/44-165     AC A0A5A7SSD8.1
#=GS A0A091FSA7_9AVES/8-128      AC A0A091FSA7.1
#=GS A0A1L9RND3_ASPWE/33-155     AC A0A1L9RND3.1
#=GS A0A398ABS0_BRACM/27-144     AC A0A398ABS0.1
#=GS T0MIV5_CAMFR/246-347        AC T0MIV5.1
#=GS F1QGE6_DANRE/22-142         AC F1QGE6.2
#=GS A0A5N5WX30_9EURO/33-155     AC A0A5N5WX30.1
#=GS A0A3P8Z5M4_ESOLU/42-120     AC A0A3P8Z5M4.1
#=GS A0A4U1FR35_MONMO/63-103     AC A0A4U1FR35.1
#=GS A0A017S2A7_9EURO/33-155     AC A0A017S2A7.1
#=GS A0A3P9Q3Y5_POERE/22-142     AC A0A3P9Q3Y5.1
#=GS A0A6J2VF15_CHACN/24-145     AC A0A6J2VF15.1
#=GS A0A226MTH4_CALSU/21-141     AC A0A226MTH4.1
#=GS A0A1S3KKT3_SALSA/11-116     AC A0A1S3KKT3.1
#=GS A0A2I4EGI7_JUGRE/44-165     AC A0A2I4EGI7.1
#=GS A0A2I3GC93_NOMLE/36-120     AC A0A2I3GC93.1
#=GS A0A3Q1GUL1_9TELE/22-142     AC A0A3Q1GUL1.1
#=GS G3PB52_GASAC/21-141         AC G3PB52.1
#=GS A0A4P9Z856_9ASCO/26-160     AC A0A4P9Z856.1
#=GS A0A444C159_ENSVE/33-153     AC A0A444C159.1
#=GS A0A6J3MD14_9PEZI/25-147     AC A0A6J3MD14.1
#=GS A0A317SLK7_9PEZI/31-153     AC A0A317SLK7.1
#=GS A0A6D2HNR6_9BRAS/37-158     AC A0A6D2HNR6.1
#=GS A0A199W4Z4_ANACO/37-151     AC A0A199W4Z4.1
#=GS A0A3Q7PKM2_CALUR/21-141     AC A0A3Q7PKM2.1
#=GS M0SI59_MUSAM/38-162         AC M0SI59.1
#=GS A0A2H1A1Q6_CANAR/26-163     AC A0A2H1A1Q6.1
#=GS A0A6P5BKE1_BOSIN/30-80      AC A0A6P5BKE1.1
#=GS A0A5N6F542_9EURO/33-155     AC A0A5N6F542.1
#=GS A0A2K5V1D3_MACFA/21-141     AC A0A2K5V1D3.1
#=GS A0A1V6SC06_9EURO/32-154     AC A0A1V6SC06.1
#=GS UEVLD_MOUSE/21-141          AC Q3U1V6.1
#=GS A0A6J3ATP7_VICPA/9-129      AC A0A6J3ATP7.1
#=GS A0A2L2TP33_9HYPO/25-147     AC A0A2L2TP33.1
#=GS A0A0F4YI01_TALEM/33-164     AC A0A0F4YI01.1
#=GS A0A1U8MV58_GOSHI/34-155     AC A0A1U8MV58.1
#=GS A0A364KMA8_9EURO/400-522    AC A0A364KMA8.1
#=GS A0A6P4YC35_BRABE/9-121      AC A0A6P4YC35.1
#=GS A0A286X7I2_CAVPO/1-89       AC A0A286X7I2.1
#=GS F4P9F9_BATDJ/1-120          AC F4P9F9.1
#=GS A0A2P6NWA4_9EUKA/27-148     AC A0A2P6NWA4.1
#=GS A0A2U4CDT0_TURTR/34-154     AC A0A2U4CDT0.2
#=GS D8T0J2_SELML/38-159         AC D8T0J2.1
#=GS A0A0L0SU60_ALLM3/26-146     AC A0A0L0SU60.1
#=GS A0A672KPX2_SINGR/10-54      AC A0A672KPX2.1
#=GS A0A6I9QZH3_ELAGV/32-151     AC A0A6I9QZH3.1
#=GS B7QIP7_IXOSC/22-142         AC B7QIP7.1
#=GS A0A6D2JZX9_9BRAS/46-158     AC A0A6D2JZX9.1
#=GS A0A3D8R0B7_9EURO/33-155     AC A0A3D8R0B7.1
#=GS ELC_ARATH/37-158            AC Q9LHG8.1
#=GS A0A1S3BEQ5_CUCME/44-165     AC A0A1S3BEQ5.1
#=GS A0A195CCW6_9HYME/22-142     AC A0A195CCW6.1
#=GS R4FP34_RHOPR/7-127          AC R4FP34.1
#=GS A0A6P6MEQ4_CARAU/21-141     AC A0A6P6MEQ4.1
#=GS A0A6A4LJ31_9ERIC/33-152     AC A0A6A4LJ31.1
#=GS A0A6P7H453_DIAVI/20-140     AC A0A6P7H453.1
#=GS A0A176VQB4_MARPO/39-160     AC A0A176VQB4.1
#=GS A0A665TRX0_ECHNA/22-142     AC A0A665TRX0.1
#=GS A0A162IJI4_9HYPO/56-171     AC A0A162IJI4.1
#=GS A0A0L0N0E3_TOLOC/25-147     AC A0A0L0N0E3.1
#=GS A0A2K6KQG4_RHIBE/69-189     AC A0A2K6KQG4.1
#=GS W1P3D6_AMBTC/35-156         AC W1P3D6.1
#=GS K1RAV3_CRAGI/33-153         AC K1RAV3.1
#=GS A0A2N5TAW0_9BASI/19-141     AC A0A2N5TAW0.1
#=GS Q4DJK6_TRYCC/140-223        AC Q4DJK6.1
#=GS G1MHQ6_AILME/21-141         AC G1MHQ6.1
#=GS A0A1D2M6L0_ORCCI/45-118     AC A0A1D2M6L0.1
#=GS A0A420U7W5_FUSOX/25-147     AC A0A420U7W5.1
#=GS W7HTD1_9PEZI/27-149         AC W7HTD1.1
#=GS A0A2B7XLK5_9EURO/33-155     AC A0A2B7XLK5.1
#=GS W9XA66_9EURO/26-148         AC W9XA66.1
#=GS A0A2K5N2K8_CERAT/21-101     AC A0A2K5N2K8.1
#=GS A0A5N3XV07_MUNRE/38-158     AC A0A5N3XV07.1
#=GS A0A1S2Z9F9_ERIEU/36-119     AC A0A1S2Z9F9.1
#=GS A0A672LBX7_SINGR/23-143     AC A0A672LBX7.1
#=GS A0A1Y1HW97_KLENI/42-163     AC A0A1Y1HW97.1
#=GS Q4DUY3_TRYCC/77-162         AC Q4DUY3.1
#=GS A0A5E4EPT6_PRUDU/47-168     AC A0A5E4EPT6.1
#=GS A0A2C9W5C3_MANES/40-161     AC A0A2C9W5C3.1
#=GS A8NFJ3_COPC7/21-143         AC A8NFJ3.2
#=GS A0A5E4CBX8_MARMO/21-141     AC A0A5E4CBX8.1
#=GS A0A099ZLR0_TINGU/8-128      AC A0A099ZLR0.1
#=GS A0A3Q3X6E3_MOLML/2-106      AC A0A3Q3X6E3.1
#=GS T0QDE1_SAPDV/27-147         AC T0QDE1.1
#=GS H3ECX1_PRIPA/40-160         AC H3ECX1.2
#=GS A0A0A2L128_PENIT/32-154     AC A0A0A2L128.1
#=GS A0A1X7RHP8_ZYMTR/25-147     AC A0A1X7RHP8.1
#=GS C6HLQ0_AJECH/33-120         AC C6HLQ0.1
#=GS A0A194XEZ2_9HELO/26-148     AC A0A194XEZ2.1
#=GS A0A1G4MFQ7_LACFM/28-149     AC A0A1G4MFQ7.1
#=GS A0A5J9WM40_9POAL/42-164     AC A0A5J9WM40.1
#=GS B4H4C4_DROPE/22-142         AC B4H4C4.1
#=GS A0A091KRS5_9GRUI/8-127      AC A0A091KRS5.1
#=GS A0A5A7QPK8_STRAF/124-210    AC A0A5A7QPK8.1
#=GS A0A1L0DLW4_9ASCO/26-161     AC A0A1L0DLW4.1
#=GS A0A4P9ZX35_9FUNG/23-150     AC A0A4P9ZX35.1
#=GS A0A286UUE3_9AGAM/23-145     AC A0A286UUE3.1
#=GS A0A1S3KL34_SALSA/22-142     AC A0A1S3KL34.1
#=GS A0A2N5SU59_9BASI/19-141     AC A0A2N5SU59.1
#=GS A0A1U8A8W4_NELNU/38-159     AC A0A1U8A8W4.1
#=GS A0A016SD90_9BILA/23-143     AC A0A016SD90.1
#=GS A0A3R7D102_CLOSI/1-47       AC A0A3R7D102.1
#=GS A0A5F8GVK3_MONDO/21-141     AC A0A5F8GVK3.1
#=GS C4M9Z1_ENTHI/46-139         AC C4M9Z1.1
#=GS A0A6J0XHH1_ODOVR/1-47       AC A0A6J0XHH1.1
#=GS A0A0L1J1T8_ASPNO/405-527    AC A0A0L1J1T8.1
#=GS E5R1C7_ARTGP/28-150         AC E5R1C7.1
#=GS A0A6J2HZW0_9PASS/21-140     AC A0A6J2HZW0.2
#=GS A0A2K5SC42_CEBIM/69-189     AC A0A2K5SC42.1
#=GS A0A287AW55_PIG/1-103        AC A0A287AW55.2
#=GS A0A5F5PLM2_HORSE/37-119     AC A0A5F5PLM2.1
#=GS A0A177WWW4_BATDL/1-120      AC A0A177WWW4.1
#=GS A0A195EGD8_9HYME/22-142     AC A0A195EGD8.1
#=GS A0A6J2AK85_ACIJB/14-134     AC A0A6J2AK85.1
#=GS B0XLN9_CULQU/523-642        AC B0XLN9.1
#=GS A0A2Y9D898_TRIMA/21-141     AC A0A2Y9D898.1
#=GS A0A674KEW1_TERCA/21-141     AC A0A674KEW1.1
#=GS A0A080WI68_TRIRC/1-58       AC A0A080WI68.1
#=GS A0A1R3KXC0_9ROSI/24-145     AC A0A1R3KXC0.1
#=GS L8I8S7_9CETA/8-128          AC L8I8S7.1
#=GS A0A398A238_BRACM/37-158     AC A0A398A238.1
#=GS A0A5N6PEA9_9ASTR/33-152     AC A0A5N6PEA9.1
#=GS A0A368H4P5_ANCCA/23-143     AC A0A368H4P5.1
#=GS A0A2U1MKZ3_ARTAN/28-149     AC A0A2U1MKZ3.1
#=GS A0A1A6AH82_9TREE/24-146     AC A0A1A6AH82.1
#=GS A0A2Y9S8Q2_PHYMC/21-141     AC A0A2Y9S8Q2.1
#=GS A0A0C3HBN5_9PEZI/26-148     AC A0A0C3HBN5.1
#=GS A0A1S3FGR5_DIPOR/21-141     AC A0A1S3FGR5.1
#=GS A0A672TQT7_STRHB/21-141     AC A0A672TQT7.1
#=GS A0A2S6CGF2_9PEZI/494-616    AC A0A2S6CGF2.1
#=GS G3WRC7_SARHA/21-141         AC G3WRC7.2
#=GS U5D8G3_AMBTC/40-161         AC U5D8G3.1
#=GS A0A093YRI9_9PEZI/26-148     AC A0A093YRI9.1
#=GS A0A183L4S3_9TREM/1-78       AC A0A183L4S3.1
#=GS G1X8K1_ARTOA/45-151         AC G1X8K1.1
#=GS J7RAK5_KAZNA/38-160         AC J7RAK5.1
#=GS A0A2Y9RDR0_TRIMA/21-141     AC A0A2Y9RDR0.1
#=GS A0A3P9CN69_9CICH/22-142     AC A0A3P9CN69.1
#=GS D7KZS2_ARALL/37-158         AC D7KZS2.1
#=GS A0A1U7RE64_ALLSI/21-141     AC A0A1U7RE64.1
#=GS A0A642UH28_DIURU/25-162     AC A0A642UH28.1
#=GS A0A2V1AYX7_9ASCO/26-163     AC A0A2V1AYX7.1
#=GS A0A2P6V3Y2_9CHLO/34-155     AC A0A2P6V3Y2.1
#=GS B4MMU9_DROWI/22-142         AC B4MMU9.1
#=GS A0A5N6KQW5_9ROSI/54-163     AC A0A5N6KQW5.1
#=GS A0A0P7UF22_SCLFO/19-105     AC A0A0P7UF22.1
#=GS A0A5N6TDU3_9EURO/33-155     AC A0A5N6TDU3.1
#=GS A0A5A7PFN2_STRAF/83-153     AC A0A5A7PFN2.1
#=GS A0A0M9FWV1_9TRYP/73-173     AC A0A0M9FWV1.1
#=GS A0A5A8CK82_CAFRO/24-148     AC A0A5A8CK82.1
#=GS A0A1S3IUW8_LINUN/85-205     AC A0A1S3IUW8.1
#=GS A0A0K0FY90_STRVS/20-140     AC A0A0K0FY90.1
#=GS A0A5D2UPN2_GOSMU/41-133     AC A0A5D2UPN2.1
#=GS A0A1Y2VYS8_9PEZI/25-147     AC A0A1Y2VYS8.1
#=GS A0A2U9BIL4_SCOMX/24-145     AC A0A2U9BIL4.1
#=GS A0A1S3W293_ERIEU/21-141     AC A0A1S3W293.1
#=GS A0A3Q7PK46_CALUR/23-143     AC A0A3Q7PK46.1
#=GS A0A6P8F2J8_CLUHA/24-145     AC A0A6P8F2J8.1
#=GS A0A372RQD5_9GLOM/27-151     AC A0A372RQD5.1
#=GS A0A6P7KYC3_BETSP/24-145     AC A0A6P7KYC3.1
#=GS I0Z3J2_COCSC/36-157         AC I0Z3J2.1
#=GS A0A6I9QX82_ELAGV/33-150     AC A0A6I9QX82.1
#=GS A0A7E5A0A2_PANRE/23-143     AC A0A7E5A0A2.1
#=GS A0A2K6RHQ0_RHIRO/21-141     AC A0A2K6RHQ0.1
#=GS A0A401SKM9_CHIPU/21-141     AC A0A401SKM9.1
#=GS A0A3G2S6A7_9BASI/23-145     AC A0A3G2S6A7.1
#=GS A0A5N7B6F4_9EURO/33-155     AC A0A5N7B6F4.1
#=GS R9AFS0_WALI9/23-145         AC R9AFS0.1
#=GS A0A2U3X0Z7_ODORO/37-119     AC A0A2U3X0Z7.1
#=GS A0A383ZIG5_BALAS/21-141     AC A0A383ZIG5.1
#=GS A0A2R6R126_ACTCC/45-166     AC A0A2R6R126.1
#=GS A0A2T7P4Y9_POMCA/540-660    AC A0A2T7P4Y9.1
#=GS A0A3Q2GFJ8_CYPVA/21-141     AC A0A3Q2GFJ8.1
#=GS W5PI27_SHEEP/21-141         AC W5PI27.1
#=GS A0A2U4CDT5_TURTR/1-47       AC A0A2U4CDT5.2
#=GS A0A5F4W9X2_CALJA/36-148     AC A0A5F4W9X2.1
#=GS A0A7N5KA92_AILME/36-119     AC A0A7N5KA92.1
#=GS A0A5F5PX43_HORSE/21-141     AC A0A5F5PX43.1
#=GS A0A485L049_9STRA/25-145     AC A0A485L049.1
#=GS A0A314XYG9_PRUYE/48-166     AC A0A314XYG9.1
#=GS A0A0Q3I8R7_BRADI/42-164     AC A0A0Q3I8R7.1
#=GS A0A673K0M3_9TELE/12-128     AC A0A673K0M3.1
#=GS A0A6P6MPM0_CARAU/24-145     AC A0A6P6MPM0.1
#=GS A0A2I0AM06_9ASPA/52-173     AC A0A2I0AM06.1
#=GS A0A091D757_FUKDA/76-196     AC A0A091D757.1
#=GS A0A1F5LBM0_9EURO/32-154     AC A0A1F5LBM0.1
#=GS A0A2H5PRU2_CITUN/41-162     AC A0A2H5PRU2.1
#=GS A0A553PCQ9_TIGCA/25-145     AC A0A553PCQ9.1
#=GS A0A1W0X549_HYPDU/470-520    AC A0A1W0X549.1
#=GS A0A2I3HE51_NOMLE/21-142     AC A0A2I3HE51.1
#=GS A0A067DDL2_CITSI/41-162     AC A0A067DDL2.1
#=GS A0A6G1PFI8_9TELE/22-142     AC A0A6G1PFI8.1
#=GS A0A5J5D6X5_9PERO/22-142     AC A0A5J5D6X5.1
#=GS A0A5N4DMQ7_CAMDR/21-141     AC A0A5N4DMQ7.1
#=GS A0A2K6KQJ8_RHIBE/21-141     AC A0A2K6KQJ8.1
#=GS A0A183WE80_TRIRE/21-128     AC A0A183WE80.1
#=GS A0A3R7P236_PENVA/24-144     AC A0A3R7P236.1
#=GS A0A3P9Q359_POERE/21-129     AC A0A3P9Q359.1
#=GS A0A2U3X0Z1_ODORO/21-141     AC A0A2U3X0Z1.1
#=GS A0A445HJK2_GLYSO/34-155     AC A0A445HJK2.1
#=GS A0A6J1U656_9SAUR/21-141     AC A0A6J1U656.1
#=GS A0A2I0W013_9ASPA/43-164     AC A0A2I0W013.1
#=GS A0A6J3RVA4_TURTR/21-141     AC A0A6J3RVA4.1
#=GS A0A091W717_OPIHO/8-127      AC A0A091W717.1
#=GS F4S7B0_MELLP/23-145         AC F4S7B0.1
#=GS E1ZQP5_CHLVA/29-140         AC E1ZQP5.1
#=GS A0A2U9BWU3_SCOMX/21-141     AC A0A2U9BWU3.1
#=GS K7F3U4_PELSI/14-134         AC K7F3U4.1
#=GS S7RTX8_GLOTA/23-145         AC S7RTX8.1
#=GS W2QT70_PHYPN/25-145         AC W2QT70.1
#=GS A0A6A2YUN1_HIBSY/41-162     AC A0A6A2YUN1.1
#=GS A0A0D2GS94_9EURO/26-148     AC A0A0D2GS94.1
#=GS A0A6P8V3D5_GYMAC/11-131     AC A0A6P8V3D5.1
#=GS A0A2K5SC88_CEBIM/21-141     AC A0A2K5SC88.1
#=GS A0A673N5K6_9TELE/31-81      AC A0A673N5K6.1
#=GS A0A137Q4B8_9AGAR/21-143     AC A0A137Q4B8.1
#=GS A0A2G4T994_RHIZD/9-130      AC A0A2G4T994.1
#=GS A0A643C336_BALPH/7-127      AC A0A643C336.1
#=GS A0A287S681_HORVV/101-223    AC A0A287S681.1
#=GS A0A1E3B1H8_9EURO/33-155     AC A0A1E3B1H8.1
#=GS A0A328DSS0_9ASTE/41-162     AC A0A328DSS0.1
#=GS A0A3P8SN78_AMPPE/21-141     AC A0A3P8SN78.1
#=GS A0A2G3CTM6_CAPCH/50-170     AC A0A2G3CTM6.1
#=GS A0A3Q4MZ44_NEOBR/24-145     AC A0A3Q4MZ44.1
#=GS A0A674P2S1_TAKRU/21-141     AC A0A674P2S1.1
#=GS A0A4Z2JC71_9TELE/22-142     AC A0A4Z2JC71.1
#=GS A0A455CC02_PHYMC/21-141     AC A0A455CC02.1
#=GS A0A3B0KNR9_DROGU/22-142     AC A0A3B0KNR9.1
#=GS A0A2I0UT15_LIMLA/21-140     AC A0A2I0UT15.1
#=GS A0A6P5YQ93_DURZI/37-158     AC A0A6P5YQ93.1
#=GS A0A6P6A421_DURZI/33-153     AC A0A6P6A421.1
#=GS W3XDQ3_PESFW/25-147         AC W3XDQ3.1
#=GS A0A0R3T6J5_RODNA/383-503    AC A0A0R3T6J5.1
#=GS A0A3B6MWR5_WHEAT/43-165     AC A0A3B6MWR5.1
#=GS A0A672M2Q1_SINGR/24-145     AC A0A672M2Q1.1
#=GS A0A1S9DB08_ASPOZ/382-504    AC A0A1S9DB08.1
#=GS A0A498NB59_LABRO/22-142     AC A0A498NB59.1
#=GS A0A2I0S0C1_9PEZI/25-147     AC A0A2I0S0C1.1
#=GS A0A7M7M2M7_NASVI/25-145     AC A0A7M7M2M7.1
#=GS A0A383ZJ66_BALAS/21-141     AC A0A383ZJ66.1
#=GS A0A1Y2WM51_9PEZI/25-147     AC A0A1Y2WM51.1
#=GS A0A2K5DC34_AOTNA/21-141     AC A0A2K5DC34.1
#=GS A0A4V1XDG8_9PEZI/25-147     AC A0A4V1XDG8.1
#=GS W9WH85_9EURO/26-148         AC W9WH85.1
#=GS A0A6I9TUS7_SESIN/31-152     AC A0A6I9TUS7.1
#=GS A0A484D3N2_PERFV/22-142     AC A0A484D3N2.1
#=GS A0A1J6IXI1_NICAT/37-158     AC A0A1J6IXI1.1
#=GS A0A1X7R8K1_9SACH/35-151     AC A0A1X7R8K1.1
#=GS A0A3N0YL56_ANAGA/76-181     AC A0A3N0YL56.1
#=GS H2RCW9_PANTR/21-141         AC H2RCW9.1
#=GS A0A6P8F4X7_CLUHA/24-145     AC A0A6P8F4X7.1
#=GS A0A0B7NQD5_9FUNG/20-128     AC A0A0B7NQD5.1
#=GS A0A452RY41_URSAM/1-47       AC A0A452RY41.1
#=GS A0A1W0X599_HYPDU/210-258    AC A0A1W0X599.1
#=GS A0A166JDB7_9AGAM/25-147     AC A0A166JDB7.1
#=GS A0A0F4ZCP5_9PEZI/25-147     AC A0A0F4ZCP5.1
#=GS A0A3Q3AX56_KRYMA/24-145     AC A0A3Q3AX56.1
#=GS T1GMH8_MEGSC/26-145         AC T1GMH8.1
#=GS A0A2V0P918_9CHLO/34-155     AC A0A2V0P918.1
#=GS A0A383ZIC3_BALAS/1-47       AC A0A383ZIC3.1
#=GS A0A3Q2WQI6_HAPBU/22-142     AC A0A3Q2WQI6.1
#=GS A0A3Q7W4I0_URSAR/23-143     AC A0A3Q7W4I0.1
#=GS A0A091E9C1_CORBR/8-127      AC A0A091E9C1.1
#=GS A0A6P5LRK7_PHACI/21-141     AC A0A6P5LRK7.1
#=GS A0A2G9H5P9_9LAMI/30-150     AC A0A2G9H5P9.1
#=GS A0A2Y9GQN8_NEOSC/32-152     AC A0A2Y9GQN8.1
#=GS A0A553HVK8_9PEZI/25-140     AC A0A553HVK8.1
#=GS A0A2H3J7L6_WOLCO/25-147     AC A0A2H3J7L6.1
#=GS C1H516_PARBA/33-155         AC C1H516.1
#=GS A0A5N3XUG8_MUNRE/9-129      AC A0A5N3XUG8.1
#=GS A0A3P8VIM5_CYNSE/22-142     AC A0A3P8VIM5.1
#=GS A0A0D2FE01_9EURO/26-148     AC A0A0D2FE01.1
#=GS A0A024UFD9_9STRA/25-145     AC A0A024UFD9.1
#=GS A0A1U8B0V4_NELNU/38-159     AC A0A1U8B0V4.1
#=GS A0A3B1JMG0_ASTMX/21-141     AC A0A3B1JMG0.1
#=GS G3JKW1_CORMM/25-147         AC G3JKW1.1
#=GS A0A6J1JB02_CUCMA/44-165     AC A0A6J1JB02.1
#=GS A0A4V3WLI0_CAMSI/44-165     AC A0A4V3WLI0.1
#=GS A0A096NGF1_PAPAN/21-141     AC A0A096NGF1.2
#=GS A0A078B356_STYLE/1-108      AC A0A078B356.1
#=GS Q4D380_TRYCC/124-207        AC Q4D380.1
#=GS A0A0K0J4I4_BRUMA/25-145     AC A0A0K0J4I4.1
#=GS A0A2Y9NWW5_DELLE/21-141     AC A0A2Y9NWW5.1
#=GS A0A6G0IYY3_LARCR/21-141     AC A0A6G0IYY3.1
#=GS A0A803JBS5_XENTR/1-103      AC A0A803JBS5.1
#=GS A0A6P8UIS2_GYMAC/22-142     AC A0A6P8UIS2.1
#=GS A0A1Y1UV45_9FUNG/1-88       AC A0A1Y1UV45.1
#=GS A0A556TLG0_BAGYA/22-142     AC A0A556TLG0.1
#=GS G1S7V5_NOMLE/21-141         AC G1S7V5.1
#=GS A0A2I4AIE3_9TELE/24-145     AC A0A2I4AIE3.1
#=GS A0A4W6EIP8_LATCA/22-142     AC A0A4W6EIP8.1
#=GS A0A6P6I826_PUMCO/21-141     AC A0A6P6I826.1
#=GS A0A4W3GH84_CALMI/40-159     AC A0A4W3GH84.1
#=GS A0A1L7WJV8_9HELO/26-148     AC A0A1L7WJV8.1
#=GS A0A437DBC6_ORYJA/21-141     AC A0A437DBC6.1
#=GS A0A4D8ZJF9_SALSN/32-153     AC A0A4D8ZJF9.1
#=GS F0Y722_AURAN/5-83           AC F0Y722.1
#=GS A0A673UXC1_SURSU/21-141     AC A0A673UXC1.1
#=GS S4RNR7_PETMA/1-99           AC S4RNR7.1
#=GS A0A671G5D9_RHIFE/21-141     AC A0A671G5D9.1
#=GS A0A2Z6SC13_9GLOM/50-174     AC A0A2Z6SC13.1
#=GS A0A2V3ISL4_9FLOR/59-181     AC A0A2V3ISL4.1
#=GS A0A6A2WNQ1_HIBSY/41-162     AC A0A6A2WNQ1.1
#=GS A0A310SS95_9HYME/7-127      AC A0A310SS95.1
#=GS A0A6P7K2D0_9TELE/41-162     AC A0A6P7K2D0.1
#=GS W2QUZ2_PHYPN/1-60           AC W2QUZ2.1
#=GS A0A2B4RB40_STYPI/304-425    AC A0A2B4RB40.1
#=GS A0A6J3D488_AYTFU/21-140     AC A0A6J3D488.1
#=GS A0A0D7A6S4_9AGAR/25-147     AC A0A0D7A6S4.1
#=GS A0A3Q1C2A7_AMPOC/1-103      AC A0A3Q1C2A7.1
#=GS A0A2K6SIX0_SAIBB/21-141     AC A0A2K6SIX0.1
#=GS A0A3Q7WSJ0_URSAR/1-80       AC A0A3Q7WSJ0.1
#=GS A0A2P4ZW90_9HYPO/25-147     AC A0A2P4ZW90.1
#=GS A0A0C9ZRW7_9AGAM/24-146     AC A0A0C9ZRW7.1
#=GS A0A7N8Y779_9TELE/35-155     AC A0A7N8Y779.1
#=GS A0A0D2E049_9EURO/26-148     AC A0A0D2E049.1
#=GS G5AZ94_HETGA/21-133         AC G5AZ94.1
#=GS A0A5N6PVI6_9ASTR/42-163     AC A0A5N6PVI6.1
#=GS A0A401KKD7_ASPAW/60-182     AC A0A401KKD7.1
#=GS A0A6P8EXQ8_CLUHA/22-142     AC A0A6P8EXQ8.1
#=GS A0A091T9T5_PHALP/19-139     AC A0A091T9T5.1
#=GS Q5KKQ1_CRYNJ/24-146         AC Q5KKQ1.1
#=GS A0A1X2GZL2_SYNRA/20-142     AC A0A1X2GZL2.1
#=GS A0A150GV38_GONPE/2-119      AC A0A150GV38.1
#=GS A0A667XEN2_9TELE/24-89      AC A0A667XEN2.1
#=GS A0A1W4WKH5_AGRPL/22-142     AC A0A1W4WKH5.1
#=GS A0A1X2IB77_9FUNG/21-144     AC A0A1X2IB77.1
#=GS A0A2I2Z5Z3_GORGO/21-71      AC A0A2I2Z5Z3.1
#=GS A0A6P6R9Q6_CARAU/24-145     AC A0A6P6R9Q6.1
#=GS A0A0D2Y2Y3_FUSO4/25-147     AC A0A0D2Y2Y3.1
#=GS A0A0C7MPA3_9SACH/27-147     AC A0A0C7MPA3.1
#=GS A0A2K5SC35_CEBIM/36-119     AC A0A2K5SC35.1
#=GS F6YJ85_CALJA/203-323        AC F6YJ85.3
#=GS A0A2I3LVX1_PAPAN/21-141     AC A0A2I3LVX1.1
#=GS A0A165GVM1_EXIGL/22-144     AC A0A165GVM1.1
#=GS A0A3P8Z672_ESOLU/19-139     AC A0A3P8Z672.1
#=GS A0A4Y9YBC4_9AGAM/32-154     AC A0A4Y9YBC4.1
#=GS A0A512U642_9ASCO/26-165     AC A0A512U642.1
#=GS A0A1L9TM48_9EURO/33-155     AC A0A1L9TM48.1
#=GS A0A3N4LJU0_9PEZI/33-154     AC A0A3N4LJU0.1
#=GS A0A0D3AIX6_BRAOL/40-161     AC A0A0D3AIX6.1
#=GS H0ZF66_TAEGU/21-140         AC H0ZF66.2
#=GS J6E9W4_SACK1/43-173         AC J6E9W4.1
#=GS A0A3Q3E8T8_9LABR/21-141     AC A0A3Q3E8T8.1
#=GS A0A2T2NLE0_CORCC/26-148     AC A0A2T2NLE0.1
#=GS A0A6I9Z2H5_9SAUR/21-141     AC A0A6I9Z2H5.1
#=GS A0A6P6JSG5_CARAU/24-145     AC A0A6P6JSG5.1
#=GS A0A6J2RG15_COTGO/24-145     AC A0A6J2RG15.1
#=GS A0A401PUI3_SCYTO/1-98       AC A0A401PUI3.1
#=GS A0A6J0AA65_ACIJB/23-143     AC A0A6J0AA65.1
#=GS A0A673BLL7_9TELE/21-103     AC A0A673BLL7.1
#=GS A0A5C6P8U7_9TELE/21-141     AC A0A5C6P8U7.1
#=GS A0A6J2XWS3_SITOR/20-140     AC A0A6J2XWS3.1
#=GS A0A6J0V308_9SAUR/1-89       AC A0A6J0V308.1
#=GS A0A2K5DC53_AOTNA/36-119     AC A0A2K5DC53.1
#=GS A0A3M7M7J6_9PLEO/43-165     AC A0A3M7M7J6.1
#=GS G3I257_CRIGR/21-141         AC G3I257.1
#=GS A0A6F9AQC7_9TELE/24-145     AC A0A6F9AQC7.1
#=GS A0A5J4Z4V1_PORPP/28-151     AC A0A5J4Z4V1.1
#=GS A0A2K6F9E8_PROCO/21-132     AC A0A2K6F9E8.1
#=GS A0A6J3EW34_SAPAP/23-143     AC A0A6J3EW34.1
#=GS A0A5A7QDV3_STRAF/117-203    AC A0A5A7QDV3.1
#=GS A0A643C2S6_BALPH/7-127      AC A0A643C2S6.1
#=GS A0A437DB86_ORYJA/207-327    AC A0A437DB86.1
#=GS A0A2K6MX15_RHIBE/21-141     AC A0A2K6MX15.1
#=GS A0A1E7FKX5_9STRA/26-147     AC A0A1E7FKX5.1
#=GS A0A1E5RZY4_9ASCO/54-197     AC A0A1E5RZY4.1
#=GS A0A0L8GSG2_OCTBM/36-156     AC A0A0L8GSG2.1
#=GS A0A4W2EGG4_BOBOX/21-127     AC A0A4W2EGG4.1
#=GS D8LU49_ECTSI/1-48           AC D8LU49.1
#=GS Q2U820_ASPOR/26-148         AC Q2U820.1
#=GS B4LE79_DROVI/22-142         AC B4LE79.1
#=GS A0A2R6QDY1_ACTCC/33-153     AC A0A2R6QDY1.1
#=GS A0A4W6EGG0_LATCA/3-106      AC A0A4W6EGG0.1
#=GS A0A0V1C283_TRISP/21-141     AC A0A0V1C283.1
#=GS A0A401RWI9_CHIPU/49-168     AC A0A401RWI9.1
#=GS A0A5J5MTW0_MUNRE/21-141     AC A0A5J5MTW0.1
#=GS A0A1Y2AMN7_9TREE/24-146     AC A0A1Y2AMN7.1
#=GS A0A1I7VH73_LOALO/25-145     AC A0A1I7VH73.1
#=GS A0A5E4CD44_MARMO/21-141     AC A0A5E4CD44.1
#=GS A0A314KNM0_NICAT/44-165     AC A0A314KNM0.1
#=GS A0A672SMC4_SINGR/23-85      AC A0A672SMC4.1
#=GS M5W5L6_PRUPE/35-159         AC M5W5L6.1
#=GS A0A673MUI6_9TELE/21-141     AC A0A673MUI6.1
#=GS G2QGA6_MYCTT/1-49           AC G2QGA6.1
#=GS A6QUU5_AJECN/20-142         AC A6QUU5.1
#=GS A0A3M0JGI3_HIRRU/21-117     AC A0A3M0JGI3.1
#=GS A0A545WBH6_9HYPO/25-147     AC A0A545WBH6.1
#=GS S8AWA1_DACHA/50-172         AC S8AWA1.1
#=GS A0A2K5X8P6_MACFA/36-119     AC A0A2K5X8P6.2
#=GS A0A166LE95_9PEZI/25-147     AC A0A166LE95.1
#=GS A0A2P6PKY3_ROSCH/20-140     AC A0A2P6PKY3.1
#=GS A0A674KGJ7_TERCA/21-141     AC A0A674KGJ7.1
#=GS A0A0C3CKC9_HEBCY/22-144     AC A0A0C3CKC9.1
#=GS A0A091EDA7_CORBR/8-128      AC A0A091EDA7.1
#=GS A0A6P8U4N1_GYMAC/35-119     AC A0A6P8U4N1.1
#=GS L5LFX5_MYODS/21-141         AC L5LFX5.1
#=GS A0A067L012_JATCU/40-161     AC A0A067L012.1
#=GS M1W510_CLAP2/25-147         AC M1W510.1
#=GS A0A4W2BQI5_BOBOX/1-102      AC A0A4W2BQI5.1
#=GS D8TEQ5_SELML/38-159         AC D8TEQ5.1
#=GS A0A1Z5STF9_HORWE/25-157     AC A0A1Z5STF9.1
#=GS A0A6J0APW9_VICPA/1-80       AC A0A6J0APW9.1
#=GS A0A5D2ULW5_GOSMU/41-162     AC A0A5D2ULW5.1
#=GS W5K090_ASTMX/24-145         AC W5K090.2
#=GS A0A0A0AZC1_CHAVO/10-129     AC A0A0A0AZC1.1
#=GS A0A2J6LRY8_LACSA/42-163     AC A0A2J6LRY8.1
#=GS A0A6A4WJ51_AMPAM/22-142     AC A0A6A4WJ51.1
#=GS A0A0L0H7J5_SPIPD/21-143     AC A0A0L0H7J5.1
#=GS A0A2R6X8B5_MARPO/39-160     AC A0A2R6X8B5.1
#=GS A0A175W5H7_9PEZI/25-147     AC A0A175W5H7.1
#=GS A0A0Q9XLH9_DROMO/1-65       AC A0A0Q9XLH9.1
#=GS A0A1E3QM46_9ASCO/27-123     AC A0A1E3QM46.1
#=GS A0A3A2Z646_9EURO/33-155     AC A0A3A2Z646.1
#=GS A0A6J2AFT9_ACIJB/21-141     AC A0A6J2AFT9.1
#=GS A0A6J8CI84_MYTCO/21-141     AC A0A6J8CI84.1
#=GS A0A2K5DC41_AOTNA/21-72      AC A0A2K5DC41.1
#=GS A0A0D3BAX9_BRAOL/247-368    AC A0A0D3BAX9.1
#=GS G8YNK5_PICSO/26-166         AC G8YNK5.1
#=GS A0A672NKR1_SINGR/21-141     AC A0A672NKR1.1
#=GS H2SE16_TAKRU/24-145         AC H2SE16.3
#=GS A0A3Q1AXL8_AMPOC/24-145     AC A0A3Q1AXL8.1
#=GS A0A2K6KQH4_RHIBE/36-119     AC A0A2K6KQH4.1
#=GS A0A091VMV0_NIPNI/8-127      AC A0A091VMV0.1
#=GS G5AKA1_HETGA/21-141         AC G5AKA1.1
#=GS A0A5N5TGQ3_9CRUS/25-145     AC A0A5N5TGQ3.1
#=GS A0A2K5SC93_CEBIM/21-141     AC A0A2K5SC93.1
#=GS A0A3L6RRQ4_PANMI/44-166     AC A0A3L6RRQ4.1
#=GS A1CLD9_ASPCL/33-155         AC A1CLD9.1
#=GS A0A6J2I0E4_9PASS/1-102      AC A0A6J2I0E4.2
#=GS A0A2I2ZHZ1_GORGO/8-128      AC A0A2I2ZHZ1.1
#=GS A8MYV4_HUMAN/21-65          AC A8MYV4.2
#=GS A0A665URI5_ECHNA/21-93      AC A0A665URI5.1
#=GS A0A0D0E9M2_9AGAM/24-146     AC A0A0D0E9M2.1
#=GS A0A3S0ZMU0_ELYCH/23-143     AC A0A3S0ZMU0.1
#=GS A0A2U3X124_ODORO/21-141     AC A0A2U3X124.1
#=GS A0BV93_PARTE/28-158         AC A0BV93.1
#=GS I1LIR0_SOYBN/34-155         AC I1LIR0.1
#=GS A0A662WUZ5_9STRA/30-143     AC A0A662WUZ5.1
#=GS A0A670XNN4_PSETE/26-136     AC A0A670XNN4.1
#=GS A0A1V6PK54_PENDC/32-154     AC A0A1V6PK54.1
#=GS A0A4Q4Y203_9PEZI/68-190     AC A0A4Q4Y203.1
#=GS A0A1V4JPY5_PATFA/21-140     AC A0A1V4JPY5.1
#=GS A0A672RY56_SINGR/22-142     AC A0A672RY56.1
#=GS A0A3Q1FPW1_9TELE/22-142     AC A0A3Q1FPW1.1
#=GS A0A6Q2XY51_ESOLU/19-139     AC A0A6Q2XY51.1
#=GS A0A2P7YRW5_9ASCO/26-163     AC A0A2P7YRW5.1
#=GS A0A6G1FCG2_9ORYZ/41-160     AC A0A6G1FCG2.1
#=GS A0A2U1NWE0_ARTAN/33-152     AC A0A2U1NWE0.1
#=GS A0A2T3A417_9PEZI/25-147     AC A0A2T3A417.1
#=GS A0A124SDK1_CYNCS/41-162     AC A0A124SDK1.1
#=GS A0A3R7JHA5_9STRA/25-145     AC A0A3R7JHA5.1
#=GS A0A484D275_PERFV/21-141     AC A0A484D275.1
#=GS A0A2C9UXE2_MANES/36-157     AC A0A2C9UXE2.1
#=GS A0A0J8RW72_COCIT/33-155     AC A0A0J8RW72.1
#=GS A0A4Y8CP53_9HELO/26-148     AC A0A4Y8CP53.1
#=GS A0A2K6UNI7_SAIBB/21-141     AC A0A2K6UNI7.1
#=GS A0A2K6RHR6_RHIRO/21-141     AC A0A2K6RHR6.1
#=GS A0A7D8YWX3_9HELO/26-143     AC A0A7D8YWX3.1
#=GS A0A1B0GS09_MOUSE/1-56       AC A0A1B0GS09.1
#=GS A0A4S8J076_MUSBA/49-169     AC A0A4S8J076.1
#=GS A0A044T413_ONCVO/25-145     AC A0A044T413.1
#=GS A0A671RE94_9TELE/48-106     AC A0A671RE94.1
#=GS W5N311_LEPOC/26-147         AC W5N311.1
#=GS W6U800_ECHGR/21-141         AC W6U800.1
#=GS A0A4Q4ZM51_9PEZI/25-147     AC A0A4Q4ZM51.1
#=GS A0A6I9RFR8_ELAGV/33-151     AC A0A6I9RFR8.1
#=GS A0A6P8P3S8_GEOSA/57-177     AC A0A6P8P3S8.1
#=GS A0A1S3HXZ7_LINUN/30-150     AC A0A1S3HXZ7.1
#=GS A0A6J0V0Z3_9SAUR/18-138     AC A0A6J0V0Z3.1
#=GS A0A0L7QSC2_9HYME/54-174     AC A0A0L7QSC2.1
#=GS F1PQX2_CANLF/62-182         AC F1PQX2.2
#=GS A0A383ZIC7_BALAS/21-141     AC A0A383ZIC7.1
#=GS A0A6J2RIC8_COTGO/24-145     AC A0A6J2RIC8.1
#=GS A0A4W2BQJ4_BOBOX/21-71      AC A0A4W2BQJ4.1
#=GS A0A118JT26_CYNCS/39-160     AC A0A118JT26.1
#=GS A0A384BRC4_URSMA/8-128      AC A0A384BRC4.1
#=GS A0A178ETN9_TRIRU/808-893    AC A0A178ETN9.1
#=GS A0A6P8YHW8_DROAB/22-142     AC A0A6P8YHW8.1
#=GS M4DKR6_BRARP/36-156         AC M4DKR6.1
#=GS A0A4U5UVK6_COLLU/26-127     AC A0A4U5UVK6.1
#=GS A0A068RV50_9FUNG/17-139     AC A0A068RV50.1
#=GS A0A2G2YLT3_CAPAN/35-156     AC A0A2G2YLT3.1
#=GS A0A1E4TN65_PACTA/34-158     AC A0A1E4TN65.1
#=GS A0A6J0M848_RAPSA/38-143     AC A0A6J0M848.1
#=GS X6MI49_RETFI/24-145         AC X6MI49.1
#=GS V4N6T8_EUTSA/40-161         AC V4N6T8.1
#=GS A0A4U6WHU0_SETVI/43-165     AC A0A4U6WHU0.1
#=GS R0JDQ0_ANAPL/1-77           AC R0JDQ0.1
#=GS A0A2A4JPS1_HELVI/21-141     AC A0A2A4JPS1.1
#=GS A0A0S4JX55_BODSA/24-142     AC A0A0S4JX55.1
#=GS A0A210QTE9_MIZYE/22-142     AC A0A210QTE9.1
#=GS A0A0D2NUI9_HYPSF/24-146     AC A0A0D2NUI9.1
#=GS S9UWE0_9TRYP/23-161         AC S9UWE0.1
#=GS A0A7E6E0J9_9CHIR/21-141     AC A0A7E6E0J9.1
#=GS A0A0E0K7E5_ORYPU/43-165     AC A0A0E0K7E5.1
#=GS A0A673UWP2_SURSU/14-134     AC A0A673UWP2.1
#=GS A0A7M7R5A3_APIME/25-145     AC A0A7M7R5A3.1
#=GS A0A3Q0GE12_ALLSI/8-128      AC A0A3Q0GE12.1
#=GS A0A5N6JP57_9HELO/26-148     AC A0A5N6JP57.1
#=GS A0A074ZQB9_AURSE/26-149     AC A0A074ZQB9.1
#=GS A0A2U4CDT3_TURTR/34-154     AC A0A2U4CDT3.2
#=GS A0A137P3G2_CONC2/61-185     AC A0A137P3G2.1
#=GS A0A317XNA9_9BASI/23-145     AC A0A317XNA9.1
#=GS A0A7R5KPM3_9PASS/21-140     AC A0A7R5KPM3.1
#=GS C3ZUX5_BRAFL/44-143         AC C3ZUX5.1
#=GS A0A565B0X4_9BRAS/43-154     AC A0A565B0X4.1
#=GS A0A4W3IEG7_CALMI/20-140     AC A0A4W3IEG7.1
#=GS A0A0M3JVD0_ANISI/22-142     AC A0A0M3JVD0.1
#=GS A0A498LBS7_LABRO/24-145     AC A0A498LBS7.1
#=GS A0A3M0JH24_HIRRU/21-141     AC A0A3M0JH24.1
#=GS A0A6A6NEZ1_HEVBR/36-157     AC A0A6A6NEZ1.1
#=GS A0A4Z1JTC7_9HELO/26-148     AC A0A4Z1JTC7.1
#=GS A0A2Z7D404_9LAMI/7-127      AC A0A2Z7D404.1
#=GS A0A6A3JBL9_9STRA/25-145     AC A0A6A3JBL9.1
#=GS V8P4X0_OPHHA/1-47           AC V8P4X0.1
#=GS Q4DP81_TRYCC/124-207        AC Q4DP81.1
#=GS A0A0N4TJU7_BRUPA/25-145     AC A0A0N4TJU7.1
#=GS A0A093Q5B8_9PASS/8-127      AC A0A093Q5B8.1
#=GS A0A395SZZ0_9HYPO/1-49       AC A0A395SZZ0.1
#=GS A0A6A5F794_PERFL/21-141     AC A0A6A5F794.1
#=GS A0A0H1BAN3_9EURO/33-155     AC A0A0H1BAN3.1
#=GS A0A0F7TR85_PENBI/32-154     AC A0A0F7TR85.1
#=GS A0A3Q0GEN4_ALLSI/21-141     AC A0A3Q0GEN4.1
#=GS S3CWW8_GLAL2/36-176         AC S3CWW8.1
#=GS A0A5J5C6L5_9ASTE/33-152     AC A0A5J5C6L5.1
#=GS A0A195FF75_9HYME/25-145     AC A0A195FF75.1
#=GS R7V940_CAPTE/21-141         AC R7V940.1
#=GS A0A6F9AJN2_9TELE/22-142     AC A0A6F9AJN2.1
#=GS A0A0P7UY60_SCLFO/23-143     AC A0A0P7UY60.1
#=GS A0A7N6FL93_ANATE/25-145     AC A0A7N6FL93.1
#=GS A0A091SQ72_PELCR/8-128      AC A0A091SQ72.1
#=GS G1PUG0_MYOLU/21-141         AC G1PUG0.1
#=GS I1BUF2_RHIO9/20-141         AC I1BUF2.1
#=GS A0A314YG75_PRUYE/41-162     AC A0A314YG75.1
#=GS A0A5C7GXG8_9ROSI/40-161     AC A0A5C7GXG8.1
#=GS A0A2R8ZX68_PANPA/21-141     AC A0A2R8ZX68.1
#=GS K1Q805_CRAGI/56-176         AC K1Q805.1
#=GS C5E3B8_LACTC/82-196         AC C5E3B8.1
#=GS A0A251VU42_HELAN/42-163     AC A0A251VU42.1
#=GS A0A0V1P080_9BILA/21-141     AC A0A0V1P080.1
#=GS A0A5A9PRI5_9TELE/39-120     AC A0A5A9PRI5.1
#=GS A0A178DZC5_9PLEO/26-148     AC A0A178DZC5.1
#=GS A0A436ZS07_9PEZI/26-148     AC A0A436ZS07.1
#=GS A0A6P7TMX3_OCTVU/36-156     AC A0A6P7TMX3.1
#=GS Q4E191_TRYCC/77-161         AC Q4E191.1
#=GS Q4N7T6_THEPA/34-148         AC Q4N7T6.1
#=GS A0A3P7NMR2_DIBLA/29-149     AC A0A3P7NMR2.1
#=GS A0A4W2BTM9_BOBOX/21-141     AC A0A4W2BTM9.1
#=GS A0A6P5ANF4_BRABE/39-168     AC A0A6P5ANF4.1
#=GS A7TQ78_VANPO/37-155         AC A7TQ78.1
#=GS A0A0D2RDW6_GOSRA/41-162     AC A0A0D2RDW6.1
#=GS A0A2K5ZMK0_MANLE/21-141     AC A0A2K5ZMK0.1
#=GS A0A6I9NDS3_9TELE/22-142     AC A0A6I9NDS3.1
#=GS A0A093GJ43_DRYPU/11-131     AC A0A093GJ43.1
#=GS F2SC78_TRIRC/28-150         AC F2SC78.1
#=GS A0A368UHC3_SOYBN/40-151     AC A0A368UHC3.1
#=GS A0A2I4AZT6_9TELE/22-142     AC A0A2I4AZT6.1
#=GS A0A4Z1K801_9HELO/26-148     AC A0A4Z1K801.1
#=GS A0A6P8ES53_CLUHA/24-145     AC A0A6P8ES53.1
#=GS A0A452J4W8_9SAUR/21-141     AC A0A452J4W8.1
#=GS A0A165T739_9AGAM/25-147     AC A0A165T739.1
#=GS A0A1S3FES6_DIPOR/21-149     AC A0A1S3FES6.1
#=GS F6ZA94_HORSE/21-141         AC F6ZA94.1
#=GS A0A673BR49_9TELE/22-142     AC A0A673BR49.1
#=GS M3WN71_FELCA/21-141         AC M3WN71.3
#=GS A0A1Y2E4C4_9FUNG/24-144     AC A0A1Y2E4C4.1
#=GS M0XLK7_HORVV/43-165         AC M0XLK7.1
#=GS A0A1Q8RA01_9PEZI/25-147     AC A0A1Q8RA01.1
#=GS W5M1C4_LEPOC/21-141         AC W5M1C4.1
#=GS A0A6J3RVF1_TURTR/1-120      AC A0A6J3RVF1.1
#=GS A0A2G8KR74_STIJA/22-142     AC A0A2G8KR74.1
#=GS A0A3Q1CK35_AMPOC/21-141     AC A0A3Q1CK35.1
#=GS A0A2U3ZWE0_ODORO/8-128      AC A0A2U3ZWE0.1
#=GS A0A5A7PKZ1_STRAF/83-183     AC A0A5A7PKZ1.1
#=GS G3SSV7_LOXAF/21-141         AC G3SSV7.1
#=GS A0A3Q3L896_9TELE/14-134     AC A0A3Q3L896.2
#=GS A0A0N4U421_DRAME/22-142     AC A0A0N4U421.1
#=GS A0A4W2E7Y4_BOBOX/21-141     AC A0A4W2E7Y4.1
#=GS N4V0F1_FUSC1/34-156         AC N4V0F1.1
#=GS A0A2N6NZM9_BEABA/55-156     AC A0A2N6NZM9.1
#=GS A0A058ZEX7_FONAL/101-223    AC A0A058ZEX7.1
#=GS A0A0V0R635_PSEPJ/20-144     AC A0A0V0R635.1
#=GS A0A6A3BH57_HIBSY/41-162     AC A0A6A3BH57.1
#=GS A0A5N6FIE0_PETAA/33-155     AC A0A5N6FIE0.1
#=GS A0A4T0TTF8_9BASI/23-145     AC A0A4T0TTF8.1
#=GS A0A124SCN5_CYNCS/33-152     AC A0A124SCN5.1
#=GS A0A3Q3E906_9LABR/22-142     AC A0A3Q3E906.1
#=GS A0A2R8ZYC6_PANPA/36-119     AC A0A2R8ZYC6.1
#=GS A0A2P6N4E4_9EUKA/57-161     AC A0A2P6N4E4.1
#=GS A0A2R6WVC7_MARPO/111-232    AC A0A2R6WVC7.1
#=GS A0A6P8FNI6_CLUHA/1-89       AC A0A6P8FNI6.1
#=GS A0A2U4CDS8_TURTR/34-154     AC A0A2U4CDS8.2
#=GS A0A2K5KNP6_CERAT/12-132     AC A0A2K5KNP6.1
#=GS C4LZT6_ENTHI/21-137         AC C4LZT6.1
#=GS A0A093F1Y4_TYTAL/8-128      AC A0A093F1Y4.1
#=GS A0A6P5BKD0_BOSIN/21-71      AC A0A6P5BKD0.1
#=GS A0A3Q1F040_9TELE/21-141     AC A0A3Q1F040.1
#=GS A0A6A5F7A2_PERFL/21-141     AC A0A6A5F7A2.1
#=GS A0A218UU21_9PASE/25-144     AC A0A218UU21.1
#=GS A0A369RVX1_9METZ/1-97       AC A0A369RVX1.1
#=GS A0A6J3RVF2_TURTR/34-154     AC A0A6J3RVF2.1
#=GS A0A151RAX6_CAJCA/32-141     AC A0A151RAX6.1
#=GS A0A2P6PKY3_ROSCH/170-285    AC A0A2P6PKY3.1
#=GS A0A3Q3XDA2_MOLML/21-70      AC A0A3Q3XDA2.1
#=GS G0P334_CAEBE/21-140         AC G0P334.1
#=GS A0A1S3ZMX8_TOBAC/49-168     AC A0A1S3ZMX8.1
#=GS L8HE30_ACACA/7-86           AC L8HE30.1
#=GS A0A671NMH0_9TELE/1-103      AC A0A671NMH0.1
#=GS L8GRT0_ACACA/126-244        AC L8GRT0.1
#=GS A0A1R2B7I1_9CILI/24-139     AC A0A1R2B7I1.1
#=GS A0A1E3I7E2_9TREE/24-146     AC A0A1E3I7E2.1
#=GS A0A5N5P1U4_9ROSI/37-158     AC A0A5N5P1U4.1
#=GS A0A540MJ30_MALBA/41-162     AC A0A540MJ30.1
#=GS A0A151MC97_ALLMI/21-141     AC A0A151MC97.1
#=GS A0A671G1Y9_RHIFE/21-141     AC A0A671G1Y9.1
#=GS A0A6F9AJM6_9TELE/13-95      AC A0A6F9AJM6.1
#=GS A0A1U7R7N7_MESAU/21-141     AC A0A1U7R7N7.1
#=GS A0A428R491_9HYPO/25-147     AC A0A428R491.1
#=GS A0A2S7P9T1_9HELO/33-175     AC A0A2S7P9T1.1
#=GS A0A087XZQ6_POEFO/24-145     AC A0A087XZQ6.2
#=GS A0A2K1IAG6_PHYPA/42-163     AC A0A2K1IAG6.1
#=GS U1HUA7_ENDPU/26-148         AC U1HUA7.1
#=GS A0A2P5C046_PARAD/33-154     AC A0A2P5C046.1
#=GS A0A4U5QFL0_POPAL/38-159     AC A0A4U5QFL0.1
#=GS A0A6J3EV98_SAPAP/21-141     AC A0A6J3EV98.1
#=GS A0A2T3ZY33_TRIHA/25-147     AC A0A2T3ZY33.1
#=GS A0A6I8PK40_ORNAN/21-141     AC A0A6I8PK40.1
#=GS A0A3N4L0G7_9PEZI/32-154     AC A0A3N4L0G7.1
#=GS A0A3P9Q507_POERE/21-141     AC A0A3P9Q507.1
#=GS A0A556TRI4_BAGYA/21-141     AC A0A556TRI4.1
#=GS A0A2K6MX16_RHIBE/21-141     AC A0A2K6MX16.1
#=GS A0A498P1F5_LABRO/22-142     AC A0A498P1F5.1
#=GS A0A5E4CA83_MARMO/21-141     AC A0A5E4CA83.1
#=GS A0A1L8FZB6_XENLA/27-143     AC A0A1L8FZB6.1
#=GS V4NJP7_EUTSA/2-98           AC V4NJP7.1
#=GS A0A024UD70_9STRA/25-145     AC A0A024UD70.1
#=GS A0A6J2RHZ1_COTGO/24-145     AC A0A6J2RHZ1.1
#=GS A0A0L0DTE2_THETB/20-141     AC A0A0L0DTE2.1
#=GS V2XWJ4_MONRO/23-147         AC V2XWJ4.1
#=GS W5LBD3_ASTMX/21-127         AC W5LBD3.2
#=GS A0A1S3JU80_LINUN/24-144     AC A0A1S3JU80.1
#=GS A0A654IAL4_9CEST/7-74       AC A0A654IAL4.1
#=GS A0A2C5XYR9_9HYPO/25-147     AC A0A2C5XYR9.1
#=GS Q6ESB7_ORYSJ/45-167         AC Q6ESB7.1
#=GS A0A151MC87_ALLMI/21-141     AC A0A151MC87.1
#=GS A0A5F5XZQ4_FELCA/23-143     AC A0A5F5XZQ4.1
#=GS A0A1Y2EQ84_PROLT/26-148     AC A0A1Y2EQ84.1
#=GS A0A2J7RDC5_9NEOP/22-142     AC A0A2J7RDC5.1
#=GS A0A165AMR8_9AGAM/21-143     AC A0A165AMR8.1
#=GS A0A1U7VU23_NICSY/37-158     AC A0A1U7VU23.1
#=GS A0A498N006_LABRO/22-127     AC A0A498N006.1
#=GS A0A0K9RUQ0_SPIOL/42-163     AC A0A0K9RUQ0.1
#=GS A0A2I4GZN3_JUGRE/41-162     AC A0A2I4GZN3.1
#=GS F6ZIZ6_CALJA/21-141         AC F6ZIZ6.3
#=GS A0A5F4W9X2_CALJA/161-245    AC A0A5F4W9X2.1
#=GS A0A444V841_ACIRT/1223-1343  AC A0A444V841.1
#=GS A0A672LGT6_SINGR/23-143     AC A0A672LGT6.1
#=GS A0A0K3ARP2_BABMR/19-133     AC A0A0K3ARP2.1
#=GS A0A0L0BPB0_LUCCU/23-143     AC A0A0L0BPB0.1
#=GS A0A2I3SDN5_PANTR/21-141     AC A0A2I3SDN5.1
#=GS A0A672TR92_STRHB/21-140     AC A0A672TR92.1
#=GS A0A452EGM1_CAPHI/21-141     AC A0A452EGM1.1
#=GS A0A087H8Z4_ARAAL/37-158     AC A0A087H8Z4.1
#=GS C0HE93_MAIZE/43-165         AC C0HE93.1
#=GS A0A6J2I0E8_9PASS/21-141     AC A0A6J2I0E8.1
#=GS A0A078I9C5_BRANA/55-175     AC A0A078I9C5.1
#=GS A0A340XWU1_LIPVE/21-141     AC A0A340XWU1.1
#=GS B8M558_TALSN/33-155         AC B8M558.1
#=GS W6MGJ0_9ASCO/29-162         AC W6MGJ0.1
#=GS A0A1J4KNR8_9EUKA/22-137     AC A0A1J4KNR8.1
#=GS A0A158RAI2_TAEAS/1-47       AC A0A158RAI2.1
#=GS A0A376B7L3_9ASCO/29-143     AC A0A376B7L3.1
#=GS A0A0N4T8L8_BRUPA/25-141     AC A0A0N4T8L8.1
#=GS A0A663EYA9_AQUCH/21-141     AC A0A663EYA9.1
#=GS I3KAX9_ORENI/21-141         AC I3KAX9.1
#=GS A0A162SLZ4_9CRUS/19-139     AC A0A162SLZ4.1
#=GS A0A2K6KQI3_RHIBE/14-134     AC A0A2K6KQI3.1
#=GS A0A3B1K394_ASTMX/23-143     AC A0A3B1K394.1
#=GS G3R4C1_GORGO/21-141         AC G3R4C1.1
#=GS A0A1V4JNP7_PATFA/21-141     AC A0A1V4JNP7.1
#=GS A0A2G7FGY7_9EURO/410-532    AC A0A2G7FGY7.1
#=GS A0A6J3AWS3_VICPA/1-47       AC A0A6J3AWS3.1
#=GS A0A2K6CCL6_MACNE/69-189     AC A0A2K6CCL6.1
#=GS A0A3P8ANM2_HAEPC/1-106      AC A0A3P8ANM2.1
#=GS A0A0D2CBA0_9EURO/1-58       AC A0A0D2CBA0.1
#=GS A0A665TLE0_ECHNA/24-145     AC A0A665TLE0.1
#=GS A0A2I3H6A0_NOMLE/21-141     AC A0A2I3H6A0.1
#=GS B0X7U6_CULQU/63-180         AC B0X7U6.1
#=GS A0A4Y7IVU0_PAPSO/33-147     AC A0A4Y7IVU0.1
#=GS A0A2K3Q6N2_9HYPO/79-201     AC A0A2K3Q6N2.1
#=GS A0A5C3MCH8_9AGAR/25-147     AC A0A5C3MCH8.1
#=GS A0A6P8V395_GYMAC/21-141     AC A0A6P8V395.1
#=GS A0A1E3PZ47_LIPST/27-149     AC A0A1E3PZ47.1
#=GS A0A2A9NW82_9AGAR/25-147     AC A0A2A9NW82.1
#=GS A0A5C3E3C0_9BASI/23-145     AC A0A5C3E3C0.1
#=GS A0A6J3ERK4_SAPAP/23-143     AC A0A6J3ERK4.1
#=GS G9MQ40_HYPVG/25-147         AC G9MQ40.1
#=GS D5GPY1_TUBMM/31-153         AC D5GPY1.1
#=GS A0A6J3ERJ9_SAPAP/38-121     AC A0A6J3ERJ9.1
#=GS A0A3P9CN59_9CICH/22-142     AC A0A3P9CN59.1
#=GS A0A671RDN5_9TELE/17-137     AC A0A671RDN5.1
#=GS A0A0K3CH55_RHOTO/437-560    AC A0A0K3CH55.1
#=GS A0A3N2Q2S8_9PEZI/26-148     AC A0A3N2Q2S8.1
#=GS V5E4L8_KALBG/23-145         AC V5E4L8.1
#=GS A0A6J2J7Y9_BOMMA/21-141     AC A0A6J2J7Y9.1
#=GS A0A4S4L2V5_9AGAM/16-98      AC A0A4S4L2V5.1
#=GS A0A0L0S486_ALLM3/1-47       AC A0A0L0S486.1
#=GS A0A5G2Q8L5_PIG/21-141       AC A0A5G2Q8L5.1
#=GS A0A4Y7L9R1_PAPSO/33-147     AC A0A4Y7L9R1.1
#=GS B1N3Q7_ENTHI/1-67           AC B1N3Q7.1
#=GS A0A6J1A258_9ROSI/33-152     AC A0A6J1A258.1
#=GS A0A6I8RXN5_XENTR/23-106     AC A0A6I8RXN5.2
#=GS S3D415_OPHP1/25-147         AC S3D415.1
#=GS A0A0D9VN56_9ORYZ/38-160     AC A0A0D9VN56.1
#=GS A0A672G2N2_SALFA/9-129      AC A0A672G2N2.1
#=GS A0A4U0W497_9BASI/18-141     AC A0A4U0W497.1
#=GS A0A3P9Q3M0_POERE/22-142     AC A0A3P9Q3M0.1
#=GS A0A1V8S9B4_9PEZI/25-147     AC A0A1V8S9B4.1
#=GS A0A671RD70_9TELE/21-141     AC A0A671RD70.1
#=GS A0A2S4PSS6_9PEZI/26-148     AC A0A2S4PSS6.1
#=GS A0A087G6W8_ARAAL/37-158     AC A0A087G6W8.1
#=GS M2MQX5_BAUPA/25-147         AC M2MQX5.1
#=GS A0A437CGJ9_ORYJA/24-145     AC A0A437CGJ9.1
#=GS A0A803J6F4_XENTR/22-142     AC A0A803J6F4.1
#=GS A0A061D9X4_BABBI/33-148     AC A0A061D9X4.1
#=GS A0A2H5PTS3_CITUN/33-153     AC A0A2H5PTS3.1
#=GS A3GFP8_PICST/25-189         AC A3GFP8.2
#=GS A0A1V6QL86_9EURO/32-154     AC A0A1V6QL86.1
#=GS A0A1S3JV13_LINUN/24-144     AC A0A1S3JV13.1
#=GS A0A671FWC6_RHIFE/21-71      AC A0A671FWC6.1
#=GS R0G9I8_9BRAS/37-158         AC R0G9I8.1
#=GS A0A498JJ43_MALDO/41-162     AC A0A498JJ43.1
#=GS A0A0U1LSI4_TALIS/33-155     AC A0A0U1LSI4.1
#=GS A0A109NDP8_SORBI/31-159     AC A0A109NDP8.1
#=GS A0A0D9Z0P1_9ORYZ/45-167     AC A0A0D9Z0P1.1
#=GS A0A3Q4GPC8_NEOBR/1-118      AC A0A3Q4GPC8.1
#=GS A0A663EY38_AQUCH/21-140     AC A0A663EY38.1
#=GS U3K9N3_FICAL/22-143         AC U3K9N3.1
#=GS A0A2K5ZMJ6_MANLE/21-72      AC A0A2K5ZMJ6.1
#=GS A0A7C8IPX5_9PEZI/25-147     AC A0A7C8IPX5.1
#=GS C5FBT1_ARTOC/33-155         AC C5FBT1.1
#=GS H3C023_TETNG/22-142         AC H3C023.1
#=GS A0A0L0DVC5_THETB/45-170     AC A0A0L0DVC5.1
#=GS A0A5N5EVR1_9ROSA/68-147     AC A0A5N5EVR1.1
#=GS A0A314UXX6_PRUYE/40-161     AC A0A314UXX6.1
#=GS A0A4V5N367_9PEZI/157-279    AC A0A4V5N367.1
#=GS A0A4W2BQK9_BOBOX/74-194     AC A0A4W2BQK9.1
#=GS G8YL75_PICSO/26-166         AC G8YL75.1
#=GS A0A194R3P8_PAPMA/21-141     AC A0A194R3P8.1
#=GS A0A1S2Z9G0_ERIEU/21-141     AC A0A1S2Z9G0.1
#=GS A0A2K5JZY1_COLAP/29-136     AC A0A2K5JZY1.1
#=GS A0A6P5BKC6_BOSIN/30-150     AC A0A6P5BKC6.1
#=GS V4TA73_CITCL/33-153         AC V4TA73.1
#=GS A0A7C8HYN3_9PLEO/26-148     AC A0A7C8HYN3.1
#=GS A0A1Y2DB56_9PEZI/25-147     AC A0A1Y2DB56.1
#=GS A0A212DH07_CEREH/25-103     AC A0A212DH07.1
#=GS A0A507D1S6_9FUNG/21-143     AC A0A507D1S6.1
#=GS A0A7E4RCI6_CIMLE/20-140     AC A0A7E4RCI6.1
#=GS A0A1X2GUR8_9FUNG/21-144     AC A0A1X2GUR8.1
#=GS F6W3G3_CALJA/23-143         AC F6W3G3.3
#=GS A0A337SU32_FELCA/21-141     AC A0A337SU32.1
#=GS A0A139AR98_GONPJ/22-127     AC A0A139AR98.1
#=GS A0A1J9QWC0_9PEZI/26-148     AC A0A1J9QWC0.1
#=GS A0A1J7JN81_9PEZI/25-147     AC A0A1J7JN81.1
#=GS A0A6I8TMN2_AEDAE/1-101      AC A0A6I8TMN2.1
#=GS K7CF25_PANTR/21-141         AC K7CF25.1
#=GS A0A671G224_RHIFE/21-141     AC A0A671G224.1
#=GS A0A6P6I6Y9_PUMCO/21-141     AC A0A6P6I6Y9.1
#=GS H2NDX9_PONAB/21-141         AC H2NDX9.2
#=GS A0A6P3VL66_CLUHA/22-142     AC A0A6P3VL66.1
#=GS A0A6A5F1N0_PERFL/22-142     AC A0A6A5F1N0.1
#=GS C5E4B5_ZYGRC/35-152         AC C5E4B5.1
#=GS A0A5N6DJ33_ASPPA/33-155     AC A0A5N6DJ33.1
#=GS A0A5J9UX13_9POAL/31-101     AC A0A5J9UX13.1
#=GS A0A068UAB2_COFCA/37-158     AC A0A068UAB2.1
#=GS A0A1Q3E8N7_LENED/20-158     AC A0A1Q3E8N7.1
#=GS A0A1V2L5H0_CYBFA/28-150     AC A0A1V2L5H0.1
#=GS A0A452J4Y8_9SAUR/21-141     AC A0A452J4Y8.1
#=GS A0A6D2IWA1_9BRAS/40-161     AC A0A6D2IWA1.1
#=GS A0A673BLC9_9TELE/21-141     AC A0A673BLC9.1
#=GS A0A2K5S826_CEBIM/26-146     AC A0A2K5S826.1
#=GS A0A6P7Y6D3_9AMPH/21-89      AC A0A6P7Y6D3.1
#=GS A0A1J8R6Y9_9AGAM/24-146     AC A0A1J8R6Y9.1
#=GS A0A1A6GDL4_NEOLE/21-141     AC A0A1A6GDL4.1
#=GS A0A565BM01_9BRAS/41-159     AC A0A565BM01.1
#=GS A0A6I8PDA4_ORNAN/21-141     AC A0A6I8PDA4.1
#=GS A0A6J8CT55_MYTCO/21-141     AC A0A6J8CT55.1
#=GS A0A6P6UY88_COFAR/38-159     AC A0A6P6UY88.1
#=GS A0A1V6R6S0_9EURO/32-154     AC A0A1V6R6S0.1
#=GS A0A2K6SIW6_SAIBB/21-73      AC A0A2K6SIW6.1
#=GS W6QFD5_PENRF/32-154         AC W6QFD5.1
#=GS A0A091KSK6_9GRUI/8-128      AC A0A091KSK6.1
#=GS H2LW02_ORYLA/24-145         AC H2LW02.2
#=GS A0A6J2WRN2_CHACN/23-143     AC A0A6J2WRN2.1
#=GS A0A2R8MAN8_CALJA/471-591    AC A0A2R8MAN8.2
#=GS A0A446USX8_TRITD/30-155     AC A0A446USX8.1
#=GS A0A1X1BH87_9APIC/33-148     AC A0A1X1BH87.1
#=GS A0A1B7NNK9_9EURO/33-155     AC A0A1B7NNK9.1
#=GS A0A177CQ08_9PLEO/2-106      AC A0A177CQ08.1
#=GS A0A2R8ZX78_PANPA/18-138     AC A0A2R8ZX78.1
#=GS G7JPJ7_MEDTR/36-157         AC G7JPJ7.1
#=GS A0A2K1QMN6_9PEZI/25-154     AC A0A2K1QMN6.1
#=GS A0A0D9QYD9_CHLSB/12-132     AC A0A0D9QYD9.1
#=GS A0A0A2JSJ6_PENEN/32-154     AC A0A0A2JSJ6.1
#=GS A0A1L8GE79_XENLA/21-141     AC A0A1L8GE79.1
#=GS A0A0M4F1U6_DROBS/22-142     AC A0A0M4F1U6.1
#=GS A0A7N5JJ48_AILME/1-112      AC A0A7N5JJ48.1
#=GS A0A663EZF7_AQUCH/1-102      AC A0A663EZF7.1
#=GS A0A2Z7DFB4_9LAMI/31-152     AC A0A2Z7DFB4.1
#=GS A0A3Q3L9R4_9TELE/22-142     AC A0A3Q3L9R4.1
#=GS A0A319EMD5_ASPSB/33-155     AC A0A319EMD5.1
#=GS A0A1U7YBL0_NICSY/49-168     AC A0A1U7YBL0.1
#=GS A0A3Q0GHP4_ALLSI/21-141     AC A0A3Q0GHP4.1
#=GS L5KY97_PTEAL/69-189         AC L5KY97.1
#=GS A0A096LPP7_POEFO/1-89       AC A0A096LPP7.1
#=GS H0WEZ6_DANRE/23-143         AC H0WEZ6.1
#=GS A0A1M8A9M6_MALS4/22-144     AC A0A1M8A9M6.1
#=GS A0A078FYV7_BRANA/36-156     AC A0A078FYV7.1
#=GS A0A2K6RHQ7_RHIRO/36-119     AC A0A2K6RHQ7.1
#=GS A0A673UWJ6_SURSU/38-121     AC A0A673UWJ6.1
#=GS A0A3Q0GHP4_ALLSI/433-553    AC A0A3Q0GHP4.1
#=GS N1RXI4_FUSC4/34-156         AC N1RXI4.1
#=GS G7XMN5_ASPKW/68-176         AC G7XMN5.1
#=GS W9XRL9_9EURO/26-148         AC W9XRL9.1
#=GS W9VRM5_9EURO/26-148         AC W9VRM5.1
#=GS F7G233_MONDO/7-105          AC F7G233.3
#=GS A0A6P5RFZ1_PRUAV/41-162     AC A0A6P5RFZ1.1
#=GS M4CVK1_BRARP/73-198         AC M4CVK1.1
#=GS A0A6A2ZF55_HIBSY/41-162     AC A0A6A2ZF55.1
#=GS A0A452FK29_CAPHI/17-137     AC A0A452FK29.1
#=GS V5B2G1_TRYCR/125-209        AC V5B2G1.1
#=GS A0A094BHG4_9PEZI/26-148     AC A0A094BHG4.1
#=GS A0A2A9P705_9HYPO/25-147     AC A0A2A9P705.1
#=GS A0A4Z2CSL4_SCHJA/1-78       AC A0A4Z2CSL4.1
#=GS A0A087X9H1_POEFO/22-142     AC A0A087X9H1.1
#=GS A0A6A3ABS2_HIBSY/33-156     AC A0A6A3ABS2.1
#=GS A0A5F5XBW6_FELCA/21-141     AC A0A5F5XBW6.1
#=GS A0A061FR54_THECC/41-162     AC A0A061FR54.1
#=GS A0A2U3X195_ODORO/36-119     AC A0A2U3X195.1
#=GS A0A507F210_9FUNG/11-130     AC A0A507F210.1
#=GS A0A084WA88_ANOSI/22-141     AC A0A084WA88.1
#=GS A0A444TM76_ARMVU/35-155     AC A0A444TM76.1
#=GS A0A5B7DGN9_PORTR/10-69      AC A0A5B7DGN9.1
#=GS A0A6G0UGH6_9BILA/22-142     AC A0A6G0UGH6.1
#=GS A0A5D2XP94_GOSMU/41-162     AC A0A5D2XP94.1
#=GS G1T6F8_RABIT/21-141         AC G1T6F8.2
#=GS A0A4W4HKU5_ELEEL/22-142     AC A0A4W4HKU5.1
#=GS A0A2U9BZ30_SCOMX/22-142     AC A0A2U9BZ30.1
#=GS X0DBJ4_FUSOX/25-147         AC X0DBJ4.1
#=GS A0A2K5X8M5_MACFA/21-72      AC A0A2K5X8M5.2
#=GS A0A2I2Z4S2_GORGO/21-141     AC A0A2I2Z4S2.1
#=GS A0A0D2RBF7_GOSRA/41-162     AC A0A0D2RBF7.1
#=GS A0A3P8B3J0_9TREM/1-116      AC A0A3P8B3J0.1
#=GS A0A1R2CYD1_9CILI/25-145     AC A0A1R2CYD1.1
#=GS A0A4W4HBB4_ELEEL/26-147     AC A0A4W4HBB4.1
#=GS A0A1A0HK27_9ASCO/26-165     AC A0A1A0HK27.1
#=GS A0A4X2JSU9_VOMUR/21-141     AC A0A4X2JSU9.1
#=GS A0A165HJP5_XYLHT/26-148     AC A0A165HJP5.1
#=GS A0A6P7L2U2_BETSP/24-145     AC A0A6P7L2U2.1
#=GS A0A4U6V6Y9_SETVI/30-153     AC A0A4U6V6Y9.1
#=GS A0A0B1PEA2_UNCNE/27-149     AC A0A0B1PEA2.1
#=GS A0A6P6JGT9_CARAU/22-142     AC A0A6P6JGT9.1
#=GS A0A7E5WT41_TRINI/21-141     AC A0A7E5WT41.1
#=GS A0A2X0LIF7_9BASI/22-159     AC A0A2X0LIF7.1
#=GS R0JCV9_ANAPL/7-127          AC R0JCV9.1
#=GS A0A341D330_NEOAA/21-141     AC A0A341D330.1
#=GS A0A6P4ABF2_ZIZJJ/34-153     AC A0A6P4ABF2.1
#=GS A0A6P9A897_THRPL/24-145     AC A0A6P9A897.1
#=GS A0A6P6ET77_OCTDE/21-141     AC A0A6P6ET77.1
#=GS A0A3Q2E6B9_CYPVA/53-174     AC A0A3Q2E6B9.1
#=GS A0A2R8ZX84_PANPA/21-141     AC A0A2R8ZX84.1
#=GS A0A498L7R9_LABRO/62-172     AC A0A498L7R9.1
#=GS A0A091IWK2_EGRGA/8-128      AC A0A091IWK2.1
#=GS A0A3Q2CNV0_CYPVA/22-142     AC A0A3Q2CNV0.1
#=GS A0A077Z353_TRITR/3-114      AC A0A077Z353.1
#=GS A0A448YMG0_BRENA/26-158     AC A0A448YMG0.1
#=GS A0A1U7RI31_MESAU/21-141     AC A0A1U7RI31.1
#=GS A0A1U8BPA6_NELNU/33-152     AC A0A1U8BPA6.1
#=GS A0A452J4Z3_9SAUR/21-141     AC A0A452J4Z3.1
#=GS A0A6P8I4Z5_ACTTE/20-140     AC A0A6P8I4Z5.1
#=GS A0A100IM55_ASPNG/66-176     AC A0A100IM55.1
#=GS F7W5S4_SORMK/25-147         AC F7W5S4.1
#=GS A0A5J5F904_9PEZI/32-154     AC A0A5J5F904.1
#=GS A0A0D7B5Z7_9AGAR/23-145     AC A0A0D7B5Z7.1
#=GS M7AXD0_CHEMY/14-134         AC M7AXD0.1
#=GS A0A2K0UTN7_GIBNY/25-147     AC A0A2K0UTN7.1
#=GS A0A5N6PFA1_9ASTR/33-152     AC A0A5N6PFA1.1
#=GS G8BEB9_CANPC/28-168         AC G8BEB9.1
#=GS A0A2K5ZMI4_MANLE/21-141     AC A0A2K5ZMI4.1
#=GS A0A7N5K9X7_AILME/23-143     AC A0A7N5K9X7.1
#=GS A0A096N0J0_PAPAN/9-129      AC A0A096N0J0.2
#=GS A0A1V8UVP2_9PEZI/25-147     AC A0A1V8UVP2.1
#=GS A0A2V1E3U2_9PLEO/26-148     AC A0A2V1E3U2.1
#=GS A0A0D2WTL7_CAPO3/21-141     AC A0A0D2WTL7.1
#=GS A0A6P5Z1V1_DURZI/41-162     AC A0A6P5Z1V1.1
#=GS H9J3P9_BOMMO/1-47           AC H9J3P9.1
#=GS A0A2K5X8J8_MACFA/69-189     AC A0A2K5X8J8.2
#=GS A0A1B8B7M5_FUSPO/25-147     AC A0A1B8B7M5.1
#=GS A0A1E5V7Q2_9POAL/30-153     AC A0A1E5V7Q2.1
#=GS A0A1E4S5Q6_CYBJN/24-145     AC A0A1E4S5Q6.1
#=GS V5BCE4_TRYCR/91-172         AC V5BCE4.1
#=GS A0A226P419_COLVI/21-135     AC A0A226P419.1
#=GS A0A6P5RHK2_PRUAV/41-162     AC A0A6P5RHK2.1
#=GS A0A200Q4H6_9MAGN/33-147     AC A0A200Q4H6.1
#=GS A0A669CEW6_ORENI/22-142     AC A0A669CEW6.1
#=GS A0A6J1SNK7_FRAOC/23-144     AC A0A6J1SNK7.1
#=GS W7MQE3_GIBM7/1-58           AC W7MQE3.1
#=GS A0A1U7TZ23_CARSF/36-119     AC A0A1U7TZ23.1
#=GS A0A091L8R7_CATAU/8-128      AC A0A091L8R7.1
#=GS A0A0K9RM83_SPIOL/33-152     AC A0A0K9RM83.1
#=GS A0A1G4AYQ7_9PEZI/25-147     AC A0A1G4AYQ7.1
#=GS A0A182E5D2_ONCOC/25-145     AC A0A182E5D2.1
#=GS A0A099ZM13_TINGU/21-140     AC A0A099ZM13.1
#=GS M4B5Q1_HYAAE/7-113          AC M4B5Q1.1
#=GS A0A6P5B121_BOSIN/21-141     AC A0A6P5B121.1
#=GS G1K889_ANOCA/21-141         AC G1K889.1
#=GS H3APC2_LATCH/22-142         AC H3APC2.1
#=GS A0A6J2WQ97_CHACN/21-141     AC A0A6J2WQ97.1
#=GS R9NYU6_PSEHS/23-145         AC R9NYU6.1
#=GS A0A7N5JVT3_AILME/50-170     AC A0A7N5JVT3.1
#=GS A0A4X2JLQ6_VOMUR/21-141     AC A0A4X2JLQ6.1
#=GS A0A316VRR9_9BASI/23-145     AC A0A316VRR9.1
#=GS A0A2I3SWF3_PANTR/36-119     AC A0A2I3SWF3.1
#=GS A0A1R2CWV1_9CILI/25-143     AC A0A1R2CWV1.1
#=GS A0A6P8J910_ACTTE/6-127      AC A0A6P8J910.1
#=GS A0A3Q0GHP9_ALLSI/339-459    AC A0A3Q0GHP9.1
#=GS A0A671MI64_9TELE/23-143     AC A0A671MI64.1
#=GS A0A078HXS9_BRANA/27-149     AC A0A078HXS9.1
#=GS A0A0D2A1N4_9PEZI/1-103      AC A0A0D2A1N4.1
#=GS V4M8S0_EUTSA/37-158         AC V4M8S0.1
#=GS A0A0D2F5K4_9EURO/41-163     AC A0A0D2F5K4.1
#=GS A0A1S3ZGJ7_TOBAC/44-165     AC A0A1S3ZGJ7.1
#=GS A0A4W2E7Y9_BOBOX/36-119     AC A0A4W2E7Y9.1
#=GS A0A6J3EVA5_SAPAP/64-184     AC A0A6J3EVA5.1
#=GS A0A0D2IQT3_9EURO/26-148     AC A0A0D2IQT3.1
#=GS A0A6P6JTF8_CARAU/24-145     AC A0A6P6JTF8.1
#=GS A0A067RQG0_ZOONE/1-81       AC A0A067RQG0.1
#=GS A0A663M505_ATHCN/29-148     AC A0A663M505.1
#=GS A0A287D657_ICTTR/21-72      AC A0A287D657.1
#=GS A0A2I2GKN1_9EURO/33-155     AC A0A2I2GKN1.1
#=GS A0A6J3D6U5_AYTFU/21-140     AC A0A6J3D6U5.1
#=GS I2FZR2_USTH4/23-145         AC I2FZR2.1
#=GS A0A671NKU4_9TELE/1-103      AC A0A671NKU4.1
#=GS A0A0V1A5P4_9BILA/38-122     AC A0A0V1A5P4.1
#=GS A0A6I9XRI9_9SAUR/21-141     AC A0A6I9XRI9.1
#=GS F6RMC2_HORSE/21-141         AC F6RMC2.2
#=GS A0A5G2QLI5_PIG/21-141       AC A0A5G2QLI5.1
#=GS N1JEK7_BLUG1/26-148         AC N1JEK7.1
#=GS A0A6P6YFG1_DERPT/23-143     AC A0A6P6YFG1.1
#=GS A0A6P8PIQ3_GEOSA/21-141     AC A0A6P8PIQ3.1
#=GS A0A087VAR1_BALRE/8-128      AC A0A087VAR1.1
#=GS A0A4W4HJ43_ELEEL/22-142     AC A0A4W4HJ43.1
#=GS A0A2K5DC69_AOTNA/21-141     AC A0A2K5DC69.1
#=GS A0A364NDF6_9PLEO/484-606    AC A0A364NDF6.1
#=GS A0A168P0G2_MUCCL/20-141     AC A0A168P0G2.1
#=GS A0A3Q2VG02_HAPBU/21-141     AC A0A3Q2VG02.1
#=GS A0A314Z9P7_PRUYE/40-161     AC A0A314Z9P7.1
#=GS A0A6P3W9G2_CLUHA/22-142     AC A0A6P3W9G2.1
#=GS E1BUH9_CHICK/21-140         AC E1BUH9.2
#=GS E3NT13_CAERE/21-119         AC E3NT13.1
#=GS D3Z2V5_MOUSE/7-119          AC D3Z2V5.1
#=GS A0A5B6W9C7_9ROSI/41-162     AC A0A5B6W9C7.1
#=GS A0A2K5DC56_AOTNA/21-141     AC A0A2K5DC56.1
#=GS A0A6J3D7A8_AYTFU/21-141     AC A0A6J3D7A8.1
#=GS T1FN37_HELRO/20-140         AC T1FN37.1
#=GS S7QBE9_MYOBR/12-132         AC S7QBE9.1
#=GS Q4UHS4_THEAN/19-133         AC Q4UHS4.1
#=GS A0A4Q1BWH0_TREME/24-146     AC A0A4Q1BWH0.1
#=GS A0A086SWL9_ACRC1/25-147     AC A0A086SWL9.1
#=GS A0A3Q7PVY0_CALUR/23-143     AC A0A3Q7PVY0.1
#=GS A0A0Q3GQ74_BRADI/62-192     AC A0A0Q3GQ74.1
#=GS A0A1W0X549_HYPDU/535-615    AC A0A1W0X549.1
#=GS A0A1V6UJS5_9EURO/32-154     AC A0A1V6UJS5.1
#=GS A0A0D2AE52_EXOME/26-148     AC A0A0D2AE52.1
#=GS A0A2I0MHN6_COLLI/36-156     AC A0A2I0MHN6.1
#=GS A0A0L0GGD4_9EUKA/25-144     AC A0A0L0GGD4.1
#=GS A0A090LKR2_STRRB/20-140     AC A0A090LKR2.1
#=GS H3APC3_LATCH/8-128          AC H3APC3.1
#=GS H3C5P9_TETNG/8-129          AC H3C5P9.1
#=GS F9F4J5_FUSOF/25-147         AC F9F4J5.1
#=GS U5H7F6_USTV1/22-147         AC U5H7F6.1
#=GS A0A0V1MP35_9BILA/35-155     AC A0A0V1MP35.1
#=GS A0A162JBT2_9PEZI/25-147     AC A0A162JBT2.1
#=GS F0UPK3_AJEC8/33-120         AC F0UPK3.1
#=GS A0A091CLH6_FUKDA/21-141     AC A0A091CLH6.1
#=GS A0A3P8VD17_CYNSE/21-141     AC A0A3P8VD17.1
#=GS A0A026WXG7_OOCBI/25-145     AC A0A026WXG7.1
#=GS A0A6J2AJU8_ACIJB/21-141     AC A0A6J2AJU8.1
#=GS A0A341D0D7_NEOAA/21-141     AC A0A341D0D7.1
#=GS B5RUR2_DEBHA/26-164         AC B5RUR2.1
#=GS A0A2G2VU54_CAPBA/35-156     AC A0A2G2VU54.1
#=GS A0A6P3Y864_DINQU/25-145     AC A0A6P3Y864.1
#=GS A0A340Y2F3_LIPVE/37-119     AC A0A340Y2F3.1
#=GS Q4E474_TRYCC/124-207        AC Q4E474.1
#=GS B0CSB9_LACBS/23-145         AC B0CSB9.1
#=GS A0A3Q4GYV4_NEOBR/21-72      AC A0A3Q4GYV4.1
#=GS Q4SDZ6_TETNG/21-141         AC Q4SDZ6.1
#=GS A0A6P5BD80_BOSIN/21-141     AC A0A6P5BD80.1
#=GS A0A1D2M6F0_ORCCI/1-56       AC A0A1D2M6F0.1
#=GS A0A3Q7RNZ5_VULVU/21-141     AC A0A3Q7RNZ5.1
#=GS A0A6A5ELL9_PERFL/24-145     AC A0A6A5ELL9.1
#=GS A0A177DVK7_ALTAL/24-146     AC A0A177DVK7.1
#=GS A0A194UYE6_9PEZI/3-108      AC A0A194UYE6.1
#=GS A0A2U3YST3_LEPWE/21-141     AC A0A2U3YST3.1
#=GS A0A1U8P6A7_GOSHI/34-155     AC A0A1U8P6A7.1
#=GS A0A6P8FMZ0_CLUHA/22-142     AC A0A6P8FMZ0.1
#=GS A0A444E5J9_ENSVE/38-162     AC A0A444E5J9.1
#=GS A0A663EYH6_AQUCH/1-102      AC A0A663EYH6.1
#=GS A0A4W5JN77_9TELE/13-133     AC A0A4W5JN77.1
#=GS D3Z0S9_MOUSE/1-47           AC D3Z0S9.2
#=GS A0A151Z365_9MYCE/34-146     AC A0A151Z365.1
#=GS A0A6G0IYX3_LARCR/21-141     AC A0A6G0IYX3.1
#=GS A0A3N0YFL9_ANAGA/1-99       AC A0A3N0YFL9.1
#=GS B9S4R4_RICCO/34-157         AC B9S4R4.1
#=GS A0A6I9ZCC7_GEOFO/1-102      AC A0A6I9ZCC7.1
#=GS W7MEF3_GIBM7/25-147         AC W7MEF3.1
#=GS A0A6D2JZX9_9BRAS/298-417    AC A0A6D2JZX9.1
#=GS A0A067PBL2_PLEOS/27-149     AC A0A067PBL2.1
#=GS F7BRH9_ORNAN/21-141         AC F7BRH9.2
#=GS A0A166GSZ7_DAUCS/38-159     AC A0A166GSZ7.1
#=GS A0A6P6G072_ZIZJJ/44-165     AC A0A6P6G072.1
#=GS A0A4W2BQK4_BOBOX/21-141     AC A0A4W2BQK4.1
#=GS Q4WYV3_ASPFU/33-155         AC Q4WYV3.1
#=GS I3KB23_ORENI/21-141         AC I3KB23.1
#=GS A0A0D0CML2_9AGAR/25-163     AC A0A0D0CML2.1
#=GS A0A3N6U5S0_BRACR/37-157     AC A0A3N6U5S0.1
#=GS D0ND31_PHYIT/330-450        AC D0ND31.1
#=GS A0A0G4P7Z5_PENCA/32-154     AC A0A0G4P7Z5.1
#=GS A0A0Q3U0B3_AMAAE/23-142     AC A0A0Q3U0B3.1
#=GS M5GGL2_DACPD/30-152         AC M5GGL2.1
#=GS G0S9F7_CHATD/9-112          AC G0S9F7.1
#=GS A0A6P7XWR9_9AMPH/1-103      AC A0A6P7XWR9.1
#=GS A0A6P9E011_JUGRE/41-162     AC A0A6P9E011.1
#=GS A0A1Y1ZFJ2_9PLEO/26-148     AC A0A1Y1ZFJ2.1
#=GS A0A067BZX7_SAPPC/25-145     AC A0A067BZX7.1
#=GS A0A1D5QFP8_MACMU/23-143     AC A0A1D5QFP8.2
#=GS A0A2U1L479_ARTAN/41-162     AC A0A2U1L479.1
#=GS A0A662Y4C9_9STRA/972-1092   AC A0A662Y4C9.1
#=GS A0A485NY25_LYNPA/23-143     AC A0A485NY25.1
#=GS A0A1D2VQQ3_9ASCO/26-152     AC A0A1D2VQQ3.1
#=GS A0A0E0CTL9_9ORYZ/45-172     AC A0A0E0CTL9.1
#=GS A0A316V9C9_9BASI/23-145     AC A0A316V9C9.1
#=GS A0A329SZ62_9STRA/25-145     AC A0A329SZ62.1
#=GS A0A1Y2IKD4_PYCCO/25-147     AC A0A1Y2IKD4.1
#=GS A0A565B991_9BRAS/37-158     AC A0A565B991.1
#=GS A0A3B6KKU0_WHEAT/43-165     AC A0A3B6KKU0.1
#=GS A0A091UJ99_NIPNI/8-128      AC A0A091UJ99.1
#=GS A0A663M5V2_ATHCN/21-138     AC A0A663M5V2.1
#=GS A0A0G2GNX8_9EURO/589-638    AC A0A0G2GNX8.1
#=GS C4M9S4_ENTHI/24-140         AC C4M9S4.1
#=GS A0A0A1TI53_9HYPO/25-147     AC A0A0A1TI53.1
#=GS A0A0V0X969_9BILA/24-144     AC A0A0V0X969.1
#=GS A0A317WJA8_9EURO/33-155     AC A0A317WJA8.1
#=GS A0A0C4EWP8_PUCT1/46-156     AC A0A0C4EWP8.1
#=GS A0A162MPS9_CORFA/25-147     AC A0A162MPS9.1
#=GS A0A3B5Q0P4_XIPMA/22-142     AC A0A3B5Q0P4.1
#=GS A0A0C3AW68_9AGAM/21-143     AC A0A0C3AW68.1
#=GS A0A022S1A0_ERYGU/35-155     AC A0A022S1A0.1
#=GS A0A1L8GI41_XENLA/1-98       AC A0A1L8GI41.1
#=GS A0A6P9BSB7_PANGU/8-128      AC A0A6P9BSB7.1
#=GS L1IJT2_GUITC/1-81           AC L1IJT2.1
#=GS A0A1Q9D930_SYMMI/1-72       AC A0A1Q9D930.1
#=GS A0A397GCY8_9EURO/33-155     AC A0A397GCY8.1
#=GS A0A2I3LWH0_PAPAN/12-132     AC A0A2I3LWH0.1
#=GS A0A2S4VS78_9BASI/22-125     AC A0A2S4VS78.1
#=GS A0A061DQB8_THECC/33-152     AC A0A061DQB8.1
#=GS W5JIK1_ANODA/22-142         AC W5JIK1.1
#=GS A0A3L6QGY7_PANMI/43-165     AC A0A3L6QGY7.1
#=GS G7PQL3_MACFA/21-141         AC G7PQL3.1
#=GS A0A1R3KQ00_9ROSI/41-162     AC A0A1R3KQ00.1
#=GS A0A444UMY6_ACIRT/22-142     AC A0A444UMY6.1
#=GS A0A2A2J5F5_9BILA/75-195     AC A0A2A2J5F5.1
#=GS A0A5N6LAZ6_9ASTR/42-163     AC A0A5N6LAZ6.1
#=GS A0A1Q5QBH5_9EURO/33-155     AC A0A1Q5QBH5.1
#=GS A0A484D1S4_PERFV/21-141     AC A0A484D1S4.1
#=GS A0A5B6WIE9_9ROSI/63-135     AC A0A5B6WIE9.1
#=GS A0A7N5PA08_AILME/59-179     AC A0A7N5PA08.1
#=GS A0A165KFB9_9APHY/25-135     AC A0A165KFB9.1
#=GS A0A384BSD5_URSMA/1-80       AC A0A384BSD5.1
#=GS A0A0F8CZB9_CERFI/25-147     AC A0A0F8CZB9.1
#=GS A0A6P8Q992_GEOSA/1-47       AC A0A6P8Q992.1
#=GS A0A0J7L578_LASNI/25-145     AC A0A0J7L578.1
#=GS A0A5N6VDC3_9EURO/33-155     AC A0A5N6VDC3.1
#=GS A0A182GPL4_AEDAL/17-137     AC A0A182GPL4.1
#=GS A0A3Q1LZA3_BOVIN/1-102      AC A0A3Q1LZA3.1
#=GS Q4DA96_TRYCC/124-208        AC Q4DA96.1
#=GS A0A261Y092_9FUNG/23-145     AC A0A261Y092.1
#=GS A0A4E0R7K2_FASHE/21-141     AC A0A4E0R7K2.1
#=GS A0A1L9UCW0_ASPBC/33-155     AC A0A1L9UCW0.1
#=GS A0A5J9UIN3_9POAL/165-273    AC A0A5J9UIN3.1
#=GS A0A101MNK6_9EURO/32-154     AC A0A101MNK6.1
#=GS A0A1L9NFQ6_ASPTC/33-155     AC A0A1L9NFQ6.1
#=GS A0A2V3ITJ3_9FLOR/35-157     AC A0A2V3ITJ3.1
#=GS A0A392QIL4_9FABA/42-163     AC A0A392QIL4.1
#=GS A0A0A0KT64_CUCSA/44-165     AC A0A0A0KT64.1
#=GS A5DLZ2_PICGU/26-162         AC A5DLZ2.2
#=GS A0A5N5ND53_9ROSI/38-159     AC A0A5N5ND53.1
#=GS A0A6P9BP77_PANGU/21-141     AC A0A6P9BP77.1
#=GS A0A2R9AWV2_PANPA/21-141     AC A0A2R9AWV2.1
#=GS F1PQX3_CANLF/35-118         AC F1PQX3.3
#=GS A0A3Q1J802_ANATE/21-76      AC A0A3Q1J802.1
#=GS A0A2I3M6T7_PAPAN/21-141     AC A0A2I3M6T7.1
#=GS A0A2G2X618_CAPBA/50-170     AC A0A2G2X618.1
#=GS A0A068Y336_ECHMU/100-220    AC A0A068Y336.1
#=GS A0A2K5C4H3_AOTNA/21-141     AC A0A2K5C4H3.1
#=GS A0A2K5JZZ1_COLAP/22-116     AC A0A2K5JZZ1.1
#=GS A0A2K5S838_CEBIM/21-141     AC A0A2K5S838.1
#=GS N1QB75_PSEFD/42-164         AC N1QB75.1
#=GS A0A5A9PQT2_9TELE/29-149     AC A0A5A9PQT2.1
#=GS A0A6J5Y4C9_PRUAR/49-174     AC A0A6J5Y4C9.1
#=GS G2X5W8_VERDV/26-134         AC G2X5W8.1
#=GS M4CB71_BRARP/37-158         AC M4CB71.1
#=GS A0A158PJS4_ANGCS/28-144     AC A0A158PJS4.1
#=GS A0A6I9T993_SESIN/33-153     AC A0A6I9T993.1
#=GS A0A315VNU9_GAMAF/22-142     AC A0A315VNU9.1
#=GS A0A0C3AJW1_9AGAM/24-146     AC A0A0C3AJW1.1
#=GS A0A5F8GZK3_MONDO/103-208    AC A0A5F8GZK3.1
#=GS A0A673UXU3_SURSU/37-119     AC A0A673UXU3.1
#=GS A0A452CBH9_BALAS/21-141     AC A0A452CBH9.1
#=GS A0A4Q4ZNI7_9PEZI/25-147     AC A0A4Q4ZNI7.1
#=GS A0A3M6ULB7_POCDA/9-129      AC A0A3M6ULB7.1
#=GS A0A059D226_EUCGR/33-155     AC A0A059D226.1
#=GS A0A484DWJ4_BRELC/45-165     AC A0A484DWJ4.1
#=GS G3UDD7_LOXAF/21-141         AC G3UDD7.1
#=GS A0A671FWS3_RHIFE/21-141     AC A0A671FWS3.1
#=GS A0A6P3VXT0_CLUHA/21-141     AC A0A6P3VXT0.1
#=GS A0A5A9PS66_9TELE/23-143     AC A0A5A9PS66.1
#=GS A0A2Y9JQ99_ENHLU/21-141     AC A0A2Y9JQ99.1
#=GS A0A3P8Z5N4_ESOLU/20-140     AC A0A3P8Z5N4.2
#=GS A0A2I4AIC2_9TELE/24-145     AC A0A2I4AIC2.1
#=GS A0A161W0L2_9PEZI/25-147     AC A0A161W0L2.1
#=GS A0A2K5SC55_CEBIM/20-140     AC A0A2K5SC55.1
#=GS A0A1Y1WCD5_9FUNG/1-86       AC A0A1Y1WCD5.1
#=GS A0A0F0I7R7_ASPPU/385-507    AC A0A0F0I7R7.1
#=GS A0A3Q7HZ13_SOLLC/45-166     AC A0A3Q7HZ13.1
#=GS A0A5N5DN80_9PEZI/67-175     AC A0A5N5DN80.1
#=GS A0A5F4D8C2_CANLF/62-182     AC A0A5F4D8C2.1
#=GS V9DWH8_PHYPR/25-145         AC V9DWH8.1
#=GS A0A084FZY5_PSEDA/31-153     AC A0A084FZY5.1
#=GS H3GRU5_PHYRM/25-139         AC H3GRU5.1
#=GS A0A0D2B7C2_9EURO/26-148     AC A0A0D2B7C2.1
#=GS A0A3B6KS41_WHEAT/30-154     AC A0A3B6KS41.1
#=GS A0A0C9X8X0_9AGAR/22-144     AC A0A0C9X8X0.1
#=GS A0A7N4PQJ2_SARHA/1-103      AC A0A7N4PQJ2.1
#=GS G2YDZ8_BOTF4/26-148         AC G2YDZ8.1
#=GS A0A4Z0Z9T3_9PEZI/25-147     AC A0A4Z0Z9T3.1
#=GS A0A6J2PV87_COTGO/21-141     AC A0A6J2PV87.1
#=GS A0A550CLW8_9AGAR/27-149     AC A0A550CLW8.1
#=GS A0A3Q0GE12_ALLSI/420-540    AC A0A3Q0GE12.1
#=GS A0A1U8P639_GOSHI/1-66       AC A0A1U8P639.1
#=GS B5X3I4_SALSA/21-141         AC B5X3I4.1
#=GS A0A212FP45_DANPL/1-47       AC A0A212FP45.1
#=GS A0A6J0XJS8_ODOVR/21-141     AC A0A6J0XJS8.1
#=GS A0A0L6WFC2_9AGAR/25-147     AC A0A0L6WFC2.1
#=GS A0A369S2L0_9METZ/20-147     AC A0A369S2L0.1
#=GS A0A1S4DCE8_TOBAC/37-158     AC A0A1S4DCE8.1
#=GS A0A7H9AY83_ZYGMR/35-150     AC A0A7H9AY83.1
#=GS K0KE88_WICCF/18-145         AC K0KE88.1
#=GS A0A5G2R2A4_PIG/36-119       AC A0A5G2R2A4.1
#=GS A0A670XNM7_PSETE/21-141     AC A0A670XNM7.1
#=GS A0A2K6CCQ9_MACNE/21-141     AC A0A2K6CCQ9.1
#=GS A0A369JIJ8_HYPMA/22-144     AC A0A369JIJ8.1
#=GS A0A1Y1XFD7_9FUNG/6-101      AC A0A1Y1XFD7.1
#=GS A0A6P7MQ90_BETSP/21-141     AC A0A6P7MQ90.1
#=GS A0A6J3EQ96_SAPAP/20-140     AC A0A6J3EQ96.1
#=GS A0A2I1BTR6_ASPN1/48-170     AC A0A2I1BTR6.1
#=GS A0A2I2F2G2_9EURO/33-155     AC A0A2I2F2G2.1
#=GS A0A6P6ESW6_OCTDE/21-141     AC A0A6P6ESW6.1
#=GS A0A5N5L997_9PEZI/25-147     AC A0A5N5L997.1
#=GS A0A226P3E7_COLVI/39-119     AC A0A226P3E7.1
#=GS A0A455C860_PHYMC/1-47       AC A0A455C860.1
#=GS A0A5E4Q5Y0_9NEOP/21-141     AC A0A5E4Q5Y0.1
#=GS A0A060S7W7_PYCCI/25-147     AC A0A060S7W7.1
#=GS A0A367K3I2_RHIAZ/19-140     AC A0A367K3I2.1
#=GS A0A2Y9D851_TRIMA/21-141     AC A0A2Y9D851.1
#=GS A0A0V0U1W2_9BILA/36-119     AC A0A0V0U1W2.1
#=GS A0A1E3P650_WICAA/1-89       AC A0A1E3P650.1
#=GS A0A1S8BK57_9PEZI/26-148     AC A0A1S8BK57.1
#=GS A0A6J8CH56_MYTCO/21-141     AC A0A6J8CH56.1
#=GS A0A195AWK8_9HYME/25-145     AC A0A195AWK8.1
#=GS A0A183NJG5_9TREM/39-105     AC A0A183NJG5.1
#=GS A0A094D030_9PEZI/26-148     AC A0A094D030.1
#=GS A0A132AIN5_SARSC/13-133     AC A0A132AIN5.1
#=GS A0A423VXB7_9PEZI/25-147     AC A0A423VXB7.1
#=GS H3CMA3_TETNG/22-142         AC H3CMA3.1
#=GS A0A6P6KFB1_CARAU/23-143     AC A0A6P6KFB1.1
#=GS A0A1U7LNE6_NEOID/25-128     AC A0A1U7LNE6.1
#=GS G4UXI3_NEUT9/25-147         AC G4UXI3.1
#=GS A0A218YS03_9HELO/26-148     AC A0A218YS03.1
#=GS G0SXL9_RHOT2/437-560        AC G0SXL9.1
#=GS A0A3Q1FUS1_9TELE/21-141     AC A0A3Q1FUS1.1
#=GS A0A0V1DHC5_TRIBR/24-144     AC A0A0V1DHC5.1
#=GS A0A1S3XQZ1_TOBAC/45-166     AC A0A1S3XQZ1.1
#=GS A0A6I8W2F3_DROPS/22-142     AC A0A6I8W2F3.1
#=GS A0A397HZN3_9GLOM/31-154     AC A0A397HZN3.1
#=GS A0A162VJA9_DIDRA/25-147     AC A0A162VJA9.1
#=GS A0A484BY26_DRONA/22-142     AC A0A484BY26.1
#=GS A0A167VMN4_9EURO/39-167     AC A0A167VMN4.1
#=GS A0A1Y1K7W7_PHOPY/22-142     AC A0A1Y1K7W7.1
#=GS A0A2R9AQ37_PANPA/21-141     AC A0A2R9AQ37.1
#=GS A0A2H3C8A7_9AGAR/23-145     AC A0A2H3C8A7.1
#=GS A0A3Q7JGU6_SOLLC/35-156     AC A0A3Q7JGU6.1
#=GS A0A6J1SVM2_FRAOC/23-144     AC A0A6J1SVM2.1
#=GS A0A1L9WGR2_ASPA1/33-155     AC A0A1L9WGR2.1
#=GS A0A3P7EAM7_WUCBA/28-107     AC A0A3P7EAM7.1
#=GS A0A7F8PWG2_LEPWE/23-143     AC A0A7F8PWG2.1
#=GS A0A669QYB9_PHACC/21-140     AC A0A669QYB9.1
#=GS A0A6J2AG91_ACIJB/21-141     AC A0A6J2AG91.1
#=GS A0A1W0X4Y2_HYPDU/11-92      AC A0A1W0X4Y2.1
#=GS A0A673BN40_9TELE/22-138     AC A0A673BN40.1
#=GS S0E9D2_GIBF5/25-147         AC S0E9D2.1
#=GS A0A1D2MHL2_ORCCI/23-153     AC A0A1D2MHL2.1
#=GS A0A3B3IPA0_ORYLA/22-142     AC A0A3B3IPA0.1
#=GS A0A671XVE8_SPAAU/21-141     AC A0A671XVE8.1
#=GS K1WUH6_MARBU/26-148         AC K1WUH6.1
#=GS A0A674DD49_SALTR/22-142     AC A0A674DD49.1
#=GS A0A3Q2DXC9_CYPVA/21-141     AC A0A3Q2DXC9.1
#=GS A0A667X0Q7_9TELE/22-142     AC A0A667X0Q7.1
#=GS A0A6J2WRP0_CHACN/22-142     AC A0A6J2WRP0.1
#=GS F5H442_HUMAN/21-141         AC F5H442.1
#=GS F4Q6S1_CAVFA/26-145         AC F4Q6S1.1
#=GS A0A2K6RHM5_RHIRO/14-134     AC A0A2K6RHM5.1
#=GS A0A2R8MAN8_CALJA/69-189     AC A0A2R8MAN8.2
#=GS M2WWG6_GALSU/32-153         AC M2WWG6.1
#=GS A0A2K6NCD3_RHIRO/12-132     AC A0A2K6NCD3.1
#=GS Q6FS29_CANGA/27-147         AC Q6FS29.1
#=GS A0A0D3FCI7_9ORYZ/45-133     AC A0A0D3FCI7.1
#=GS A0A5E4G941_PRUDU/41-92      AC A0A5E4G941.1
#=GS F0ZTJ6_DICPU/42-159         AC F0ZTJ6.1
#=GS A0A2J6KTJ6_LACSA/33-154     AC A0A2J6KTJ6.1
#=GS B9GXA7_POPTR/38-159         AC B9GXA7.1
#=GS A0A2B4RII4_STYPI/20-140     AC A0A2B4RII4.1
#=GS A2EN70_TRIVA/20-134         AC A2EN70.1
#=GS A0A1V4JNQ3_PATFA/36-119     AC A0A1V4JNQ3.1
#=GS A0A2B7YG57_9EURO/33-155     AC A0A2B7YG57.1
#=GS A0A671Y0A4_SPAAU/22-142     AC A0A671Y0A4.1
#=GS A0A1Y2GPV8_9FUNG/24-146     AC A0A1Y2GPV8.1
#=GS Q4E187_TRYCC/77-161         AC Q4E187.1
#=GS A0A420YFZ0_9PEZI/27-149     AC A0A420YFZ0.1
#=GS A0A200PVL3_9MAGN/41-162     AC A0A200PVL3.1
#=GS A0A4Z1HLN6_9HELO/26-148     AC A0A4Z1HLN6.1
#=GS A9TJ74_PHYPA/39-160         AC A9TJ74.1
#=GS A0A2K6CCQ0_MACNE/16-136     AC A0A2K6CCQ0.1
#=GS A0A2S4L8S4_9HYPO/25-147     AC A0A2S4L8S4.1
#=GS M2PPT3_CERS8/25-147         AC M2PPT3.1
#=GS A8XL86_CAEBR/22-132         AC A8XL86.1
#=GS A0A2H3DSH6_ARMGA/23-145     AC A0A2H3DSH6.1
#=GS A0A673JWU0_9TELE/23-143     AC A0A673JWU0.1
#=GS A0A6A3AMG2_HIBSY/4-124      AC A0A6A3AMG2.1
#=GS A0A6P4XWN7_BRABE/23-143     AC A0A6P4XWN7.1
#=GS B5YNX5_THAPS/27-150         AC B5YNX5.1
#=GS A0A6J0CX61_PERMB/21-141     AC A0A6J0CX61.1
#=GS K7F3W1_PELSI/1-103          AC K7F3W1.1
#=GS W2Y3L1_PHYPR/25-145         AC W2Y3L1.1
#=GS A0A4D9EKQ4_9SAUR/21-141     AC A0A4D9EKQ4.1
#=GS A0A673UMM8_SURSU/21-81      AC A0A673UMM8.1
#=GS A0A093RH68_PYGAD/8-128      AC A0A093RH68.1
#=GS G3BDK1_CANTC/32-171         AC G3BDK1.1
#=GS A0A671REW0_9TELE/1-103      AC A0A671REW0.1
#=GS A0A6J3EVP7_SAPAP/64-184     AC A0A6J3EVP7.1
#=GS A0A5J9WMW9_9POAL/42-164     AC A0A5J9WMW9.1
#=GS E4XMK5_OIKDI/3-120          AC E4XMK5.1
#=GS A0A0S4KKV9_BODSA/57-148     AC A0A0S4KKV9.1
#=GS A0A6P6ESD3_OCTDE/1-47       AC A0A6P6ESD3.1
#=GS I1LPI0_SOYBN/34-155         AC I1LPI0.1
#=GS A0A6P6ESB6_OCTDE/10-93      AC A0A6P6ESB6.1
#=GS A0A4Q4TRC6_9PEZI/25-147     AC A0A4Q4TRC6.1
#=GS A0A2I3RBS4_PANTR/23-143     AC A0A2I3RBS4.1
#=GS A0A6G0WKG4_9STRA/13-133     AC A0A6G0WKG4.1
#=GS H2TSN0_TAKRU/22-142         AC H2TSN0.3
#=GS A0A024UEP7_9STRA/25-145     AC A0A024UEP7.1
#=GS A0A251TIQ9_HELAN/59-178     AC A0A251TIQ9.1
#=GS E3KWF8_PUCGT/25-147         AC E3KWF8.2
#=GS A0A2K3DLC5_CHLRE/31-151     AC A0A2K3DLC5.1
#=GS A0A6J3EQ93_SAPAP/79-162     AC A0A6J3EQ93.1
#=GS A0A0P7UK92_SCLFO/23-143     AC A0A0P7UK92.1
#=GS A0A383USP1_BLUGH/26-148     AC A0A383USP1.1
#=GS A0A672TTV2_STRHB/23-142     AC A0A672TTV2.1
#=GS A0A0E0CTL8_9ORYZ/45-172     AC A0A0E0CTL8.1
#=GS A0A6I9JTS5_CHRAS/21-141     AC A0A6I9JTS5.1
#=GS A0A6J2PWH4_COTGO/21-141     AC A0A6J2PWH4.1
#=GS M1BPA9_SOLTU/50-170         AC M1BPA9.1
#=GS A0A0W4ZNM9_PNEJ7/26-147     AC A0A0W4ZNM9.1
#=GS A0A3P9CN78_9CICH/21-107     AC A0A3P9CN78.1
#=GS A0A5A9PT57_9TELE/22-142     AC A0A5A9PT57.1
#=GS A0A668RIL4_OREAU/22-142     AC A0A668RIL4.1
#=GS A0A1D1V7N9_RAMVA/24-145     AC A0A1D1V7N9.1
#=GS A0A654I8H4_9CEST/7-59       AC A0A654I8H4.1
#=GS A0A1D2MJW1_ORCCI/23-143     AC A0A1D2MJW1.1
#=GS A0A179GB16_PURLI/25-147     AC A0A179GB16.1
#=GS A0A0V1HEX6_9BILA/35-155     AC A0A0V1HEX6.1
#=GS A0A5F5PV93_HORSE/21-72      AC A0A5F5PV93.1
#=GS A0A5A7REZ5_STRAF/125-192    AC A0A5A7REZ5.1
#=GS A0A1B8GY54_9PEZI/26-148     AC A0A1B8GY54.1
#=GS A0A2Y9JQD0_ENHLU/23-143     AC A0A2Y9JQD0.1
#=GS A0A428QFA4_9HYPO/25-147     AC A0A428QFA4.1
#=GS A0A0D1YRA5_9EURO/1-49       AC A0A0D1YRA5.1
#=GS A0A1Y2DR58_9FUNG/24-144     AC A0A1Y2DR58.1
#=GS A0A022Q0B4_ERYGU/31-152     AC A0A022Q0B4.1
#=GS A0A6J0V0V4_9SAUR/21-141     AC A0A6J0V0V4.1
#=GS A0A6J2RFW7_COTGO/14-135     AC A0A6J2RFW7.1
#=GS A0A0W8BUY0_PHYNI/25-145     AC A0A0W8BUY0.1
#=GS B8AFJ3_ORYSI/45-167         AC B8AFJ3.1
#=GS A0A6L2PEI1_COPFO/1-92       AC A0A6L2PEI1.1
#=GS W4KJK5_HETIT/23-109         AC W4KJK5.1
#=GS A0A2K6KQH7_RHIBE/21-72      AC A0A2K6KQH7.1
#=GS A0A670I7U5_PODMU/21-141     AC A0A670I7U5.1
#=GS A0A3P9NMR9_POERE/50-166     AC A0A3P9NMR9.1
#=GS A0A672RX69_SINGR/22-142     AC A0A672RX69.1
#=GS A0A1U7TM32_CARSF/21-141     AC A0A1U7TM32.1
#=GS A0A4W6EHB9_LATCA/21-141     AC A0A4W6EHB9.1
#=GS A0A1W2TCT4_ROSNE/25-147     AC A0A1W2TCT4.1
#=GS A0A2H3H7D3_FUSOX/25-147     AC A0A2H3H7D3.1
#=GS A0A7M7P4V5_STRPU/24-144     AC A0A7M7P4V5.1
#=GS S4RQL0_PETMA/5-115          AC S4RQL0.1
#=GS F7BKV2_CALJA/36-119         AC F7BKV2.3
#=GS A0A218WSM8_PUNGR/37-158     AC A0A218WSM8.1
#=GS A0A2K6CCM4_MACNE/36-119     AC A0A2K6CCM4.1
#=GS A0A6P4FIT5_DRORH/22-142     AC A0A6P4FIT5.1
#=GS A0A2Y9RIT5_TRIMA/21-71      AC A0A2Y9RIT5.1
#=GS M2USC2_COCH5/28-150         AC M2USC2.1
#=GS A0A421JGD5_9ASCO/1-87       AC A0A421JGD5.1
#=GS A0A5F8GY06_MONDO/21-123     AC A0A5F8GY06.1
#=GS A0A3D8S793_9HELO/26-148     AC A0A3D8S793.1
#=GS A0A2D3UV88_9PEZI/24-146     AC A0A2D3UV88.1
#=GS C3Z6I8_BRAFL/1-109          AC C3Z6I8.1
#=GS A0A067JC46_JATCU/33-154     AC A0A067JC46.1
#=GS A0A6J0A988_ACIJB/19-139     AC A0A6J0A988.1
#=GS A0A1J4JA71_9EUKA/21-136     AC A0A1J4JA71.1
#=GS M0RQ57_MUSAM/42-166         AC M0RQ57.1
#=GS A0A1Y1YD06_9FUNG/23-146     AC A0A1Y1YD06.1
#=GS A0A2K5C4J4_AOTNA/21-141     AC A0A2K5C4J4.1
#=GS A0A166C157_9AGAM/21-143     AC A0A166C157.1
#=GS A0A2S7QGL7_9HELO/26-148     AC A0A2S7QGL7.1
#=GS H0VKG4_CAVPO/14-134         AC H0VKG4.2
#=GS A0A2K5KNW7_CERAT/7-127      AC A0A2K5KNW7.1
#=GS A0A1S3JUC6_LINUN/24-144     AC A0A1S3JUC6.1
#=GS A0A0U5G9P7_9EURO/33-155     AC A0A0U5G9P7.1
#=GS E9HTS3_DAPPU/10-130         AC E9HTS3.1
#=GS A7SAT5_NEMVE/20-140         AC A7SAT5.1
#=GS A0A4Q4U503_9PEZI/25-147     AC A0A4Q4U503.1
#=GS A0A401Q3J7_SCYTO/16-136     AC A0A401Q3J7.1
#=GS A0A163DJ19_PHYB8/25-147     AC A0A163DJ19.1
#=GS B3M4D5_DROAN/22-142         AC B3M4D5.1
#=GS A0A674DD34_SALTR/22-142     AC A0A674DD34.1
#=GS A0A420HN69_9PEZI/26-148     AC A0A420HN69.1
#=GS A0A6P4Z6K4_BRABE/43-164     AC A0A6P4Z6K4.1
#=GS A0A5B1QJF9_9AGAM/23-145     AC A0A5B1QJF9.1
#=GS A0A6P7MTE8_BETSP/22-142     AC A0A6P7MTE8.1
#=GS I2JZ69_DEKBR/27-182         AC I2JZ69.1
#=GS A0A2K6RHL3_RHIRO/21-141     AC A0A2K6RHL3.1
#=GS A0A673UXP2_SURSU/21-141     AC A0A673UXP2.1
#=GS A0A2Y9SBZ6_PHYMC/21-141     AC A0A2Y9SBZ6.1
#=GS A0A0D8XTT7_DICVI/23-143     AC A0A0D8XTT7.1
#=GS A0A2K6DP20_MACNE/12-132     AC A0A2K6DP20.1
#=GS V9DY71_PHYPR/25-145         AC V9DY71.1
#=GS A0A671XWH8_SPAAU/21-141     AC A0A671XWH8.1
#=GS A0A2Y9P843_DELLE/21-141     AC A0A2Y9P843.1
#=GS A0A5C3E0T2_9BASI/23-145     AC A0A5C3E0T2.1
#=GS A0A395RQC9_FUSSP/25-158     AC A0A395RQC9.1
#=GS A0A1C7MES6_GRIFR/101-223    AC A0A1C7MES6.1
#=GS A0A3Q1MK61_BOVIN/18-138     AC A0A3Q1MK61.1
#=GS A0A673UMH8_SURSU/21-141     AC A0A673UMH8.1
#=GS A0A5C5G410_9BASI/18-141     AC A0A5C5G410.1
#=GS A0A016SE28_9BILA/23-143     AC A0A016SE28.1
#=GS A0A433PAI7_9FUNG/23-139     AC A0A433PAI7.1
#=GS A0A1R2B668_9CILI/22-141     AC A0A1R2B668.1
#=GS A0A0K9PK70_ZOSMR/42-163     AC A0A0K9PK70.1
#=GS A0A401PA19_SCYTO/34-153     AC A0A401PA19.1
#=GS A0A4U0X9B9_9PEZI/11-133     AC A0A4U0X9B9.1
#=GS A0A2K5X8N4_MACFA/21-141     AC A0A2K5X8N4.2
#=GS A0A4Y7J290_PAPSO/33-154     AC A0A4Y7J290.1
#=GS A0A2K5C4K1_AOTNA/17-137     AC A0A2K5C4K1.1
#=GS A0A445A7Q5_ARAHY/40-161     AC A0A445A7Q5.1
#=GS Q6CS18_KLULA/28-142         AC Q6CS18.2
#=GS A0A4U0UJE1_9PEZI/10-132     AC A0A4U0UJE1.1
#=GS A0A1L9V864_ASPGL/33-155     AC A0A1L9V864.1
#=GS A0A6J2RIC3_COTGO/24-145     AC A0A6J2RIC3.1
#=GS W2Y2Q5_PHYPR/25-145         AC W2Y2Q5.1
#=GS F6QUZ4_CALJA/245-330        AC F6QUZ4.2
#=GS A0A0B0MU89_GOSAR/41-162     AC A0A0B0MU89.1
#=GS H2B056_KAZAF/33-159         AC H2B056.1
#=GS B4J261_DROGR/22-142         AC B4J261.1
#=GS A0A4S3J6Q7_9EURO/33-140     AC A0A4S3J6Q7.1
#=GS A0A6P6MRD1_CARAU/24-138     AC A0A6P6MRD1.1
#=GS A0A341D0J5_NEOAA/21-141     AC A0A341D0J5.1
#=GS A0A672L8L5_SINGR/23-139     AC A0A672L8L5.1
#=GS A0A1V6R506_9EURO/32-154     AC A0A1V6R506.1
#=GS A0A5F8HIM1_MONDO/37-119     AC A0A5F8HIM1.1
#=GS A0A2Y9GQE8_NEOSC/23-143     AC A0A2Y9GQE8.1
#=GS UEVLD_HUMAN/21-141          AC Q8IX04.2
#=GS A0A2T7P4Y9_POMCA/282-402    AC A0A2T7P4Y9.1
#=GS A0A2U9BXZ4_SCOMX/721-841    AC A0A2U9BXZ4.1
#=GS A0A5A7PVY6_STRAF/31-152     AC A0A5A7PVY6.1
#=GS A0A452J4Y6_9SAUR/1-103      AC A0A452J4Y6.1
#=GS H1VZT0_COLHI/25-147         AC H1VZT0.1
#=GS ELCL_ARATH/37-158           AC Q9FFY6.1
#=GS STP22_YEAST/31-162          AC P25604.3
#=GS STP22_YEAST/31-162          DR PDB; 3R3Q A; 31-160;
#=GS STP22_YEAST/31-162          DR PDB; 1UZX A; 31-159;
#=GS STP22_YEAST/31-162          DR PDB; 3R42 A; 31-160;
#=GS A0A667Y6Y0_9TELE/24-145     AC A0A667Y6Y0.1
#=GS A0A0A1U025_ENTIV/21-137     AC A0A0A1U025.1
#=GS A0A446TKG3_TRITD/30-154     AC A0A446TKG3.1
#=GS A0A340WLB9_LIPVE/21-71      AC A0A340WLB9.1
#=GS A0A6J2URR9_CHACN/23-143     AC A0A6J2URR9.1
#=GS A0A673K1F1_9TELE/21-141     AC A0A673K1F1.1
#=GS A0A2R6Q1D6_ACTCC/45-166     AC A0A2R6Q1D6.1
#=GS W5KJZ4_ASTMX/22-142         AC W5KJZ4.2
#=GS A0A6J1CCJ0_MOMCH/41-162     AC A0A6J1CCJ0.1
#=GS A0A6A6LHB7_HEVBR/40-161     AC A0A6A6LHB7.1
#=GS A0A1B9IDS8_9TREE/24-146     AC A0A1B9IDS8.1
#=GS Q2GU83_CHAGB/66-167         AC Q2GU83.1
#=GS A0A6A3CB32_HIBSY/41-162     AC A0A6A3CB32.1
#=GS A0A3P8XMA1_ESOLU/24-145     AC A0A3P8XMA1.1
#=GS A0A1U7TFT0_CARSF/21-141     AC A0A1U7TFT0.1
#=GS A0A1V6SME7_9EURO/32-154     AC A0A1V6SME7.1
#=GS A0A6J0V4U6_9SAUR/21-141     AC A0A6J0V4U6.1
#=GS A2DH33_TRIVA/18-132         AC A2DH33.1
#=GS E5A4L5_LEPMJ/47-187         AC E5A4L5.1
#=GS A0A5F9DIH9_RABIT/21-141     AC A0A5F9DIH9.1
#=GS A0A367XTG1_9ASCO/27-167     AC A0A367XTG1.1
#=GS A0A437DB86_ORYJA/21-141     AC A0A437DB86.1
#=GS A0A267FES1_9PLAT/22-142     AC A0A267FES1.1
#=GS A0A1U7XAK5_NICSY/45-166     AC A0A1U7XAK5.1
#=GS A0A7M7P4F0_STRPU/1-47       AC A0A7M7P4F0.1
#=GS G3TM84_LOXAF/21-141         AC G3TM84.1
#=GS A0A0B2WGP8_METAS/25-147     AC A0A0B2WGP8.1
#=GS A7EY93_SCLS1/26-148         AC A7EY93.1
#=GS L9L6X8_TUPCH/8-60           AC L9L6X8.1
#=GS B6Q4B0_TALMQ/33-155         AC B6Q4B0.1
#=GS A0A6P3R6K1_PTEVA/21-141     AC A0A6P3R6K1.1
#=GS A0A261A3C7_9PELO/21-141     AC A0A261A3C7.1
#=GS S7Q4T7_MYOBR/21-141         AC S7Q4T7.1
#=GS Q4E3W0_TRYCC/124-207        AC Q4E3W0.1
#=GS A0A6J1U017_9SAUR/21-141     AC A0A6J1U017.1
#=GS A0A484H0T5_SOUCH/8-128      AC A0A484H0T5.1
#=GS A0A448Z6N1_9STRA/26-147     AC A0A448Z6N1.1
#=GS V7ADM1_PHAVU/32-153         AC V7ADM1.1
#=GS C1E1D0_MICCC/33-154         AC C1E1D0.1
#=GS A0A6P6MG51_CARAU/22-142     AC A0A6P6MG51.1
#=GS U3IFC7_ANAPP/21-141         AC U3IFC7.2
#=GS A0A6A3C7X3_HIBSY/41-162     AC A0A6A3C7X3.1
#=GS A0A2P5HFS1_9PEZI/25-147     AC A0A2P5HFS1.1
#=GS A0A4W2E7Z5_BOBOX/30-150     AC A0A4W2E7Z5.1
#=GS A0A667XIN9_9TELE/21-141     AC A0A667XIN9.1
#=GS A0A6J3EVA2_SAPAP/64-184     AC A0A6J3EVA2.1
#=GS A0A165H873_9APHY/25-147     AC A0A165H873.1
#=GS A0A316UMD3_9BASI/23-145     AC A0A316UMD3.1
#=GS A0A398AIZ6_BRACM/35-133     AC A0A398AIZ6.1
#=GS A0A0L9V7N8_PHAAN/32-153     AC A0A0L9V7N8.1
#=GS A0A673UKM1_SURSU/21-141     AC A0A673UKM1.1
#=GS T0KFK7_COLGC/25-147         AC T0KFK7.1
#=GS A0A2I0WL17_9ASPA/42-163     AC A0A2I0WL17.1
#=GS A0A6J0N748_RAPSA/36-156     AC A0A6J0N748.1
#=GS A0A423VFB7_9PEZI/11-133     AC A0A423VFB7.1
#=GS A0A238FB91_9BASI/5-138      AC A0A238FB91.1
#=GS A0A3P8RLR6_AMPPE/24-145     AC A0A3P8RLR6.1
#=GS A0A5N5NX01_9PEZI/25-147     AC A0A5N5NX01.1
#=GS C4LUR9_ENTHI/22-138         AC C4LUR9.1
#=GS A0A669CP61_ORENI/21-141     AC A0A669CP61.1
#=GS TS101_HUMAN/21-141          AC Q99816.2
#=GS TS101_HUMAN/21-141          DR PDB; 5VKG A; 21-141;
#=GS TS101_HUMAN/21-141          DR PDB; 6UD0 C; 21-141;
#=GS TS101_HUMAN/21-141          DR PDB; 3OBX A; 21-141;
#=GS TS101_HUMAN/21-141          DR PDB; 3OBS A; 21-141;
#=GS TS101_HUMAN/21-141          DR PDB; 3P9H A; 21-141;
#=GS TS101_HUMAN/21-141          DR PDB; 2F0R A; 21-141;
#=GS TS101_HUMAN/21-141          DR PDB; 4YC1 C; 21-141;
#=GS TS101_HUMAN/21-141          DR PDB; 4EJE B; 21-141;
#=GS TS101_HUMAN/21-141          DR PDB; 2F0R B; 21-141;
#=GS TS101_HUMAN/21-141          DR PDB; 3OBQ A; 21-141;
#=GS TS101_HUMAN/21-141          DR PDB; 3P9G A; 21-141;
#=GS TS101_HUMAN/21-141          DR PDB; 4YC1 A; 21-141;
#=GS TS101_HUMAN/21-141          DR PDB; 4ZNY A; 21-141;
#=GS TS101_HUMAN/21-141          DR PDB; 4EJE A; 21-141;
#=GS TS101_HUMAN/21-141          DR PDB; 4YC1 B; 21-141;
#=GS TS101_HUMAN/21-141          DR PDB; 3OBU A; 21-141;
#=GS TS101_HUMAN/21-141          DR PDB; 1M4Q A; 21-141;
#=GS TS101_HUMAN/21-141          DR PDB; 1M4P A; 21-141;
#=GS TS101_HUMAN/21-141          DR PDB; 1S1Q C; 21-141;
#=GS TS101_HUMAN/21-141          DR PDB; 1KPP A; 21-141;
#=GS TS101_HUMAN/21-141          DR PDB; 1KPQ A; 21-141;
#=GS TS101_HUMAN/21-141          DR PDB; 1S1Q A; 21-141;
#=GS A0A1S3IUX0_LINUN/85-134     AC A0A1S3IUX0.1
#=GS A0A6P3VE42_OCTDE/21-141     AC A0A6P3VE42.1
#=GS A0A674DCS2_SALTR/22-142     AC A0A674DCS2.1
#=GS TS101_MOUSE/21-141          AC Q61187.2
#=GS B3SBY4_TRIAD/7-127          AC B3SBY4.1
#=GS A0A498P051_LABRO/22-142     AC A0A498P051.1
#=GS A0A0S6XJ81_9FUNG/25-155     AC A0A0S6XJ81.1
#=GS A0A2J6TT29_9HELO/26-147     AC A0A2J6TT29.1
#=GS A0A1Q5THD9_9EURO/32-154     AC A0A1Q5THD9.1
#=GS A0A427YNZ7_9TREE/24-146     AC A0A427YNZ7.1
#=GS M2VY38_GALSU/26-142         AC M2VY38.1
#=GS A0A4Y9ZJ92_9AGAM/22-141     AC A0A4Y9ZJ92.1
#=GS G7K5V5_MEDTR/46-168         AC G7K5V5.1
#=GS M3YQQ7_MUSPF/21-141         AC M3YQQ7.1
#=GS A0A553Q2J2_9TELE/12-116     AC A0A553Q2J2.1
#=GS A0A3P8SPL2_AMPPE/21-141     AC A0A3P8SPL2.1
#=GS G1N6C7_MELGA/1-98           AC G1N6C7.1
#=GS A0A2Y9GQK6_NEOSC/21-141     AC A0A2Y9GQK6.1
#=GS A0A1S7I032_9SACH/34-154     AC A0A1S7I032.1
#=GS A0A0C4DS70_MAGP6/25-147     AC A0A0C4DS70.1
#=GS B4QNB3_DROSI/22-142         AC B4QNB3.1
#=GS A0A2A2LXZ4_9BILA/75-195     AC A0A2A2LXZ4.1
#=GS A0A1L9PE59_ASPVE/33-166     AC A0A1L9PE59.1
#=GS M3YQR2_MUSPF/21-141         AC M3YQR2.1
#=GS A0A2K6CCP5_MACNE/21-72      AC A0A2K6CCP5.1
#=GS E2AZS6_CAMFO/25-145         AC E2AZS6.1
#=GS A0A3Q3KWX3_9TELE/1-107      AC A0A3Q3KWX3.2
#=GS A0A3P4QIR0_GULGU/57-155     AC A0A3P4QIR0.1
#=GS A0A5G2QN35_PIG/15-65        AC A0A5G2QN35.1
#=GS A0A1U8D2S0_MESAU/1-111      AC A0A1U8D2S0.1
#=GS A0A337SS00_FELCA/21-82      AC A0A337SS00.1
#=GS A0A177BCY3_9BILA/16-137     AC A0A177BCY3.1
#=GS Q59WF8_CANAL/24-164         AC Q59WF8.1
#=GS A0A395NFC5_TRIAR/25-147     AC A0A395NFC5.1
#=GS A0A4U5UF21_COLLU/1-89       AC A0A4U5UF21.1
#=GS A0A3M2SZN2_9EURO/33-155     AC A0A3M2SZN2.1
#=GS A0A395H1R9_9EURO/33-155     AC A0A395H1R9.1
#=GS B0S5K1_DANRE/24-145         AC B0S5K1.1
#=GS A0A6P3F9J7_OCTDE/21-141     AC A0A6P3F9J7.1
#=GS G1K890_ANOCA/21-141         AC G1K890.1
#=GS A0A4U5LPA4_STECR/22-142     AC A0A4U5LPA4.1
#=GS A0A674CES3_SALTR/24-145     AC A0A674CES3.1
#=GS A0A2K5N2R1_CERAT/21-72      AC A0A2K5N2R1.1
#=GS A0A6J3K9G9_9HYME/25-145     AC A0A6J3K9G9.1
#=GS A0A671NPI0_9TELE/23-143     AC A0A671NPI0.1
#=GS A0A5A7PPY4_STRAF/31-152     AC A0A5A7PPY4.1
#=GS A0A179FER9_METCM/25-147     AC A0A179FER9.1
#=GS A0A341D344_NEOAA/21-141     AC A0A341D344.1
#=GS A0A2I2ZVW6_GORGO/36-119     AC A0A2I2ZVW6.1
#=GS A0A094ADE6_9PEZI/26-148     AC A0A094ADE6.1
#=GS A0A409YUE9_9AGAR/23-145     AC A0A409YUE9.1
#=GS A0A212DH87_CEREH/1-100      AC A0A212DH87.1
#=GS A0A498LHV6_LABRO/22-142     AC A0A498LHV6.1
#=GS A0A674DNQ9_SALTR/16-136     AC A0A674DNQ9.1
#=GS A0A182YD34_ANOST/22-142     AC A0A182YD34.1
#=GS M1V8C4_CYAM1/34-155         AC M1V8C4.1
#=GS A0A6G1GCG2_9PEZI/26-148     AC A0A6G1GCG2.1
#=GS A0A0N4V2M6_ENTVE/23-143     AC A0A0N4V2M6.1
#=GS A0A4T0FME6_9BASI/22-144     AC A0A4T0FME6.1
#=GS A0A402ET12_9SAUR/53-173     AC A0A402ET12.1
#=GS A0A1S3ZYW5_TOBAC/37-158     AC A0A1S3ZYW5.1
#=GS F7FD96_MONDO/21-141         AC F7FD96.1
#=GS A0A3P8VIN6_CYNSE/22-142     AC A0A3P8VIN6.1
#=GS A0A199URN0_ANACO/44-165     AC A0A199URN0.1
#=GS A0A0L0S4C7_ALLM3/26-146     AC A0A0L0S4C7.1
#=GS A0A2I0MHU1_COLLI/1-102      AC A0A2I0MHU1.1
#=GS A0A2K6NCC6_RHIRO/21-141     AC A0A2K6NCC6.1
#=GS B7GBA3_PHATC/26-147         AC B7GBA3.1
#=GS G1T6E8_RABIT/21-141         AC G1T6E8.1
#=GS W4GS44_9STRA/25-145         AC W4GS44.1
#=GS A0A384BRE4_URSMA/23-143     AC A0A384BRE4.1
#=GS A0A1Y3NEY8_PIRSE/7-110      AC A0A1Y3NEY8.1
#=GS A0A5F8HC36_MONDO/7-57       AC A0A5F8HC36.1
#=GS A0A3Q2H3U7_HORSE/30-150     AC A0A3Q2H3U7.1
#=GS A0A1S3LUR5_SALSA/24-145     AC A0A1S3LUR5.1
#=GS A0A388KLI9_CHABU/37-158     AC A0A388KLI9.1
#=GS A0A6J3EQ89_SAPAP/1-89       AC A0A6J3EQ89.1
#=GS A0A091HNH8_CALAN/8-127      AC A0A091HNH8.1
#=GS A0A2K5I641_COLAP/21-141     AC A0A2K5I641.1
#=GS A0A3L6STW3_PANMI/29-152     AC A0A3L6STW3.1
#=GS A0A384BRD1_URSMA/23-143     AC A0A384BRD1.1
#=GS A0A2J7RDC1_9NEOP/1-65       AC A0A2J7RDC1.1
#=GS A0A444V841_ACIRT/767-887    AC A0A444V841.1
#=GS B0WII4_CULQU/19-139         AC B0WII4.1
#=GS A0A4Q2DYR0_9AGAR/25-133     AC A0A4Q2DYR0.1
#=GS A0A139I0K9_9PEZI/25-147     AC A0A139I0K9.1
#=GS A0A671NTA0_9TELE/22-142     AC A0A671NTA0.1
#=GS A0A6P7IRZ8_9TELE/21-141     AC A0A6P7IRZ8.1
#=GS A0A6D2ISK8_9BRAS/40-161     AC A0A6D2ISK8.1
#=GS A0A2J6QBA9_9HELO/26-147     AC A0A2J6QBA9.1
#=GS A0A3Q4FY43_NEOBR/5-88       AC A0A3Q4FY43.1
#=GS A0A672NTS3_SINGR/15-135     AC A0A672NTS3.1
#=GS A0A3P8SM14_AMPPE/22-142     AC A0A3P8SM14.1
#=GS A0A427XZA1_9TREE/24-149     AC A0A427XZA1.1
#=GS A0A673JUS1_9TELE/22-71      AC A0A673JUS1.1
#=GS A0A4S2N1P8_9PEZI/31-153     AC A0A4S2N1P8.1
#=GS A0A3Q4FY40_NEOBR/5-88       AC A0A3Q4FY40.1
#=GS A0A087Y988_POEFO/1-92       AC A0A087Y988.2
#=GS W2T004_NECAM/74-197         AC W2T004.1
#=GS V6LQG5_9EUKA/20-137         AC V6LQG5.1
#=GS A0A087RK57_APTFO/8-128      AC A0A087RK57.1
#=GS N1Q0F5_DOTSN/25-147         AC N1Q0F5.1
#=GS E2C7Z4_HARSA/22-142         AC E2C7Z4.1
#=GS A0A3L8SX74_CHLGU/18-137     AC A0A3L8SX74.1
#=GS A0A2U3X1A1_ODORO/21-141     AC A0A2U3X1A1.1
#=GS A0A6P4ZZA0_BRABE/1-68       AC A0A6P4ZZA0.1
#=GS A0A6J0V7J4_9SAUR/21-141     AC A0A6J0V7J4.1
#=GS A0A453M766_AEGTS/30-154     AC A0A453M766.1
#=GS A0A3Q2ZFE9_KRYMA/1-107      AC A0A3Q2ZFE9.1
#=GS A0A671NPJ7_9TELE/15-135     AC A0A671NPJ7.1
#=GS A0A3P8WAQ8_CYNSE/1-99       AC A0A3P8WAQ8.1
#=GS A0A316Z9I1_9BASI/12-134     AC A0A316Z9I1.1
#=GS A0A665TWK9_ECHNA/21-141     AC A0A665TWK9.1
#=GS A0A671PDA8_9TELE/24-145     AC A0A671PDA8.1
#=GS A0A6P3IZ37_BISBI/21-141     AC A0A6P3IZ37.1
#=GS A0A2I2ZHD4_GORGO/21-141     AC A0A2I2ZHD4.1
#=GS A0A5E4NJJ6_9HEMI/22-142     AC A0A5E4NJJ6.1
#=GS Q16LW0_AEDAE/17-137         AC Q16LW0.1
#=GS C3YG01_BRAFL/23-143         AC C3YG01.1
#=GS A0A1X7UNL7_AMPQE/21-141     AC A0A1X7UNL7.1
#=GS A0A5G2QCG1_PIG/21-72        AC A0A5G2QCG1.1
#=GS A0A2B7XHZ6_9EURO/33-155     AC A0A2B7XHZ6.1
#=GS A0A0R3RAN0_9BILA/77-120     AC A0A0R3RAN0.1
#=GS A0A670I874_PODMU/21-141     AC A0A670I874.1
#=GS A0A2J6S2B7_9HELO/26-147     AC A0A2J6S2B7.1
#=GS A0A423WVY2_9PEZI/25-129     AC A0A423WVY2.1
#=GS A0A3B3HBA2_ORYLA/21-141     AC A0A3B3HBA2.1
#=GS A0A3P8XIA7_ESOLU/29-123     AC A0A3P8XIA7.1
#=GS A0A674P369_TAKRU/22-142     AC A0A674P369.1
#=GS A0A4V3SFP1_OPIFE/21-141     AC A0A4V3SFP1.1
#=GS A0A1E3IX62_9TREE/24-146     AC A0A1E3IX62.1
#=GS H0VKG6_CAVPO/21-141         AC H0VKG6.1
#=GS A0A4U5UID7_COLLU/22-142     AC A0A4U5UID7.1
#=GS A0A6J1BBB9_9ROSI/41-162     AC A0A6J1BBB9.1
#=GS A0A3B6LS51_WHEAT/43-165     AC A0A3B6LS51.1
#=GS H9FWP8_MACMU/21-141         AC H9FWP8.1
#=GS E7F4Y8_DANRE/23-143         AC E7F4Y8.1
#=GS A0A0G4J1Z8_PLABS/22-143     AC A0A0G4J1Z8.1
#=GS A0A6J3RVC2_TURTR/21-141     AC A0A6J3RVC2.1
#=GS A0A1Y1UER5_9TREE/24-145     AC A0A1Y1UER5.1
#=GS A0A6H5J9W5_9PHAE/38-157     AC A0A6H5J9W5.1
#=GS W2Y2R0_PHYPR/1-60           AC W2Y2R0.1
#=GS A0A7N4PAZ1_SARHA/21-141     AC A0A7N4PAZ1.1
#=GS A0A6H5G340_9HEMI/11-131     AC A0A6H5G340.1
#=GS A0A2I1FVT7_9GLOM/50-174     AC A0A2I1FVT7.1
#=GS G1MHS5_AILME/23-143         AC G1MHS5.2
#=GS A0A455C7X0_PHYMC/21-141     AC A0A455C7X0.1
#=GS A0A2F0B9T8_ESCRO/1-76       AC A0A2F0B9T8.1
#=GS A0A1B9IIT4_9TREE/55-177     AC A0A1B9IIT4.1
#=GS A0A1J4JSX3_9EUKA/23-137     AC A0A1J4JSX3.1
#=GS A0A6P4XUM5_BRABE/23-149     AC A0A6P4XUM5.1
#=GS A0A1S3LV07_SALSA/24-146     AC A0A1S3LV07.1
#=GS A0A1X6P7F6_PORUM/22-107     AC A0A1X6P7F6.1
#=GS A0A3Q3E6G1_9LABR/21-141     AC A0A3Q3E6G1.1
#=GS A0A087RK56_APTFO/8-127      AC A0A087RK56.1
#=GS A0A177TWN1_9BASI/25-147     AC A0A177TWN1.1
#=GS A0A6S7N1D0_LACSI/42-163     AC A0A6S7N1D0.1
#=GS A0A383ZII1_BALAS/21-141     AC A0A383ZII1.1
#=GS A0A5E4CDB5_MARMO/1-112      AC A0A5E4CDB5.1
#=GS A0A3Q1B1N2_AMPOC/21-141     AC A0A3Q1B1N2.1
#=GS A0A3Q4GI65_NEOBR/18-128     AC A0A3Q4GI65.1
#=GS A0A1X0RVA3_RHIZD/19-140     AC A0A1X0RVA3.1
#=GS G7NDS4_MACMU/21-141         AC G7NDS4.1
#=GS A0A1I9LRG2_ARATH/37-158     AC A0A1I9LRG2.1
#=GS L1JUG5_GUITC/33-150         AC L1JUG5.1
#=GS A0A1S2Z9G8_ERIEU/21-141     AC A0A1S2Z9G8.1
#=GS A0A067TNT8_GALM3/23-145     AC A0A067TNT8.1
#=GS A0A5F8GG56_MONDO/21-108     AC A0A5F8GG56.1
#=GS A0A1V9ZMC8_9STRA/25-145     AC A0A1V9ZMC8.1
#=GS A0A0D2CFD7_9EURO/26-148     AC A0A0D2CFD7.1
#=GS A0A6P5LR19_PHACI/21-141     AC A0A6P5LR19.1
#=GS A0A5C6P4S4_9TELE/24-145     AC A0A5C6P4S4.1
#=GS A0A2P5XMY8_GOSBA/41-162     AC A0A2P5XMY8.1
#=GS A0A2T7FEE0_9POAL/43-165     AC A0A2T7FEE0.1
#=GS A0A5A7Q058_STRAF/128-216    AC A0A5A7Q058.1
#=GS A0A6P8FGS4_CLUHA/22-142     AC A0A6P8FGS4.1
#=GS A0A084QT65_STAC4/65-167     AC A0A084QT65.1
#=GS A0A443HRD6_BYSSP/33-155     AC A0A443HRD6.1
#=GS A0A287S637_HORVV/38-160     AC A0A287S637.1
#=GS A0A5C3F0G1_9BASI/23-145     AC A0A5C3F0G1.1
#=GS A0A067FYR1_CITSI/33-153     AC A0A067FYR1.1
#=GS A0A0Q9XBR6_DROMO/22-142     AC A0A0Q9XBR6.1
#=GS H2NDX6_PONAB/22-142         AC H2NDX6.2
#=GS A0A384BRC0_URSMA/23-143     AC A0A384BRC0.1
#=GS A0A4Y7QIS3_9AGAM/23-145     AC A0A4Y7QIS3.1
#=GS A0A671XVF9_SPAAU/21-141     AC A0A671XVF9.1
#=GS A0A3B5R8N1_XIPMA/1-107      AC A0A3B5R8N1.1
#=GS M7B841_CHEMY/1-98           AC M7B841.1
#=GS A0A3Q2ZFH8_KRYMA/21-140     AC A0A3Q2ZFH8.1
#=GS M4E3T6_BRARP/41-162         AC M4E3T6.1
#=GS A0A319DES5_9EURO/33-155     AC A0A319DES5.1
#=GS A0A673K491_9TELE/17-137     AC A0A673K491.1
#=GS A0A060VWX4_ONCMY/21-100     AC A0A060VWX4.1
#=GS A0A6I9ICJ6_VICPA/21-141     AC A0A6I9ICJ6.1
#=GS A0A2K5I652_COLAP/21-141     AC A0A2K5I652.1
#=GS A0A6P8BAH4_MAGGR/25-147     AC A0A6P8BAH4.1
#=GS A0A1U7U0R2_CARSF/21-141     AC A0A1U7U0R2.1
#=GS A0A6J1HV36_CUCMA/40-161     AC A0A6J1HV36.1
#=GS A0A2K6SIU5_SAIBB/84-167     AC A0A2K6SIU5.1
#=GS A2E4C0_TRIVA/20-134         AC A2E4C0.1
#=GS A0A3P8VEA0_CYNSE/21-141     AC A0A3P8VEA0.1
#=GS A0A0D3C517_BRAOL/301-421    AC A0A0D3C517.1
#=GS A0A1E4TLI6_9ASCO/24-123     AC A0A1E4TLI6.1
#=GS A0A5F8GW33_MONDO/1-103      AC A0A5F8GW33.1
#=GS A0A2K2BRT6_POPTR/37-158     AC A0A2K2BRT6.1
#=GS A5DUM1_LODEL/35-173         AC A5DUM1.1
#=GS A0A1G4K4Y2_9SACH/27-145     AC A0A1G4K4Y2.1
#=GS A0A672FX98_SALFA/22-142     AC A0A672FX98.1
#=GS A0A1J1I6S8_9DIPT/16-136     AC A0A1J1I6S8.1
#=GS A0A671XT07_SPAAU/21-141     AC A0A671XT07.1
#=GS A0A401SKM0_CHIPU/1-89       AC A0A401SKM0.1
#=GS A0A6P3VK65_CLUHA/22-142     AC A0A6P3VK65.1
#=GS A0A2Y9NWW0_DELLE/21-141     AC A0A2Y9NWW0.1
#=GS A0A284QV58_ARMOS/30-152     AC A0A284QV58.1
#=GS A0A2K5ZAE6_MANLE/21-141     AC A0A2K5ZAE6.1
#=GS A0A341D0E4_NEOAA/21-141     AC A0A341D0E4.1
#=GS A0A672FXA3_SALFA/16-136     AC A0A672FXA3.1
#=GS Q01DC3_OSTTA/35-156         AC Q01DC3.1
#=GS A0A226MTD5_CALSU/21-140     AC A0A226MTD5.1
#=GS A0A059LEW1_9CHLO/29-150     AC A0A059LEW1.1
#=GS C1GFU8_PARBD/33-155         AC C1GFU8.2
#=GS A0A2K6G1U9_PROCO/21-141     AC A0A2K6G1U9.1
#=GS A0A0E9NCE9_SAICN/30-153     AC A0A0E9NCE9.1
#=GS A0A395MNH1_9HYPO/25-133     AC A0A395MNH1.1
#=GS A0A0V0UYA1_9BILA/24-144     AC A0A0V0UYA1.1
#=GS A0A067Q1J4_9AGAM/23-145     AC A0A067Q1J4.1
#=GS C3Z6I7_BRAFL/1-115          AC C3Z6I7.1
#=GS A0A2P5FB43_TREOI/33-154     AC A0A2P5FB43.1
#=GS A0A087SG86_AUXPR/29-115     AC A0A087SG86.1
#=GS A0A4P9YTI9_9FUNG/1-62       AC A0A4P9YTI9.1
#=GS A0A6J1TZH3_9SAUR/21-141     AC A0A6J1TZH3.1
#=GS A0A2T9YH27_9FUNG/28-148     AC A0A2T9YH27.1
#=GS A0A2Y9JPA8_ENHLU/8-128      AC A0A2Y9JPA8.1
#=GS A0A2P5XHM5_GOSBA/41-175     AC A0A2P5XHM5.1
#=GS A0A4Q7JHB0_METCM/25-147     AC A0A4Q7JHB0.1
#=GS A0A2P4SWF3_BAMTH/23-105     AC A0A2P4SWF3.1
#=GS A0A2U4CDV0_TURTR/33-89      AC A0A2U4CDV0.2
#=GS A0A5N7D293_9EURO/33-155     AC A0A5N7D293.1
#=GS A0A6P3IR00_BISBI/21-141     AC A0A6P3IR00.1
#=GS G1PUF2_MYOLU/21-141         AC G1PUF2.1
#=GS L1LED9_THEEQ/15-130         AC L1LED9.1
#=GS A0A6J8CG12_MYTCO/21-141     AC A0A6J8CG12.1
#=GS A0A1E4T8B9_9ASCO/28-171     AC A0A1E4T8B9.1
#=GS A0A6G1PG64_9TELE/21-141     AC A0A6G1PG64.1
#=GS S9W0P4_9TRYP/16-110         AC S9W0P4.1
#=GS A0A0L0STZ3_ALLM3/26-146     AC A0A0L0STZ3.1
#=GS A2QU33_ASPNC/103-225        AC A2QU33.1
#=GS A0A4T0VJ95_9PEZI/25-147     AC A0A4T0VJ95.1
#=GS A0A0V1L5H3_9BILA/21-141     AC A0A0V1L5H3.1
#=GS A0A665TJD7_ECHNA/22-142     AC A0A665TJD7.1
#=GS H2Q397_PANTR/21-141         AC H2Q397.2
#=GS A0A3Q2DXR2_CYPVA/22-142     AC A0A3Q2DXR2.1
#=GS A0A061FSC1_THECC/38-105     AC A0A061FSC1.1
#=GS A0A3Q0GEN4_ALLSI/433-553    AC A0A3Q0GEN4.1
#=GS A0A395HP89_ASPHC/33-155     AC A0A395HP89.1
#=GS H3AN81_LATCH/21-141         AC H3AN81.2
#=GS E1BWW2_CHICK/21-141         AC E1BWW2.2
#=GS G7E1N4_MIXOS/26-148         AC G7E1N4.1
#=GS Q4DQS3_TRYCC/77-161         AC Q4DQS3.1
#=GS A3KN51_BOVIN/21-141         AC A3KN51.1
#=GS A0A5K4FBD2_SCHMA/21-141     AC A0A5K4FBD2.1
#=GS A0A0E0GFF5_ORYNI/45-174     AC A0A0E0GFF5.1
#=GS A0A397ZPV3_BRACM/36-156     AC A0A397ZPV3.1
#=GS A0A3P8Z4S6_ESOLU/22-142     AC A0A3P8Z4S6.2
#=GS A0A2H6KBB1_9APIC/33-148     AC A0A2H6KBB1.1
#=GS J4C7L2_THEOR/19-134         AC J4C7L2.1
#=GS A0A6P5RGC5_PRUAV/41-162     AC A0A6P5RGC5.1
#=GS A0A0D2EJ52_9EURO/26-148     AC A0A0D2EJ52.1
#=GS A0A5C3LB37_9AGAR/25-147     AC A0A5C3LB37.1
#=GS D8LU57_ECTSI/38-157         AC D8LU57.1
#=GS S8ESV9_FOMPI/25-147         AC S8ESV9.1
#=GS A0A6P7ICE0_9TELE/22-142     AC A0A6P7ICE0.1
#=GS G3R4B1_GORGO/21-141         AC G3R4B1.1
#=GS G1N6A3_MELGA/23-143         AC G1N6A3.1
#=GS A0A2Y9RPI4_TRIMA/21-141     AC A0A2Y9RPI4.1
#=GS A0A5K4F623_SCHMA/21-141     AC A0A5K4F623.1
#=GS A0A2K6RHQ6_RHIRO/21-72      AC A0A2K6RHQ6.1
#=GS A0A7I4B4C0_PHYPA/1-82       AC A0A7I4B4C0.1
#=GS A0A667XET7_9TELE/22-142     AC A0A667XET7.1
#=GS A0A4Y7KNR3_PAPSO/1-66       AC A0A4Y7KNR3.1
#=GS A0A0C9MY21_9FUNG/20-141     AC A0A0C9MY21.1
#=GS Q4D2W6_TRYCC/77-163         AC Q4D2W6.1
#=GS A0A3M2S348_9HYPO/25-147     AC A0A3M2S348.1
#=GS L8IBD2_9CETA/8-128          AC L8IBD2.1
#=GS A0A444G6W4_ENSVE/42-166     AC A0A444G6W4.1
#=GS A0A091I5X0_BUCRH/8-127      AC A0A091I5X0.1
#=GS C0NQ15_AJECG/13-129         AC C0NQ15.1
#=GS A0A091J073_EGRGA/8-127      AC A0A091J073.1
#=GS A0A1S4D6J9_TOBAC/49-168     AC A0A1S4D6J9.1
#=GS A0A672NMP4_SINGR/20-140     AC A0A672NMP4.1
#=GS A0A6J2AK90_ACIJB/21-141     AC A0A6J2AK90.1
#=GS A0A3M9XZ23_9PEZI/26-148     AC A0A3M9XZ23.1
#=GS A0A383ZIB9_BALAS/21-141     AC A0A383ZIB9.1
#=GS Q0TWM8_PHANO/43-150         AC Q0TWM8.2
#=GS A0A2K6F9E9_PROCO/36-110     AC A0A2K6F9E9.1
#=GS B8PPJ2_POSPM/14-111         AC B8PPJ2.1
#=GS A0A7H8QSM4_9EURO/93-215     AC A0A7H8QSM4.1
#=GS A0A0R3X527_HYDTA/1-47       AC A0A0R3X527.1
#=GS A0A2T4BWK2_TRILO/25-147     AC A0A2T4BWK2.1
#=GS A0A179IKQ3_CORDF/25-152     AC A0A179IKQ3.1
#=GS A0A1B8CZ87_9PEZI/26-148     AC A0A1B8CZ87.1
#=GS A0A6P5AUZ4_BOSIN/21-141     AC A0A6P5AUZ4.1
#=GS H0X077_OTOGA/21-142         AC H0X077.1
#=GS K2MVI3_TRYCR/77-161         AC K2MVI3.1
#=GS A0A5J5B3Z9_9ASTE/1-60       AC A0A5J5B3Z9.1
#=GS A0A1B0GS10_MOUSE/21-67      AC A0A1B0GS10.1
#=GS A0A671P511_9TELE/23-143     AC A0A671P511.1
#=GS A0A091IAG9_CALAN/8-128      AC A0A091IAG9.1
#=GS A0A6A3XCR7_9STRA/25-145     AC A0A6A3XCR7.1
#=GS A7ASA6_BABBO/32-147         AC A7ASA6.1
#=GS A0A671G295_RHIFE/21-141     AC A0A671G295.1
#=GS A0A4W5P1G7_9TELE/11-116     AC A0A4W5P1G7.1
#=GS A0A0D2AM59_9PEZI/26-148     AC A0A0D2AM59.1
#=GS A0A2H3IKL5_9EURO/33-155     AC A0A2H3IKL5.1
#=GS A0A5N4DN76_CAMDR/10-118     AC A0A5N4DN76.1
#=GS C3Y2Y1_BRAFL/39-168         AC C3Y2Y1.1
#=GS A0A553MSV3_9TELE/22-105     AC A0A553MSV3.1
#=GS A0A7N8XDC6_9TELE/19-94      AC A0A7N8XDC6.1
#=GS A0A367LDK8_9HYPO/25-147     AC A0A367LDK8.1
#=GS A0A4D8Z3F3_SALSN/102-186    AC A0A4D8Z3F3.1
#=GS A0A4Q9QDV0_9APHY/25-147     AC A0A4Q9QDV0.1
#=GS A0A6P8ICV1_ACTTE/20-140     AC A0A6P8ICV1.1
#=GS A0A238C065_9BILA/43-127     AC A0A238C065.1
#=GS A0A7E6E1U1_9CHIR/21-142     AC A0A7E6E1U1.1
#=GS A0A5E4FRY1_PRUDU/35-159     AC A0A5E4FRY1.1
#=GS A0A2K5SC59_CEBIM/21-80      AC A0A2K5SC59.1
#=GS A0A6J0XID9_ODOVR/40-160     AC A0A6J0XID9.1
#=GS A0A6P6MHL2_CARAU/23-143     AC A0A6P6MHL2.1
#=GS A0A5B0QDD0_PUCGR/25-147     AC A0A5B0QDD0.1
#=GS A0A5N5K874_PANHP/22-142     AC A0A5N5K874.1
#=GS A0A6J1X221_GALME/21-141     AC A0A6J1X221.1
#=GS J4UNC7_BEAB2/25-147         AC J4UNC7.1
#=GS A0A340XXC1_LIPVE/21-141     AC A0A340XXC1.1
#=GS A0A3P9AKQ0_ESOLU/21-141     AC A0A3P9AKQ0.1
#=GS A0A2I3RL65_PANTR/21-141     AC A0A2I3RL65.1
#=GS K9GN05_PEND2/32-146         AC K9GN05.1
#=GS A0A6P6JRN4_CARAU/24-138     AC A0A6P6JRN4.1
#=GS A0A2I3LUW8_PAPAN/21-141     AC A0A2I3LUW8.1
#=GS A0A2C5X196_9PEZI/25-147     AC A0A2C5X196.1
#=GS A0A6J0V0Y2_9SAUR/1-103      AC A0A6J0V0Y2.1
#=GS A0A2T3ZGM1_9HYPO/25-147     AC A0A2T3ZGM1.1
#=GS A0A4W4GVW4_ELEEL/23-143     AC A0A4W4GVW4.1
#=GS F8QGZ2_SERL3/24-146         AC F8QGZ2.1
#=GS G0RMK5_HYPJQ/25-147         AC G0RMK5.1
#=GS A0A2G2ZXL5_CAPAN/50-170     AC A0A2G2ZXL5.1
#=GS G8JN65_ERECY/32-146         AC G8JN65.1
#=GS A0A6P4IZF5_DROKI/22-142     AC A0A6P4IZF5.1
#=GS Q5BAA9_EMENI/33-155         AC Q5BAA9.1
#=GS A0A6P5TTQ0_PRUAV/41-162     AC A0A6P5TTQ0.1
#=GS A0A2J7RDC7_9NEOP/22-142     AC A0A2J7RDC7.1
#=GS A0A428UP37_9HYPO/25-147     AC A0A428UP37.1
#=GS A0A2I4AZX3_9TELE/21-141     AC A0A2I4AZX3.1
#=GS A0A484FVW5_COLOR/25-147     AC A0A484FVW5.1
#=GS A0A6P6V5X4_COFAR/38-159     AC A0A6P6V5X4.1
#=GS A0A565B6L9_9BRAS/37-158     AC A0A565B6L9.1
#=GS I4YCG2_WALMC/24-146         AC I4YCG2.1
#=GS A0A1B9GH95_9TREE/24-146     AC A0A1B9GH95.1
#=GS A0A150US14_9PEZI/25-147     AC A0A150US14.1
#=GS A0A2K6NCD4_RHIRO/21-141     AC A0A2K6NCD4.1
#=GS Q9VVA7_DROME/22-142         AC Q9VVA7.2
#=GS I3MD91_ICTTR/21-141         AC I3MD91.1
#=GS A0A4U0UHF5_9PEZI/25-147     AC A0A4U0UHF5.1
#=GS E3NW97_CAERE/21-139         AC E3NW97.1
#=GS A0A1X7V8G5_AMPQE/21-141     AC A0A1X7V8G5.1
#=GS A0A5N5HH10_9ROSA/41-162     AC A0A5N5HH10.1
#=GS K5W8A3_PHACS/26-148         AC K5W8A3.1
#=GS A0A2P6TDL5_CHLSO/1-82       AC A0A2P6TDL5.1
#=GS A0A139HML0_9PEZI/25-147     AC A0A139HML0.1
#=GS A0A6P3FCP9_OCTDE/36-119     AC A0A6P3FCP9.1
#=GS A0A162A4H5_DAUCS/33-152     AC A0A162A4H5.1
#=GS A0A4W3I7Z8_CALMI/16-136     AC A0A4W3I7Z8.1
#=GS D8LU50_ECTSI/78-153         AC D8LU50.1
#=GS A0A060X9R1_ONCMY/22-142     AC A0A060X9R1.1
#=GS A0A453LLB6_AEGTS/42-125     AC A0A453LLB6.1
#=GS A0A5E4FZY8_PRUDU/26-148     AC A0A5E4FZY8.1
#=GS A0A2K6KQG1_RHIBE/21-141     AC A0A2K6KQG1.1
#=GS A0A6J3D6F2_AYTFU/21-141     AC A0A6J3D6F2.1
#=GS A0A2I4AI81_9TELE/24-145     AC A0A2I4AI81.1
#=GS A0A4W5QK37_9TELE/24-145     AC A0A4W5QK37.1
#=GS A0A485NY25_LYNPA/425-545    AC A0A485NY25.1
#=GS A0A2K5ZAF1_MANLE/12-132     AC A0A2K5ZAF1.1
#=GS G3PBK8_GASAC/22-142         AC G3PBK8.1
#=GS A0A1B7NI79_9AGAM/24-146     AC A0A1B7NI79.1
#=GS A0A5S6LAN6_XENTR/20-140     AC A0A5S6LAN6.3
#=GS A0A091MEB0_CARIC/8-128      AC A0A091MEB0.1
#=GS A0A672N7H8_SINGR/21-141     AC A0A672N7H8.1
#=GS A0A135UGD5_9PEZI/111-233    AC A0A135UGD5.1
#=GS A0A1C1CHL3_9EURO/26-148     AC A0A1C1CHL3.1
#=GS A0A093JID8_FULGA/11-131     AC A0A093JID8.1
#=GS G4T661_SERID/2-108          AC G4T661.1
#=GS A0A6J0A6M0_ACIJB/23-143     AC A0A6J0A6M0.1
#=GS A0A5D6XGX5_9STRA/25-94      AC A0A5D6XGX5.1
#=GS A0A1V9XHT4_9ACAR/23-143     AC A0A1V9XHT4.1
#=GS F2TZL4_SALR5/103-223        AC F2TZL4.1
#=GS A4RTQ7_OSTLU/1-105          AC A4RTQ7.1
#=GS A0A665TRX3_ECHNA/36-156     AC A0A665TRX3.1
#=GS A0A6P5XHX6_DURZI/33-152     AC A0A6P5XHX6.1
#=GS A0A6P6I7U6_PUMCO/36-119     AC A0A6P6I7U6.1
#=GS A0A4S8JJY1_MUSBA/38-162     AC A0A4S8JJY1.1
#=GS A0A2U9BWM8_SCOMX/8-90       AC A0A2U9BWM8.1
#=GS A0A066VQN8_TILAU/23-157     AC A0A066VQN8.1
#=GS A0A398A6D4_BRACM/41-162     AC A0A398A6D4.1
#=GS A0A2G5TZK5_9PELO/22-141     AC A0A2G5TZK5.1
#=GS A0A6J2AHB5_ACIJB/23-143     AC A0A6J2AHB5.1
#=GS L0P9M5_PNEJ8/342-419        AC L0P9M5.1
#=GS A0A341D0E8_NEOAA/21-141     AC A0A341D0E8.1
#=GS A0A369GPE4_9HYPO/25-147     AC A0A369GPE4.1
#=GS A0A3P8SND4_AMPPE/22-142     AC A0A3P8SND4.1
#=GS J4HSU4_9APHY/84-230         AC J4HSU4.1
#=GS A0A2R8ZX86_PANPA/21-71      AC A0A2R8ZX86.1
#=GS A0A0B1PJH4_9BILA/77-160     AC A0A0B1PJH4.1
#=GS A0A371DWE6_9APHY/25-147     AC A0A371DWE6.1
#=GS A0A087U7Z6_STEMI/24-144     AC A0A087U7Z6.1
#=GS A0A2Z7BL35_9LAMI/31-154     AC A0A2Z7BL35.1
#=GS A0A2U9BHV8_SCOMX/24-145     AC A0A2U9BHV8.1
#=GS A0A6J0CL46_PERMB/21-125     AC A0A6J0CL46.1
#=GS A0A670XVN1_PSETE/21-141     AC A0A670XVN1.1
#=GS A0A314YQX8_PRUYE/25-147     AC A0A314YQX8.1
#=GS A0A2I3S8V2_PANTR/21-71      AC A0A2I3S8V2.1
#=GS A0A7I4CVH8_PHYPA/1-82       AC A0A7I4CVH8.1
#=GS A0A2K5X8L3_MACFA/96-202     AC A0A2K5X8L3.2
#=GS C7ZA33_FUSV7/25-147         AC C7ZA33.1
#=GS A0A0N5D2Y7_THECL/25-152     AC A0A0N5D2Y7.1
#=GS A0A319AQD7_9EURO/33-155     AC A0A319AQD7.1
#=GS A0A3Q2ZEZ2_KRYMA/21-141     AC A0A3Q2ZEZ2.1
#=GS A0A6A5C8K3_NAEFO/30-140     AC A0A6A5C8K3.1
#=GS A0A162J3U9_METRR/25-147     AC A0A162J3U9.1
#=GS A0A2R5G7T7_9STRA/43-164     AC A0A2R5G7T7.1
#=GS A0A668S151_OREAU/21-141     AC A0A668S151.1
#=GS A0A6A4LYX3_9ERIC/52-173     AC A0A6A4LYX3.1
#=GS Q4R5D6_MACFA/1-47           AC Q4R5D6.1
#=GS A0A4U8UYC2_STECR/22-143     AC A0A4U8UYC2.1
#=GS A0A507BZJ3_9FUNG/21-143     AC A0A507BZJ3.1
#=GS A0A093PRF1_9PASS/8-128      AC A0A093PRF1.1
#=GS A0A197JWK1_9FUNG/24-146     AC A0A197JWK1.1
#=GS A0A5C7I469_9ROSI/34-155     AC A0A5C7I469.1
#=GS A0A4W5NV73_9TELE/21-141     AC A0A4W5NV73.1
#=GS A0A5N4DMR6_CAMDR/21-141     AC A0A5N4DMR6.1
#=GS M4AL45_XIPMA/22-142         AC M4AL45.1
#=GS A0A3N0YL56_ANAGA/182-302    AC A0A3N0YL56.1
#=GS A0A0D3AQZ7_BRAOL/50-168     AC A0A0D3AQZ7.1
#=GS A0A1B9GB34_9TREE/24-146     AC A0A1B9GB34.1
#=GS B0W7H1_CULQU/574-689        AC B0W7H1.1
#=GS A1D5Y8_NEOFI/48-170         AC A1D5Y8.1
#=GS M1AFF3_SOLTU/35-156         AC M1AFF3.1
#=GS A0A1E1K288_9HELO/26-148     AC A0A1E1K288.1
#=GS A0A671P2I1_9TELE/9-129      AC A0A671P2I1.1
#=GS M9LZ44_PSEA3/23-145         AC M9LZ44.1
#=GS A0A2Y9NZS9_DELLE/21-141     AC A0A2Y9NZS9.1
#=GS A0A0J8TQ17_COCIT/33-155     AC A0A0J8TQ17.1
#=GS A0A176VPH9_MARPO/109-230    AC A0A176VPH9.1
#=GS A0A6J8CGI8_MYTCO/21-141     AC A0A6J8CGI8.1
#=GS A0A068RWY6_9FUNG/20-142     AC A0A068RWY6.1
#=GS H2TJW7_TAKRU/21-141         AC H2TJW7.2
#=GS W7TRL2_9STRA/52-173         AC W7TRL2.1
#=GS A0A166I076_9AGAM/23-145     AC A0A166I076.1
#=GS A0A2K5DC63_AOTNA/21-141     AC A0A2K5DC63.1
#=GS A0A3Q7RDN3_VULVU/21-141     AC A0A3Q7RDN3.1
#=GS A0A2I2YJL4_GORGO/21-141     AC A0A2I2YJL4.1
#=GS E2RGP6_CANLF/21-141         AC E2RGP6.2
#=GS A0A251T572_HELAN/38-159     AC A0A251T572.1
#=GS A0A3Q7WSJ5_URSAR/21-141     AC A0A3Q7WSJ5.1
#=GS M0SP04_MUSAM/33-153         AC M0SP04.1
#=GS A0A2N3N4V9_9PEZI/25-147     AC A0A2N3N4V9.1
#=GS A0A0P7XFV9_SCLFO/28-106     AC A0A0P7XFV9.1
#=GS A0A7N4PBP0_SARHA/7-57       AC A0A7N4PBP0.1
#=GS A0A3M6U440_POCDA/20-140     AC A0A3M6U440.1
#=GS X0CKV6_FUSOX/1-58           AC X0CKV6.1
#=GS A0A3Q0E563_CARSF/21-72      AC A0A3Q0E563.1
#=GS A0A2Y9S3W1_PHYMC/51-171     AC A0A2Y9S3W1.1
#=GS A0A1D5RJI3_MACMU/21-139     AC A0A1D5RJI3.1
#=GS A0A2I3N4L1_PAPAN/21-141     AC A0A2I3N4L1.1
#=GS H0ZF42_TAEGU/21-141         AC H0ZF42.2
#=GS A0A0G0A2J2_TRIHA/25-147     AC A0A0G0A2J2.1
#=GS W2QVL7_PHYPN/25-145         AC W2QVL7.1
#=GS A0A1V1SWB9_9FUNG/25-147     AC A0A1V1SWB9.1
#=GS A0A1Z5KDP9_FISSO/67-177     AC A0A1Z5KDP9.1
#=GS F1SFX1_PIG/1-103            AC F1SFX1.4
#=GS A0A1Y2DJL9_9BASI/362-485    AC A0A1Y2DJL9.1
#=GS A0A0C3G5C5_PILCF/1-49       AC A0A0C3G5C5.1
#=GS A0A5E4FHK7_PRUDU/41-162     AC A0A5E4FHK7.1
#=GS A0A1X6N9U5_9APHY/24-146     AC A0A1X6N9U5.1
#=GS A0A4X2JQS6_VOMUR/21-141     AC A0A4X2JQS6.1
#=GS A0A3E2H1P2_SCYLI/26-148     AC A0A3E2H1P2.1
#=GS A0A0D2EU69_9EURO/1-49       AC A0A0D2EU69.1
#=GS A0A5N5NP41_9ROSI/33-152     AC A0A5N5NP41.1
#=GS G0PF60_CAEBE/21-139         AC G0PF60.1
#=GS A0A034WB09_BACDO/23-143     AC A0A034WB09.1
#=GS L8X6T4_THACA/23-144         AC L8X6T4.1
#=GS A0A087H3T3_ARAAL/36-160     AC A0A087H3T3.1
#=GS A0A2K5JZY9_COLAP/29-136     AC A0A2K5JZY9.1
#=GS A0A671XU73_SPAAU/22-129     AC A0A671XU73.1
#=GS A0A2I3LP92_PAPAN/36-119     AC A0A2I3LP92.1
#=GS A0A673UW36_SURSU/23-143     AC A0A673UW36.1
#=GS A0A369HFN0_9HYPO/77-199     AC A0A369HFN0.1
#=GS C3ZUX6_BRAFL/1-68           AC C3ZUX6.1
#=GS A0A0W0F9I7_9AGAR/23-147     AC A0A0W0F9I7.1
#=GS A0A3Q7I4F2_SOLLC/50-170     AC A0A3Q7I4F2.1
#=GS A0A455C7R0_PHYMC/21-141     AC A0A455C7R0.1
#=GS L8G861_PSED2/26-148         AC L8G861.1
#=GS Q4CX77_TRYCC/126-209        AC Q4CX77.1
#=GS A0A3Q7R1J1_CALUR/1-80       AC A0A3Q7R1J1.1
#=GS A0A1B0GSG9_MOUSE/21-72      AC A0A1B0GSG9.1
#=GS G5AKA0_HETGA/98-218         AC G5AKA0.1
#=GS A0A3Q3CQR3_HAPBU/21-141     AC A0A3Q3CQR3.1
#=GS A0A1B0GRX2_MOUSE/21-66      AC A0A1B0GRX2.1
#=GS A0A1B8DYZ7_9PEZI/26-148     AC A0A1B8DYZ7.1
#=GS A0A504Z0G9_FASGI/21-141     AC A0A504Z0G9.1
#=GS A0A067N2Y4_9AGAM/26-148     AC A0A067N2Y4.1
#=GS A0A3M6VRU5_9STRA/25-145     AC A0A3M6VRU5.1
#=GS A0A6G1PG54_9TELE/21-140     AC A0A6G1PG54.1
#=GS A0A1Y3AZK3_EURMA/1-110      AC A0A1Y3AZK3.1
#=GS A0A3B5K6Y7_TAKRU/22-142     AC A0A3B5K6Y7.2
#=GS A0A3N0Z0J7_ANAGA/32-118     AC A0A3N0Z0J7.1
#=GS A0A517LK17_9PEZI/23-145     AC A0A517LK17.1
#=GS E3RWI8_PYRTT/27-149         AC E3RWI8.1
#=GS A0A6I9R278_ELAGV/44-165     AC A0A6I9R278.1
#=GS B3SC29_TRIAD/2-102          AC B3SC29.1
#=GS A0A6H5IUN0_9HYME/22-142     AC A0A6H5IUN0.1
#=GS A0A452RXV7_URSAM/21-130     AC A0A452RXV7.1
#=GS A0A2P5DXY7_PARAD/44-165     AC A0A2P5DXY7.1
#=GS W5LAZ6_ASTMX/1-103          AC W5LAZ6.2
#=GS V4SXQ5_CITCL/41-162         AC V4SXQ5.1
#=GS A0A4D9AYY2_SALSN/31-152     AC A0A4D9AYY2.1
#=GS A0A2G9GRM0_9LAMI/1-82       AC A0A2G9GRM0.1
#=GS A0A0L0F1C0_9EUKA/7-107      AC A0A0L0F1C0.1
#=GS A0A6P5LY38_PHACI/37-119     AC A0A6P5LY38.1
#=GS A0A1S4MY01_PEDHC/1-65       AC A0A1S4MY01.1
#=GS A0A430QFW1_SCHBO/21-141     AC A0A430QFW1.1
#=GS A0A3P9NMU5_POERE/24-145     AC A0A3P9NMU5.1
#=GS A0A194QCS8_PAPXU/21-141     AC A0A194QCS8.1
#=GS A0A1E3NP18_9ASCO/71-158     AC A0A1E3NP18.1
#=GS A0A668S548_OREAU/21-141     AC A0A668S548.1
#=GS A0A2K6G1X8_PROCO/15-135     AC A0A2K6G1X8.1
#=GS A0A3N6SW68_BRACR/40-161     AC A0A3N6SW68.1
#=GS M3J1B0_CANMX/28-168         AC M3J1B0.1
#=GS A0A178ARL9_9PLEO/26-148     AC A0A178ARL9.1
#=GS D7LCC3_ARALL/36-157         AC D7LCC3.1
#=GS A0A314UVC3_PRUYE/182-284    AC A0A314UVC3.1
#=GS A0A2K6SIX8_SAIBB/69-189     AC A0A2K6SIX8.1
#=GS A0A1U8B0X3_NELNU/33-152     AC A0A1U8B0X3.1
#=GS Q75EU1_ASHGO/32-146         AC Q75EU1.1
#=GS A0A1V8TF13_9PEZI/25-147     AC A0A1V8TF13.1
#=GS A0A4U0VV18_9PEZI/22-154     AC A0A4U0VV18.1
#=GS A0A6P9BNL7_PANGU/21-141     AC A0A6P9BNL7.1
#=GS A0A319BXE7_9EURO/33-155     AC A0A319BXE7.1
#=GS A0A439DJA6_9PEZI/25-147     AC A0A439DJA6.1
#=GS L5KXS6_PTEAL/21-141         AC L5KXS6.1
#=GS A0A314XSE4_PRUYE/41-162     AC A0A314XSE4.1
#=GS L5LFK1_MYODS/279-399        AC L5LFK1.1
#=GS A0A3Q1CMN4_AMPOC/22-142     AC A0A3Q1CMN4.1
#=GS A0A5C6P8T7_9TELE/22-142     AC A0A5C6P8T7.1
#=GS A0A5D2TAW2_GOSMU/41-162     AC A0A5D2TAW2.1
#=GS A0A109FL35_9BASI/420-543    AC A0A109FL35.1
#=GS A0A420I4C5_9PEZI/26-148     AC A0A420I4C5.1
#=GS A0A5N6SMM8_ASPPS/33-155     AC A0A5N6SMM8.1
#=GS A0A5C3R1Q2_9AGAR/23-145     AC A0A5C3R1Q2.1
#=GS M5WZN4_PRUPE/41-162         AC M5WZN4.1
#=GS A0A2G3BFL9_CAPCH/35-156     AC A0A2G3BFL9.1
#=GS A0A093XJ48_9PEZI/26-148     AC A0A093XJ48.1
#=GS A0A1S3TJH0_VIGRR/32-153     AC A0A1S3TJH0.1
#=GS A0A7D8Z7B5_9TREE/24-144     AC A0A7D8Z7B5.1
#=GS A0A6I8NW91_ORNAN/37-119     AC A0A6I8NW91.1
#=GS A0A6P4CJS0_ARADU/40-161     AC A0A6P4CJS0.1
#=GS A0A2I3M224_PAPAN/21-141     AC A0A2I3M224.1
#=GS A0A6J3EW37_SAPAP/1-112      AC A0A6J3EW37.1
#=GS A0A6P7MTS1_BETSP/21-140     AC A0A6P7MTS1.1
#=GS F7B384_CALJA/69-189         AC F7B384.2
#=GS A0A6J1Q771_9HYME/25-145     AC A0A6J1Q771.1
#=GS A0A671MEJ8_9TELE/23-143     AC A0A671MEJ8.1
#=GS V9DWJ9_PHYPR/1-60           AC V9DWJ9.1
#=GS A0A671NKT5_9TELE/3-109      AC A0A671NKT5.1
#=GS A0A1C7N186_9FUNG/20-141     AC A0A1C7N186.1
#=GS G8C1L6_TETPH/33-154         AC G8C1L6.1
#=GS A0A6I9RCW0_ELAGV/44-165     AC A0A6I9RCW0.1
#=GS B7G481_PHATC/78-198         AC B7G481.1
#=GS A0A370TUG4_9HELO/26-148     AC A0A370TUG4.1
#=GS A0A5F4CPE5_CANLF/1-103      AC A0A5F4CPE5.1
#=GS A0A0Q3X7I5_AMAAE/37-119     AC A0A0Q3X7I5.1
#=GS R0HG26_9BRAS/36-157         AC R0HG26.1
#=GS V4AIK3_LOTGI/7-127          AC V4AIK3.1
#=GS A0A5C3NCA9_9AGAM/25-147     AC A0A5C3NCA9.1
#=GS J3P887_GAET3/25-147         AC J3P887.1
#=GS A0A0D9NUD5_METAN/25-147     AC A0A0D9NUD5.1
#=GS S9W3I9_9TRYP/37-146         AC S9W3I9.1
#=GS A0A673UXL1_SURSU/21-141     AC A0A673UXL1.1
#=GS A0A388K9V4_CHABU/34-161     AC A0A388K9V4.1
#=GS A0A1B8F7P2_9PEZI/26-148     AC A0A1B8F7P2.1
#=GS A0A0E0NND8_ORYRU/45-167     AC A0A0E0NND8.1
#=GS A0A4Z2JCL6_9TELE/1-107      AC A0A4Z2JCL6.1
#=GS A0A3P6TNI2_LITSI/25-145     AC A0A3P6TNI2.1
#=GS A0A1S3CTU5_DIACI/1-65       AC A0A1S3CTU5.1
#=GS A0A367KHP9_RHIST/20-141     AC A0A367KHP9.1
#=GS A0A668RJ71_OREAU/21-107     AC A0A668RJ71.1
#=GS M3WZG1_FELCA/21-141         AC M3WZG1.2
#=GS A0A6P6ALI7_DURZI/41-162     AC A0A6P6ALI7.1
#=GS W9IBC9_FUSOX/1-58           AC W9IBC9.1
#=GS F1M0M3_RAT/21-141           AC F1M0M3.2
#=GS A0A2R8ZYD1_PANPA/21-141     AC A0A2R8ZYD1.1
#=GS T1JPK6_STRMM/21-141         AC T1JPK6.1
#=GS J8Q7F3_SACAR/31-153         AC J8Q7F3.1
#=GS A0A6I9JSU0_CHRAS/21-141     AC A0A6I9JSU0.1
#=GS A0A401GJ98_9APHY/23-145     AC A0A401GJ98.1
#=GS A0A135LCB7_PENPA/32-154     AC A0A135LCB7.1
#=GS A0A6A4LUQ1_9ERIC/41-162     AC A0A6A4LUQ1.1
#=GS A0A445E2S5_ARAHY/40-161     AC A0A445E2S5.1
#=GS A0A3Q3KYF8_9TELE/22-142     AC A0A3Q3KYF8.1
#=GS A0A4D9EE60_9SAUR/21-141     AC A0A4D9EE60.1
#=GS A0A507R1C4_MONPU/33-155     AC A0A507R1C4.1
#=GS A0A4W4HKG1_ELEEL/22-142     AC A0A4W4HKG1.1
#=GS A0A6A5DKE6_SCHHA/159-279    AC A0A6A5DKE6.1
#=GS A0A0M8MZC6_9HYPO/25-147     AC A0A0M8MZC6.1
#=GS A0A671G5C5_RHIFE/36-119     AC A0A671G5C5.1
#=GS S8AML6_PENO1/32-154         AC S8AML6.1
#=GS A0A674PLV3_TAKRU/22-142     AC A0A674PLV3.1
#=GS K7TNF7_MAIZE/29-152         AC K7TNF7.1
#=GS A0A0P7AWF2_9HYPO/25-147     AC A0A0P7AWF2.1
#=GS A0A395ICU2_9HELO/26-148     AC A0A395ICU2.1
#=GS A0A4W4HKY0_ELEEL/21-141     AC A0A4W4HKY0.1
#=GS A0A3F3Q0Y0_9EURO/60-182     AC A0A3F3Q0Y0.1
#=GS A0A1L9SB90_9EURO/33-155     AC A0A1L9SB90.1
#=GS A0A672GKN3_SALFA/21-141     AC A0A672GKN3.1
#=GS A0A093NZS3_PYGAD/8-127      AC A0A093NZS3.1
#=GS A0A670I856_PODMU/21-141     AC A0A670I856.1
#=GS A0A443SU03_9ACAR/20-140     AC A0A443SU03.1
#=GS A0A553PC15_TIGCA/563-683    AC A0A553PC15.1
#=GS A0A5J5DAA9_9PERO/21-141     AC A0A5J5DAA9.1
#=GS A0A4W4HGE1_ELEEL/23-143     AC A0A4W4HGE1.1
#=GS A0A4W5NYU7_9TELE/21-141     AC A0A4W5NYU7.1
#=GS A0A0C3PZR7_9AGAM/23-145     AC A0A0C3PZR7.1
#=GS A0A314KZR7_NICAT/49-168     AC A0A314KZR7.1
#=GS A0A482XP14_LAOST/22-142     AC A0A482XP14.1
#=GS A0A1R2CS28_9CILI/16-131     AC A0A1R2CS28.1
#=GS A0A2S7Q3L8_9HELO/26-148     AC A0A2S7Q3L8.1
#=GS W6YT45_COCCA/30-152         AC W6YT45.1
#=GS A0A0F8WT44_9EURO/56-178     AC A0A0F8WT44.1
#=GS A0A337S451_FELCA/21-141     AC A0A337S451.1
#=GS A0A507AV23_9PEZI/53-175     AC A0A507AV23.1
#=GS A0A6D2KSH6_9BRAS/35-154     AC A0A6D2KSH6.1
#=GS A0A4P6XLL6_9ASCO/26-165     AC A0A4P6XLL6.1
#=GS A0A316YUE0_9BASI/23-145     AC A0A316YUE0.1
#=GS A0A7E6E139_9CHIR/21-142     AC A0A7E6E139.1
#=GS A0A6P6BRD7_PTEVA/21-141     AC A0A6P6BRD7.1
#=GS C5MCW1_CANTT/27-167         AC C5MCW1.1
#=GS A0A671P638_9TELE/15-135     AC A0A671P638.1
#=GS A0A162KU68_CORDF/25-147     AC A0A162KU68.1
#=GS Q382M1_TRYB2/23-157         AC Q382M1.1
#=GS A0A5N7AH89_9EURO/33-155     AC A0A5N7AH89.1
#=GS A0A2K6DNZ6_MACNE/21-141     AC A0A2K6DNZ6.1
#=GS B2WIB9_PYRTR/1-58           AC B2WIB9.1
#=GS A0A2C9VWV7_MANES/34-153     AC A0A2C9VWV7.1
#=GS A0A091N7L8_APAVI/8-128      AC A0A091N7L8.1
#=GS A0A671FWS3_RHIFE/423-543    AC A0A671FWS3.1
#=GS A0A452RY54_URSAM/21-75      AC A0A452RY54.1
#=GS G4MR87_MAGO7/25-147         AC G4MR87.1
#=GS A0A0F4G735_9PEZI/25-147     AC A0A0F4G735.1
#=GS A0A091GCI6_9AVES/7-126      AC A0A091GCI6.1
#=GS A0A445HZS0_GLYSO/34-155     AC A0A445HZS0.1
#=GS M8A2K0_TRIUA/44-166         AC M8A2K0.1
#=GS A0A4D8XQ37_9ALVE/1-47       AC A0A4D8XQ37.1
#=GS A0A1S2Z9H3_ERIEU/21-141     AC A0A1S2Z9H3.1
#=GS A0A0L6VLQ3_9BASI/18-140     AC A0A0L6VLQ3.1
#=GS A0A6P9BZA9_PANGU/21-141     AC A0A6P9BZA9.1
#=GS F4ITY4_ARATH/37-158         AC F4ITY4.1
#=GS B9SHU4_RICCO/43-164         AC B9SHU4.1
#=GS A0A010Q9E7_9PEZI/25-147     AC A0A010Q9E7.1
#=GS A0A7R5KD77_9PASS/34-154     AC A0A7R5KD77.1
#=GS T1IHN8_STRMM/22-142         AC T1IHN8.1
#=GS A0A673BPY5_9TELE/22-142     AC A0A673BPY5.1
#=GS T1KUB6_TETUR/21-141         AC T1KUB6.1
#=GS A0A2Y9NZT4_DELLE/21-141     AC A0A2Y9NZT4.1
#=GS A0A2V5I2R0_ASPV1/33-155     AC A0A2V5I2R0.1
#=GS A0A5C2SRS9_9APHY/25-147     AC A0A5C2SRS9.1
#=GS B8NEG4_ASPFN/23-145         AC B8NEG4.1
#=GS R7YQH1_CONA1/26-149         AC R7YQH1.1
#=GS A0A158QDU6_HYMDI/7-127      AC A0A158QDU6.1
#=GS A0A7E6E1S8_9CHIR/1-47       AC A0A7E6E1S8.1
#=GS A0A3Q7REA1_VULVU/15-135     AC A0A3Q7REA1.1
#=GS A0A383ZJ61_BALAS/36-119     AC A0A383ZJ61.1
#=GS A0A341D0E9_NEOAA/1-47       AC A0A341D0E9.1
#=GS A0A1E3PMM2_9ASCO/29-151     AC A0A1E3PMM2.1
#=GS A0A6S7P0Q5_LACSI/42-163     AC A0A6S7P0Q5.1
#=GS D8LXE4_BLAHO/37-142         AC D8LXE4.1
#=GS A0A2K6G1V5_PROCO/9-129      AC A0A2K6G1V5.1
#=GS A0A3M7QQD3_BRAPC/23-143     AC A0A3M7QQD3.1
#=GS A0A507E382_9FUNG/12-134     AC A0A507E382.1
#=GS A0A3Q3E5L4_9LABR/22-142     AC A0A3Q3E5L4.1
#=GS A0A074SSN3_9AGAM/23-145     AC A0A074SSN3.1
#=GS A0A1W0X549_HYPDU/212-332    AC A0A1W0X549.1
#=GS A0A066X430_COLSU/25-147     AC A0A066X430.1
#=GS A0A2K5N331_CERAT/21-99      AC A0A2K5N331.1
#=GS A0A6H5G3F7_9HEMI/16-136     AC A0A6H5G3F7.1
#=GS A0A6J0BYM8_NEOLC/25-145     AC A0A6J0BYM8.1
#=GS A0A091SVW5_PELCR/8-127      AC A0A091SVW5.1
#=GS A0A4W6EIN6_LATCA/21-141     AC A0A4W6EIN6.1
#=GS A0A1D2MK57_ORCCI/39-155     AC A0A1D2MK57.1
#=GS W1QEX8_OGAPD/26-152         AC W1QEX8.1
#=GS A0A2Y9P2L3_DELLE/1-47       AC A0A2Y9P2L3.1
#=GS A0A0G4GA20_VITBC/20-140     AC A0A0G4GA20.1
#=GS A0A425BNE8_9PEZI/2-102      AC A0A425BNE8.1
#=GS A8QBQ6_MALGO/1-58           AC A8QBQ6.1
#=GS A0A2Y9P2L8_DELLE/21-141     AC A0A2Y9P2L8.1
#=GS A0A2N1J6Z3_9BASI/500-608    AC A0A2N1J6Z3.1
#=GS A0A5D2UBQ6_GOSMU/1-100      AC A0A5D2UBQ6.1
#=GS I3KB16_ORENI/22-142         AC I3KB16.1
#=GS A0A6J2AFT3_ACIJB/23-143     AC A0A6J2AFT3.1
#=GS A0A4U6X9S2_9PEZI/28-150     AC A0A4U6X9S2.1
#=GS A0A2K5DC62_AOTNA/21-141     AC A0A2K5DC62.1
#=GS J3KGC1_COCIM/33-155         AC J3KGC1.2
#=GS A0A2I0KKN7_PUNGR/38-128     AC A0A2I0KKN7.1
#=GS F6GWC1_VITVI/49-170         AC F6GWC1.1
#=GS A0A2H9TP77_9FUNG/21-117     AC A0A2H9TP77.1
#=GS A0A5J4ZP56_9ASTE/45-166     AC A0A5J4ZP56.1
#=GS A0A074X2T5_9PEZI/26-149     AC A0A074X2T5.1
#=GS A0A1U7TM36_CARSF/21-141     AC A0A1U7TM36.1
#=GS A0A151GM05_9HYPO/44-158     AC A0A151GM05.1
#=GS A0A3Q3EKE1_KRYMA/22-142     AC A0A3Q3EKE1.1
#=GS A0A1A6GDP5_NEOLE/1-111      AC A0A1A6GDP5.1
#=GS A0A4U5UFC7_COLLU/21-141     AC A0A4U5UFC7.1
#=GS A0A3M7AYQ4_HORWE/25-156     AC A0A3M7AYQ4.1
#=GS A0A158NHR1_ATTCE/1-65       AC A0A158NHR1.1
#=GS A0A1B8CK43_9PEZI/26-148     AC A0A1B8CK43.1
#=GS A0A4W6EHM1_LATCA/22-142     AC A0A4W6EHM1.1
#=GS A0A5D2YSM4_GOSMU/1-100      AC A0A5D2YSM4.1
#=GS A0A540NGY0_MALBA/41-162     AC A0A540NGY0.1
#=GS A0A6P5LVB5_PHACI/21-141     AC A0A6P5LVB5.1
#=GS F7GPU5_MACMU/17-137         AC F7GPU5.3
#=GS A0A7N4PEU5_SARHA/36-119     AC A0A7N4PEU5.1
#=GS H3D1E5_TETNG/22-142         AC H3D1E5.1
#=GS A0A136JD18_9PEZI/25-147     AC A0A136JD18.1
#=GS A0A6J0NRF6_RAPSA/37-158     AC A0A6J0NRF6.1
#=GS A0A3P9CW58_9CICH/24-145     AC A0A3P9CW58.1
#=GS A0A498KI83_MALDO/41-162     AC A0A498KI83.1
#=GS A0A6P5LY32_PHACI/21-141     AC A0A6P5LY32.1
#=GS A0A2K5N2L3_CERAT/21-82      AC A0A2K5N2L3.1
#=GS A0A4W4GWJ1_ELEEL/22-142     AC A0A4W4GWJ1.1
#=GS A0A1J9Q486_9EURO/33-155     AC A0A1J9Q486.1
#=GS U3K9H6_FICAL/21-141         AC U3K9H6.1
#=GS D7M5X3_ARALL/37-158         AC D7M5X3.1
#=GS A0A315VMU5_GAMAF/7-127      AC A0A315VMU5.1
#=GS A0A3P9CM11_9CICH/21-141     AC A0A3P9CM11.1
#=GS A0A6P9BZ64_PANGU/21-141     AC A0A6P9BZ64.1
#=GS A0A4W5JNC9_9TELE/22-142     AC A0A4W5JNC9.1
#=GS M0ZS40_SOLTU/45-166         AC M0ZS40.1
#=GS A0A4D9AE51_SALSN/31-152     AC A0A4D9AE51.1
#=GS A0A6P7KYA1_BETSP/39-123     AC A0A6P7KYA1.1
#=GS TS101_RAT/21-141            AC Q6IRE4.1
#=GS B2ADK8_PODAN/131-253        AC B2ADK8.1
#=GS A0A663EXE6_AQUCH/1-102      AC A0A663EXE6.1
#=GS A0A6P6PSB4_CARAU/23-143     AC A0A6P6PSB4.1
#=GS A0A409WHT5_PSICY/23-145     AC A0A409WHT5.1
#=GS C5GPU6_AJEDR/33-155         AC C5GPU6.1
#=GS A0A673MT51_9TELE/23-143     AC A0A673MT51.1
#=GS A0A482VX77_9CUCU/22-142     AC A0A482VX77.1
#=GS A0A1R3I744_COCAP/1-100      AC A0A1R3I744.1
#=GS A0A565B0X4_9BRAS/216-333    AC A0A565B0X4.1
#=GS A0A4U1ESZ5_MONMO/75-195     AC A0A4U1ESZ5.1
#=GS A0A6J2UAG7_DROLE/22-142     AC A0A6J2UAG7.1
#=GS A0A1W4WAE1_AGRPL/22-147     AC A0A1W4WAE1.1
#=GS A0A167L2A2_CALVF/29-151     AC A0A167L2A2.1
#=GS D3AYD3_POLPP/26-141         AC D3AYD3.1
#=GS A0A5F9CZS6_RABIT/36-119     AC A0A5F9CZS6.1
#=GS A0A5N5NFQ6_PANHP/22-142     AC A0A5N5NFQ6.1
#=GS A0A0D3CKV6_BRAOL/27-149     AC A0A0D3CKV6.1
#=GS A0A0D1E2K5_USTMA/23-145     AC A0A0D1E2K5.1
#=GS A0A158QVZ7_9CEST/21-151     AC A0A158QVZ7.1
#=GS E9DXX0_METAQ/25-147         AC E9DXX0.1
#=GS A0A337S9E2_FELCA/36-119     AC A0A337S9E2.1
#=GS C1MJQ9_MICPC/95-212         AC C1MJQ9.1
#=GS UEVLD_XENTR/21-141          AC Q66KB7.1
#=GS W9RB65_9ROSA/41-162         AC W9RB65.1
#=GS A0A6J3EQA0_SAPAP/23-143     AC A0A6J3EQA0.1
#=GS F6HBJ5_VITVI/33-152         AC F6HBJ5.1
#=GS J9HP95_9SPIT/24-148         AC J9HP95.1
#=GS A0A3Q1JD75_ANATE/22-142     AC A0A3Q1JD75.1
#=GS A9V9P6_MONBE/32-155         AC A9V9P6.1
#=GS A0A232M0U6_9EURO/358-492    AC A0A232M0U6.1
#=GS A0A165ED35_9BASI/29-151     AC A0A165ED35.1
#=GS A0A402ET08_9SAUR/21-141     AC A0A402ET08.1
#=GS A0A063BTQ2_USTVR/131-253    AC A0A063BTQ2.1
#=GS A0A672FXA8_SALFA/14-134     AC A0A672FXA8.1
#=GS A0A0A2VMB1_BEABA/58-165     AC A0A0A2VMB1.1
#=GS A0A6P7XNP0_9AMPH/33-153     AC A0A6P7XNP0.1
#=GS A0A158R0M8_NIPBR/22-142     AC A0A158R0M8.1
#=GS A0A397THS2_9GLOM/7-117      AC A0A397THS2.1
#=GS A0A4Y7TPN6_9AGAR/68-190     AC A0A4Y7TPN6.1
#=GS A0A2K2BDE4_POPTR/33-152     AC A0A2K2BDE4.1
#=GS A0A1I9LRG3_ARATH/37-158     AC A0A1I9LRG3.1
#=GS U5D5G4_AMBTC/40-161         AC U5D5G4.1
#=GS A0A2T6ZG83_TUBBO/28-150     AC A0A2T6ZG83.1
#=GS A0A1J7HQX1_LUPAN/40-161     AC A0A1J7HQX1.1
#=GS A0A3Q0GHP9_ALLSI/1-47       AC A0A3Q0GHP9.1
#=GS A0A668RVT9_OREAU/22-142     AC A0A668RVT9.1
#=GS A0A3Q3XJM0_MOLML/21-93      AC A0A3Q3XJM0.1
#=GS A0A7N5P8L8_AILME/21-93      AC A0A7N5P8L8.1
#=GS E9D5G8_COCPS/33-155         AC E9D5G8.1
#=GS A0A0C9VYM4_SPHS4/25-147     AC A0A0C9VYM4.1
#=GS A0A2T0FHK6_9ASCO/25-140     AC A0A2T0FHK6.1
#=GS Q24HU3_TETTS/37-161         AC Q24HU3.1
#=GS H2XP92_CIOIN/24-144         AC H2XP92.1
#=GS A0A2Y9ELP8_PHYMC/21-141     AC A0A2Y9ELP8.1
#=GS A0A5N5QXX5_9AGAM/23-145     AC A0A5N5QXX5.1
#=GS A0A4Q4UP89_9PEZI/25-147     AC A0A4Q4UP89.1
#=GS A0A4Z1NQI9_9PEZI/23-145     AC A0A4Z1NQI9.1
#=GS A0A6P9A875_THRPL/24-145     AC A0A6P9A875.1
#=GS A0A2P7YIS2_9PEZI/25-154     AC A0A2P7YIS2.1
#=GS A0A4C1ULE0_EUMVA/21-140     AC A0A4C1ULE0.1
#=GS A0A6H0XLG0_9PEZI/25-147     AC A0A6H0XLG0.1
#=GS A0A5E8B5V0_9ASCO/33-146     AC A0A5E8B5V0.1
#=GS A0A5Q4C3Y9_9PEZI/25-147     AC A0A5Q4C3Y9.1
#=GS A0A6P7Y2A7_9AMPH/33-153     AC A0A6P7Y2A7.1
#=GS G3XMV4_ASPNA/33-155         AC G3XMV4.1
#=GS A0A3Q4GHI7_NEOBR/21-107     AC A0A3Q4GHI7.1
#=GS M2RVG4_COCSN/24-146         AC M2RVG4.1
#=GS A0A484CR58_PERFV/24-145     AC A0A484CR58.1
#=GS A0A183DT26_9BILA/25-106     AC A0A183DT26.1
#=GS A0A653D2C7_CALMS/21-141     AC A0A653D2C7.1
#=GS G2QVW3_THETT/25-147         AC G2QVW3.1
#=GS A0A183TMI5_SCHSO/7-127      AC A0A183TMI5.1
#=GS A0A1V8V0M8_9PEZI/25-147     AC A0A1V8V0M8.1
#=GS A0A3Q0GIB7_ALLSI/265-385    AC A0A3Q0GIB7.1
#=GS A0A1B7TK04_9ASCO/59-180     AC A0A1B7TK04.1
#=GS A0A3Q1J645_ANATE/1-111      AC A0A3Q1J645.2
#=GS A0A388L708_CHABU/73-194     AC A0A388L708.1
#=GS A0A5E4CAI2_MARMO/21-141     AC A0A5E4CAI2.1
#=GS A0A286XT57_CAVPO/21-141     AC A0A286XT57.1
#=GS A0A2G5B7D1_COERN/24-143     AC A0A2G5B7D1.1
#=GS A0A2Y9EMA3_PHYMC/21-141     AC A0A2Y9EMA3.1
#=GS A0A5F4DKE2_CANLF/20-107     AC A0A5F4DKE2.1
#=GS A0A0C3NUV6_PHLGI/23-145     AC A0A0C3NUV6.1
#=GS A0A6J2PV63_COTGO/22-142     AC A0A6J2PV63.1
#=GS A0A1S4FWC1_AEDAE/20-140     AC A0A1S4FWC1.1
#=GS A0A4P9XRU9_9FUNG/17-139     AC A0A4P9XRU9.1
#=GS A0A0K6G950_9AGAM/23-145     AC A0A0K6G950.1
#=GS A0A091W8U4_OPIHO/8-128      AC A0A091W8U4.1
#=GS A0A455CC26_PHYMC/21-70      AC A0A455CC26.1
#=GS A5PJF9_BOVIN/21-141         AC A5PJF9.1
#=GS A0A6J1N2E1_BICAN/21-141     AC A0A6J1N2E1.1
#=GS A0A3B5KIC6_TAKRU/24-145     AC A0A3B5KIC6.2
#=GS A0A5E4GNV6_PRUDU/47-168     AC A0A5E4GNV6.1
#=GS A0A168RAZ4_ABSGL/21-144     AC A0A168RAZ4.1
#=GS A0A0B2VZI4_TOXCA/22-142     AC A0A0B2VZI4.1
#=GS A0A1R0GW45_9FUNG/26-148     AC A0A1R0GW45.1
#=GS A0A183IVI4_9BILA/21-142     AC A0A183IVI4.1
#=GS A0A091MHL0_9PASS/8-127      AC A0A091MHL0.1
#=GS A0A059J3I8_TRIIM/28-150     AC A0A059J3I8.1
#=GS F9WX63_ZYMTI/25-147         AC F9WX63.1
#=GS A0A0D9QYD5_CHLSB/21-141     AC A0A0D9QYD5.1
#=GS W9QCK8_9ROSA/35-157         AC W9QCK8.1
#=GS A0A0K0DVP0_STRER/20-140     AC A0A0K0DVP0.1
#=GS S8C8F3_9LAMI/31-152         AC S8C8F3.1
#=GS A0A2P5YEH3_GOSBA/34-155     AC A0A2P5YEH3.1
#=GS A0A556VWC4_BAGYA/24-145     AC A0A556VWC4.1
#=GS A0A316UIQ5_9BASI/23-145     AC A0A316UIQ5.1
#=GS A0A2C6AL38_9HYPO/25-147     AC A0A2C6AL38.1
#=GS A0A2I3TIK6_PANTR/21-141     AC A0A2I3TIK6.1
#=GS A0A498SGW9_ACAVI/29-149     AC A0A498SGW9.1
#=GS A0A074VDE8_9PEZI/26-149     AC A0A074VDE8.1
#=GS A0A4S4CXM5_CAMSI/33-152     AC A0A4S4CXM5.1
#=GS A0A5N5KZX5_PANHP/24-145     AC A0A5N5KZX5.1
#=GS A0A0P1BF99_9BASI/23-145     AC A0A0P1BF99.1
#=GS C9SGY4_VERA1/26-148         AC C9SGY4.1
#=GS A0A3M7A6Q2_HORWE/25-157     AC A0A3M7A6Q2.1
#=GS D6WIH5_TRICA/22-144         AC D6WIH5.1
#=GS E3QBS7_COLGM/25-147         AC E3QBS7.1
#=GS A0A0D2MQ42_9CHLO/1-112      AC A0A0D2MQ42.1
#=GS A0A6G0YSQ9_APHCR/2-102      AC A0A6G0YSQ9.1
#=GS A0A0M9WJF0_9EURO/89-211     AC A0A0M9WJF0.1
#=GS A0A2V1C505_9HELO/26-148     AC A0A2V1C505.1
#=GS A0A1Y2C7Q4_9FUNG/9-132      AC A0A1Y2C7Q4.1
#=GS A0A179URW9_BLAGS/33-155     AC A0A179URW9.1
#=GS U7Q7C1_SPOS1/25-147         AC U7Q7C1.1
#=GS A0A553PYZ8_9TELE/35-85      AC A0A553PYZ8.1
#=GS A0A2K3L7N1_TRIPR/43-164     AC A0A2K3L7N1.1
#=GS A0A444D4F0_ENSVE/39-159     AC A0A444D4F0.1
#=GS A0A2C5ZBV2_9HYPO/25-147     AC A0A2C5ZBV2.1
#=GS A0A672FYF4_SALFA/18-135     AC A0A672FYF4.1
#=GS A0A151X6V4_9HYME/22-142     AC A0A151X6V4.1
#=GS A0A671XU68_SPAAU/22-142     AC A0A671XU68.1
#=GS R0IGY2_SETT2/24-146         AC R0IGY2.1
#=GS A0A4W3IBS8_CALMI/19-139     AC A0A4W3IBS8.1
#=GS A0A2I3LK16_PAPAN/21-72      AC A0A2I3LK16.1
#=GS A0A2K6SIW2_SAIBB/21-141     AC A0A2K6SIW2.1
#=GS A0A6A6NJA7_HEVBR/33-152     AC A0A6A6NJA7.1
#=GS G8ZQ29_TORDC/34-155         AC G8ZQ29.1
#=GS A0A341D0D2_NEOAA/21-141     AC A0A341D0D2.1
#=GS A0A2Y9RNB1_TRIMA/10-130     AC A0A2Y9RNB1.1
#=GS A0A1Q3D9B2_CEPFO/38-159     AC A0A1Q3D9B2.1
#=GS A0A3N6QXJ4_BRACR/246-367    AC A0A3N6QXJ4.1
#=GS A0A091H6Y0_BUCRH/8-128      AC A0A091H6Y0.1
#=GS G1S7V6_NOMLE/21-142         AC G1S7V6.3
#=GS A0A1E4SPD6_9ASCO/25-158     AC A0A1E4SPD6.1
#=GS A0A2Y9JQ69_ENHLU/36-119     AC A0A2Y9JQ69.1
#=GS A0A0F8ADA3_LARCR/22-142     AC A0A0F8ADA3.1
#=GS A0A1V6N8P7_9EURO/32-154     AC A0A1V6N8P7.1
#=GS K5W795_AGABU/21-143         AC K5W795.1
#=GS A0A674P505_TAKRU/22-142     AC A0A674P505.1
#=GS UEVLD_DANRE/21-141          AC Q6DBY5.1
#=GS A0A2U3V5C0_TURTR/21-141     AC A0A2U3V5C0.2
#=GS A0A5B0NR00_PUCGR/25-147     AC A0A5B0NR00.1
#=GS A0A3Q3XF07_MOLML/1-101      AC A0A3Q3XF07.1
#=GS A0A1Y1IDC2_KLENI/33-160     AC A0A1Y1IDC2.1
#=GS A0A4Y7IZ61_PAPSO/32-153     AC A0A4Y7IZ61.1
#=GS B4HK72_DROSE/22-142         AC B4HK72.1
#=GS A0A3Q3XD74_MOLML/22-142     AC A0A3Q3XD74.1
#=GS A0A250WUH6_9CHLO/29-150     AC A0A250WUH6.1
#=GS D7LC94_ARALL/71-135         AC D7LC94.1
#=GS N6TTI4_DENPD/20-140         AC N6TTI4.1
#=GS A0A6S7PD21_LACSI/33-152     AC A0A6S7PD21.1
#=GS A0A4X2JQT0_VOMUR/37-119     AC A0A4X2JQT0.1
#=GS A0A081CGY5_PSEA2/23-145     AC A0A081CGY5.1
#=GS A0A4S8J2D8_MUSBA/42-166     AC A0A4S8J2D8.1
#=GS M7NMC0_PNEMU/24-146         AC M7NMC0.1
#=GS F6GV51_VITVI/38-159         AC F6GV51.1
#=GS A0A218UTI9_9PASE/21-141     AC A0A218UTI9.1
#=GS A0A6J2M541_9CHIR/21-141     AC A0A6J2M541.1
#=GS A0A317WLZ1_9EURO/33-155     AC A0A317WLZ1.1
#=GS A0A2P6NNJ5_9EUKA/71-192     AC A0A2P6NNJ5.1
#=GS A0A5C3PRZ6_9APHY/25-147     AC A0A5C3PRZ6.1
#=GS A0A673K582_9TELE/23-143     AC A0A673K582.1
#=GS A0A6P7GUW5_DIAVI/20-140     AC A0A6P7GUW5.1
#=GS A0A1S7HQT7_9SACH/34-154     AC A0A1S7HQT7.1
A0A1R2AP69_9CILI/22-141                ......................................................ik--VDLLANLRNFP.......SL.RLN.L-..L.T..................M...........N.....E.....QGD..V.Y...KIIA..FEGCLPV..V.......YM............N...CS....Y.N...........VPISCAIPPRYPF...........................QAP..S..I..Y..V.KNPQNT..............SIQ...P.SS...YVD.P..D....GLV....KH..P...........S.I..T..Y.WDP.........KKSS...............LGNL.IRDIVQ.......AFGQHFPI................................................................
A0A397UES5_9GLOM/32-156                .......................................................a-FRDVDTTISVFG......kSL.TLK.TD..T.Y..................T...........Y.....D.....DGK..S.K...ALLC..LHGTIPI..T.......FK............S...TP....Y.N...........IPVNIWIPTEYPM...........................AAP..I..V..F..V.VPTSNM..............LVR...P.SK...IVD.V..S....GRC....QH..T...........Y.L..Q..H.WGIn......pqEESN...............IVAL.CRILQD.......VFGHNPPV................................................................
A0A0L7LM77_9NEOP/21-141                .......................................................t-CREVLNLIQFYK.......SL.TYR.LE..G.F..................V...........F.....N.....SGS..R.K...DLLN..LEGTIPV..N.......YK............G...AF....Y.N...........IPVSIWLMDTHPQ...........................NAP..L..A..F..V.KPTKDM..............SIK...V.SK...YVD.S..N....GKV....YL..P...........Y.L..H..D.WAP.........NNST...............LQNL.IQCMAV.......AFGELPPV................................................................
A0A0D1ZAZ9_9EURO/26-148                ........................................................TYSDLAHVLARNP.......GF.APR.TD..V.Y..................T...........S.....E.....NGV..S.A...LLVH..FTGTIPV..T.......FR............G...NT....Y.R...........FPVSLWIPHAYPY...........................EPP..I..C..Y..V.TPTEDM..............VVR...P.GQ...HVG.G..D....GRV....YH..P...........Y.L..A..H.WREa.......wERSN...............TVDF.LSILSD.......VFAKEPPV................................................................
A0A383V8V5_TETOB/34-155                .......................................................i-REHLSDLLKMFP.......NL.TIK.VS..E.Y..................H...........T.....N.....DGR..I.L...HLIK..AEGTIPI..H.......YQ............A...HK....Y.N...........IPVVVWLPERYPL...........................QAP..I..V..Y..V.CPTANM..............IIK...A.GH..tYVD.P..S....GLV....RT..S...........C.I..A..N.WLH.........PSSD...............LSTA.CQEMAM.......LFGAEPPL................................................................
A0A6I9NGH5_9TELE/21-141                .......................................................a-VEQLQKIYRIYP.......EM.MPS.TG..T.Y..................T...........F.....S.....DNT..Q.K...DLLK..LIGNVPV..N.......YG............G...RS....Y.N...........IPIQLWLMDSFPF...........................TPP..I..C..L..L.RPTSNM..............VIR...E.GK...HVD.K..E....GRL....HL..P...........G.L..H..N.WDY.........PKST...............VLVL.LTEMIS.......KFEEDPPL................................................................
I2H0Q9_TETBL/24-146                    ........................................................TFHDSMVVLSEFK.......QL.RPR.TR..V.F..................T...........N.....S.....EGS..S.E...LLLC..IYGE-PV..P.......ES............-...-S....I.Q...........TPVLIWVPQNYPA...........................EPP..N..V..F..L.DLEKLQn............aRIR...I.SN...HID.S..N....GRI....FL..P...........I.L..N..K.WDY.........RTST...............LQSL.LIELIH.......TI------ysttlvdpv.......................................................
A0A5J9WVU3_9POAL/54-177                .......................................................v-RRHVFAVLREFP.......SL.SPS.VD..I.Y..................T...........A.....D.....DGA..S.A...VLLN..ARGLLAV..-.......-S............G...AL....P.P...........LLLTLWLPREYPY...........................RRP..I..V..Y..A.FPATPRe............aPVP...D.HP...FVD.H..R...tGQVr..aTL..P...........Y.L..D..G.WRV.........PASS...............LAGL.VRSLVA.......AFRMCRP-l...............................................................
A0A482SCM0_9ARCH/1-103                 ....................................................msnt-------------.......--.---.--..-.-..................V...........Q.....N.....NGT..H.T...KLLT..LTGTMPI..Y.......YQ............G...TQ....Y.N...........IPIEIFLPLAYPQ...........................ECP..K..L..F..V.RPTPTM..............CVK...Q.GH..kHVD.T..Q....GCV....YL..P...........Y.L..H..E.WRG.........-GSH...............LKGL.VETASG.......VFSIEPPL................................................................
TS101_DICDI/47-167                     .......................................................i-SKDLKETFHLFP.......NL.SPF.YE..-.-..................-...........-.....N.....IPN..R.V...NLIC..IKGTIPI..C.......FK............G...IN....Y.Y...........LPIIVWVPLNYPQ...........................EFP..T..M..V..L.DPTPEM..............RIV...K.NH..hHVN.L..Q....GLV....YH..P...........Y.I..S..S.WSS.........-NST...............METR.VSQQQQpq...ppQ-------nnisppp.........................................................
F7AJZ9_CALJA/1-103                     ........................................................-------------.......--.---.MD..T.Y..................V...........F.....K.....DSS..Q.K...NLLN..FAGTIPV..I.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A6P9A9L0_THRPL/65-167                .....................................................pyk-------------.......--.---.--..-.-..................V...........F.....S.....NGT..R.K...ELLN..LKGTVPV..P.......YK............G...MN....Y.N...........IPVKIWIMDTHPN...........................NAP..I..C..Y..V.NPTSDM..............IVK...P.SR...TTD.H..S....GKI....YL..P...........F.L..H..F.WDP.........RGAE..............lLPSL.IKNMIS.......AFSAEPPV................................................................
A0A1Z5TP61_HORWE/25-154                .......................................................t-YTSVAQTLSAYP.......TL.SPR.TE..V.F..................T...........N.....E.....TGR..S.A...LLLV..LSGTLPT..H.......FR............G...AE....Y.R...........FPVKIWFPHTYPH...........................EAP..M..V..F..V.TPGGAM..............AIR...P.GQ...HVG.T..D....GRV....YH..P...........Y.L..R..D.WRGmgggggwedGGSN...............LGEF.LRVLIG.......VFEREPPV................................................................
A0A452FY44_CAPHI/14-134                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..I.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSI...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A671PG62_9TELE/24-145                .......................................................v-LDDIKDVATDFP.......HL.QLY.VD..Y.Y..................L...........Y.....P.....NND..K.K...KLVY..LGGTVPI..T.......YE............G...AT....Y.N...........IPVCIWIHETHPK...........................NPP..R..C..F..V.CPSPSM..............IIN...A.KT..sNVD.A..N....GRV....LL..H...........C.L..S..N.WKI.........GWSN...............LSIV.LEEMIA.......AFQRETPL................................................................
A0A6P7Y1Q5_9AMPH/33-153                ........................................................TVEDLKNVHKRYP.......NF.IFS.MD..T.Y..................T...........F.....R.....DGS..Q.K...DLLN..FVGTIPM..T.......YQ............G...NS....Y.N...........IPVQLWILDSHPF...........................APP..L..C..F..L.KPTATM..............GIH...V.GK...HVD.T..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VLGL.FAEMIL.......KFEEELPL................................................................
A0A2U3ZWC7_ODORO/1-112                 ......................................................mf-----------FP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A0N1P0F3_9EURO/29-152                .......................................................a-YSDIVSTLQRYP.......GI.TVKgTK..E.Y..................I...........F.....D.....NGK..P.E...LLLY..LGGVLPV..S.......FR............G...SL....Y.H...........FPILIWIPYAYPY...........................EAP..I..I..Y..V.DPSDDI..............AVN...P.GQ...HVA.T..D....GKI....YH..H...........Y.L..A..H.WREt.......wDRSH...............IVEF.LGILSD.......VFAKEPPV................................................................
A0A2K5ZMN0_MANLE/36-119                ....................................................kysm-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......TY............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
V5GA62_BYSSN/421-543                   ........................................................TYYDVAAALAQYP.......SL.GPR.TD..V.Y..................T...........F.....E.....NGV..S.A...LLLH..IVGTVPV..N.......FR............G...AM....Y.Q...........FPVDVWIPTAYPL...........................EPP..V..V..Y..V.TPTQDM..............VVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wDRSS...............IVDF.LTILRE.......VFAKEPPV................................................................
J3LIS8_ORYBR/41-163                    .......................................................i-RNHLVALADAFP.......SL.HPK.AA..L.F..................T...........H.....N.....DGR..A.A...HLLQ..ADGTIPI..H.......HA............G...AS....Y.N...........LPAVLWLPEPYPR...........................SPP..L..V..F..L.SPTRDM..............VIK...P.HH..pLVD.R..S....GLV...aNA..P...........Y.L..R..S.WVF.........PSSN...............LVDL.VRSLSH.......LFGLDPPL................................................................
A0A3B1K084_ASTMX/22-142                ........................................................TVREITNVILQYK.......DL.KPL.MD..A.Y..................V...........F.....N.....DGS..S.R...ELMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A5A9PRJ4_9TELE/21-141                .......................................................a-IEELQKVSRLHP.......DI.KVL.YG..T.Y..................T...........F.....S.....DSS..Q.K...DLLK..VVGNIPV..R.......YQ............G...RL....Y.N...........LPILLWLVDSFPF...........................TPP..I..C..F..L.RPTSSM..............VIR...E.GK...HVD.S..K....GRI....HL..P...........G.L..H..N.WDH.........PKSS...............LNGL.LAEMIA.......KFEEEPPL................................................................
F6QUZ4_CALJA/36-156                    ........................................................TVEELKNVNMFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...NLLN..FAGTIPV..I.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A1S3IWS2_LINUN/24-144                .......................................................a-KRDILQALSHFK.......DL.KPN.VD..S.F..................V...........F.....N.....DGN..R.K...ELLC..LEGTIPV..T.......YR............G...TT....F.N...........IPVCLWLLETHPH...........................NPP..M..V..Y..V.KPTANM..............QIM...S.GQ...HVD.T..N....GKV....YL..S...........Y.L..H..E.WRH.........PQSD...............LLGL.IQIMCI.......IFGDNPPV................................................................
V4LPT5_EUTSA/36-153                    .......................................................i-RKHLISFLQDFP.......NF.ELS.TD..T.F..................N...........H.....N.....NGT..T.V...QLFR..LEGSLRT..R.......ST............-...--....-.T...........VQLTIWVHENYPL...........................TPP..M..V..F..V.SSNSMA..............PIR...T.NH..pFVN.S..S....GLT....NS..N...........Y.I..E..T.WEY.........PRCN...............LLDF.IRNLRR.......VLANDNP-f...............................................................
C4YAB8_CLAL4/26-162                    .......................................................v-YSDVYRFLAVHLt.....hGF.RIR.TA..V.Y..................T...........S.....P.....SGR..T.S...LLIE..LYGSVSC..A.......NG............-...--....-.S...........VPVQIWIPQNYPFaedsa.................rfdpnGVP..L..V..Y..V.MPPQDM..............IIR...S.GN...NVD.S..Q....GRF....YH..P...........Y.L..S..S.WHQny....tpgP--Arn..........dfsLLSL.VGCLKT.......TFEKEMPL................................................................
B6H2Y6_PENRW/32-154                    ........................................................TYHDVANALAQYP.......SL.SPR.TD..V.Y..................T...........Y.....E.....TGF..S.A...LLLH..LVGTLPV..T.......FR............G...TT....Y.R...........FPIALWIPNTYPR...........................EPP..I..A..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GQV....YH..H...........Y.L..A..H.WAEa.......wDRST...............IADL.LSILQD.......IFAKEPPV................................................................
A0A2K6UNQ3_SAIBB/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A4Q4WDR7_9PEZI/25-147                ........................................................TYNDVAQALSQYS.......SL.SPR.TD..V.H..................T...........F.....D.....NGI..S.A...LLLH..LSGTIPV..V.......FR............G...TT....Y.R...........FPISIWVPHAYPR...........................EAP..L..A..Y..V.TPTENM..............MVR...P.GQ...HVD.P..Q....GRI....YH..P...........Y.L..A..A.WPEf.......wDKSS...............LLDF.LAILRD.......IFAKEPPV................................................................
A0A287SQ79_HORVV/26-150                ......................................................vp--DHLATLTEAFP.......SL.RPR.TG..L.F..................T...........H.....D.....DGR..A.A...RLLQ..AAGTIPI..V.......HA............G...VS....Y.D...........LPAVVWLPERYPR...........................CPP..L..V..F..L.SPARGT..............VVR...T.DH..pLVD.R..S....GLVa.aaDA..P...........Y.L..R..S.WAF.........PSSN...............LRDL.VLSLSR.......AFGIDPPL................................................................
A0A5N5ND42_PANHP/21-141                .......................................................a-VEELQKIHLNYP.......DM.KTV.AG..T.Y..................T...........F.....T.....DSS..Q.K...DLLK..VLGNIPV..R.......YQ............G...HS....Y.N...........LPIQLWLLDSFPF...........................TPP..I..C..F..L.RPTASM..............VIR...E.GK...HVD.A..K....GRI....YL..P...........A.L..H..N.WDH.........PKSS...............VIAL.LEEMIA.......KFEEDPPL................................................................
A0A0J0XPB1_9TREE/24-148                .......................................................i-LSEVLGVLSSYR.......TL.QVK.TD..A.F..................T...........F.....D.....SGQ..T.A...LLLL..LHGTLPI..N.......YR............G...AT....Y.Q...........IPVHVWVPHEYPR...........................RPP..M..A..F..V.VPTKEM..............GVR...K.SR...EVD.P..G....GRV....RE..E...........V.V..E..H.WWAsw.....psPNRD...............IPTL.LNKLAE.......IFSATPPV................................................................
A0A0H2RP71_9AGAM/27-149                ......................................................iq--PDVLALLDRVP.......SL.RPK.TE..I.Y..................T...........Y.....D.....DGR..T.Q...LLLC..IHGTIPI..A.......YR............A...TA....Y.N...........IPVAVWLTLDYPR...........................EPP..I..V..Y..V.VPTSDM..............LVR...Q.SP...YVD.V..S....GRC....DL..E...........Y.M..R..N.WRAk.......pDSCS...............VQGL.IDAMID.......HFSAHPPL................................................................
A0A2I3HW18_NOMLE/21-142                ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIC.......QV------lrgtspv.........................................................
A0A2X0P6C8_9BASI/47-158                ..............................................pvltptlsta-------------.......--.---.--..-.-..................-...........Y.....D.....DGR..V.E...LLLS..ITGVIPV..P.......IQ............G...AT....Y.Q...........CPITFWLPLDFPN...........................KPP..M..V..F..V.LPSSTL..............IVR...P.GP...NIE.P..S....GKV...vES..A...........Y.L..D..N.WARk.......aEGCS...............LVALvVEELIP.......MFSRRYPV................................................................
A0A2S5BIK5_9BASI/18-141                ......................................................va--QQALSVLNHYH.......TLvNAE.QS..D.F..................T...........Y.....D.....DGR..V.E...LLLS..LTGVLPV..P.......IG............A...NT....Y.H...........CPVAIWLPLDFPS...........................RPP..I..V..Y..V.LASETL..............QIR...K.GK...HVD.A..N....GKV....EA..P...........Y.L..E..N.WGRk.......sEGCS...............LMSL.INELIP.......IFSARYPL................................................................
A0A5M3N1G5_CONPW/24-146                .......................................................v-YVDIDAALSRFT.......TL.RPK.SD..V.Y..................T...........Y.....D.....DGR..S.Q...LLLC..LHGTLPI..T.......FR............G...TT....Y.N...........IPIAVWIAREYPR...........................RPP..I..A..Y..V.VPTQDM..............LVR...S.SK...HVD.V..S....GRC....LT..G...........Y.I..Q..D.WERk.......sESCN...............LSAL.LESMQA.......EFSRGPPV................................................................
A0A5A9PBF3_9TELE/39-160                .......................................................v-LDDIKGVSTDYP.......DL.QLY.VD..Y.Y..................F...........Y.....P.....NND..K.K...KLVY..LGGTVPV..T.......YE............G...NK....Y.N...........IPVCVWIHETHPK...........................NPP..R..C..F..V.CPSPTM..............VIN...A.KS..sNVD.A..S....GCV....LL..H...........C.L..S..N.WKI.........GWSN...............LSIV.LEEMIA.......AFQREPPL................................................................
A0A2B7ZLP5_9EURO/33-155                ........................................................TYSDVANLLAQYP.......GF.APR.TD..V.Y..................T...........Y.....E.....NGT..P.A...LLLH..AAGTLPV..T.......FR............G...AL....Y.R...........FPITVWVPKAYPR...........................EPP..M..V..Y..V.TPTQDM..............LVR...P.GQ...HVS.G..E....GRV....YH..H...........Y.L..A..H.WSEa.......wDRST...............IVDF.LYILRD.......VFAKEPPV................................................................
A0A6P3R6B4_PTEVA/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NI....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A2B4SSR3_STYPI/18-138                ......................................................ch--NDVRRALHQYS.......CL.IPN.LQ..N.F..................T...........H.....N.....DGR..E.V...ELLA..LDGTLPV..M.......IR............G...VT....Y.N...........IPVCVWLQENHPY...........................VPP..L..V..F..V.KPTSTM..............AIK...A.SQ...YVD.T..S....GKV....YH..P...........F.L..H..E.WSH.........PKSD...............LAAL.LQILCG.......VFAQQSPV................................................................
A0A0B1TGM3_OESDE/7-87                  ....................................................firy-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............G...VR....Y.N...........IPISVYLWDTHPY...........................YAP..I..C..Y..V.SPTPTM..............VIR...E.SE...HVT.K..Q....GRV....FL..P...........Y.L..S..E.WRF.........PGYD...............LNGL.LQVMAM.......VFQEKCPV................................................................
A0A314YNZ2_PRUYE/2-123                 ........................................................IFSDVIQLLDQYP.......SL.GLT.RG..R.F..................-...........-.....-.....QPE..E.L...AILV..VKGTIPI..F.......YT............N...MA....Y.K...........IPVEIWVSLSYPT...........................SPP..R..A..HgtV.DYQNTT..............TIK...L.HH..pYVD.A..Rs..gGFI....NV..P...........H.M..L..D.WHS.........-ERT...............LVVL.VTNMCE.......CFSQDPPV................................................................
A0A5D2YZP2_GOSMU/41-162                .......................................................i-RQQLLSLISNYP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..AEGTIPM..P.......FQ............G...VT....Y.N...........IPIIIWLMESYPR...........................YAP..A..V..Y..V.NPTRDM..............IIK...R.PH..pHVS.P..S....GLV....SI..P...........Y.L..H..N.WIY.........PSSN...............LVDL.VLHLSS.......AFSRDPPL................................................................
A0A0S7DFU6_9EURO/70-185                ........................................sylellvlmkvahpaa-------------.......--.---.--..-.-..................-...........Y.....E.....TGF..S.A...LLLH..LTGTIPV..S.......FR............G...TV....Y.K...........FPIALWIPNAYPR...........................EPP..L..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wDRSN...............LVDF.LMILRE.......VFAKEPPV................................................................
A0A2K5KNR8_CERAT/7-127                 .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A6P3IR59_BISBI/9-129                 .......................................................t-VRETVNVISLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A5N6ZAS4_9EURO/33-155                ........................................................TYYDVALVLAQYP.......SL.SPR.TE..V.Y..................T...........Y.....E.....NGF..S.A...LLLQ..LTGTVPV..T.......FR............G...TV....Y.K...........FPISLWVPNTYPR...........................EPP..I..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wERSS...............LVDL.VSILRE.......VFAKEPPV................................................................
A0A1J9QR92_9EURO/33-155                ........................................................TYSDVSNLLAQYP.......GF.APR.TD..V.Y..................T...........Y.....E.....NGT..P.A...LLLH..VAGTLPV..T.......FR............G...AV....Y.R...........FPITIWVPKAYPR...........................ESP..M..V..Y..V.TPTQDM..............LVR...P.GQ...HVS.G..E....GRV....YH..H...........Y.L..A..H.WSEa.......wDRST...............IVDF.LYILRD.......VFAKEPPV................................................................
A0A6P8U4S0_GYMAC/1-65                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------MDSFPF...........................TPP..I..C..L..L.RPTSNM..............VIR...E.GK...HVD.K..E....GRL....HL..P...........G.L..H..N.WDY.........PKST...............VVGL.LTEMIS.......KFEEDPPL................................................................
A0A3Q7RP01_VULVU/1-80                  .......................................................m-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..K....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A7M7SZX9_STRPU/24-144                .......................................................t-QRDMQSVFAAFK.......DL.RPK.LD..S.H..................V...........F.....N.....DGK..R.K...ELIC..IDGTIPV..L.......YK............A...NT....Y.N...........IPICVWILETHPH...........................NPP..L..C..F..V.RPTSTM..............LIK...P.SK...HVD.A..N....GRV....YL..P...........Y.L..H..D.WKP.........NNSD...............LVGL.IQVMTV.......VFGESSPV................................................................
Q7S4R9_NEUCR/25-147                    ........................................................TYNDVAQVLSHYP.......SL.SPR.TD..V.H..................T...........F.....P.....NGA..S.A...LLVH..LSGTLPV..V.......FR............G...TT....Y.R...........FPISVWIPHAYPR...........................EAP..L..V..Y..V.TPTEHI..............MVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..A..G.WSTy.......wDKST...............ILDF.LAILRD.......VFAKEPPV................................................................
A0A3M7PXR2_BRAPC/66-186                .......................................................t-KRDIMDALSYFK.......YL.SPK.TD..K.Y..................V...........Y.....P.....TGT..V.K...ELVC..VLGTIPV..N.......FR............S...AV....Y.N...........IPVQIYLNDTHPY...........................DAP..I..A..Y..V.RPTAEM..............SVN...V.CE...TVD.A..S....GKV....SL..P...........C.L..T..E.WNH.........QNSD...............LYML.LNLMAI.......KFSEQTPL................................................................
A0A6J0CI58_PERMB/18-123                ...................................................aeedd-------------.......--.---.--..V.Q..................V...........F.....N.....DGS..S.R...ELVN..LTGTIPV..R.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..D.WKH.........PRSE...............LLEL.IQIMIV.......IFGEEPPV................................................................
A0A2P6QV45_ROSCH/36-157                .......................................................i-RQHLVALISSYP.......SL.EPK.TA..T.F..................T...........H.....N.....NGR..T.V...NLLQ..VDGTVPM..T.......YQ............G...VT....Y.N...........IPVVFWLIDSYPR...........................SAP..C..V..Y..V.NPTRDM..............VIK...R.PH..pCVD.P..S....GIV....SI..P...........Y.L..Q..D.WVF.........PSSN...............LLDL.TRQLSD.......YFGRDPPL................................................................
A0A4W5JZL8_9TELE/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..T.R...TLVS..LTGTVPV..S.......YR............G...NI....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A060W8L8_ONCMY/24-146                ........................................................VVSDIKNVTATYG.......DL.RMY.VD..F.Y..................C...........F.....P.....NKE..K.K...KLVY..LAGTIPV..P.......HD...........aG...NT....Y.N...........IPVCIWLHETHPQ...........................SRP..R..C..Y..V.CPSISM..............LIN...P.RC..pYVE.A..S....GQV....LL..D...........C.L..N..N.WKS.........GLAN...............LSLL.VSEMRS.......AFQKETPL................................................................
A0A3Q3NAH2_9TELE/24-145                .......................................................t-LTDLQEVQALFS.......DL.RLY.VD..F.Y..................C...........F.....P.....NKD..K.K...RLVY..LAGTLPV..H.......YE............G...SV....Y.N...........IPVCIWLHETHPV...........................SRP..R..C..Y..V.CPSVSM..............VIN...P.SC..tCVD.A..F....GNI....SL..D...........G.L..T..N.WTH.........GVSN...............LTLL.VSEMRR.......AFQKDTPL................................................................
A0A0E0RUR5_GIBZE/25-147                .......................................................a-YNDVAQALDRFS.......SL.SPR.TD..V.H..................T...........F.....S.....NGA..N.A...LLLH..LSGTLPV..N.......FR............G...TT....Y.R...........FPLSIWVPHAYPR...........................EPP..M..I..Y..V.VPTETM..............MIR...P.GQ...HID.P..Q....GFV....YH..P...........Y.L..V..R.WAEf.......wDKSN...............LRDF.LNILTD.......VFAKEPPV................................................................
A0A0A0AWF0_CHAVO/8-128                 ........................................................TVQETTSVITQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
A0A200QH97_9MAGN/33-149                .......................................................i-RDHFLSLLHNFP.......SL.KPS.ID..T.F..................T...........H.....D.....DGT..T.V...NLLN..ASGTLPV..S.......PA............-...--....-.-...........IPLTIWIHESYPF...........................FPP..L..V..F..L.SSTSST..............QIL...R.DH..pFVY.P..S....GAI....FS..P...........Y.L..H..V.WRY.........PRSN...............LLDF.ACNLVR.......IFTYYHP-f...............................................................
A0A1E4RID3_9ASCO/2-144                 .......................................................v-YTHIYQFLQVFLnhkskssRF.KIR.TN..V.F..................T...........S....gN.....TGH..S.E...LLIE..LFGSVKL..N.......DL............-...--....-.A...........VPINIWVPLNYPFadadn................rvnevnGVP..I..V..F..I.TPNKDKn............hVLI...P.GN...YVD.S..Q....GRF....YH..P...........Y.L..S..S.WFSef....ndiAKYN...............LIEL.INVLKQ.......TFSLEPPI................................................................
A0A4W3IEG2_CALMI/1-103                 ........................................................-------------.......--.---.MD..K.Y..................T...........F.....N.....DGS..Q.R...DLLN..LLGTVPV..T.......YQ............G...FS....Y.N...........IPVRLWILDSHPF...........................GPP..L..C..F..L.RPTPDM..............VIR...E.GK...HVD.V..Q....GRV....YL..P...........G.L..Q..H.WSH.........PKSD...............VVSL.LNEMSL.......TFGNEPPL................................................................
A0A669QVG4_PHACC/15-135                .......................................................t-IQETNSVISQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NI....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFAEEPPV................................................................
A0A1Y2M722_EPING/25-147                ........................................................TYHDATEALSHYP.......SL.AVR.TD..V.Y..................T...........Y.....E.....NGA..S.H...LLLN..LSGTLPV..T.......FR............G...TT....Y.G...........FPVAVWVPYAYPR...........................EPP..I..V..F..V.KPDKDM..............LVR...P.GQ...HVS.G..D....GRV....YH..P...........Y.L..A..Q.WAKy.......wDKST...............LFDF.LAVLRG.......VFTKEPPV................................................................
A0A1R1Y0H4_9FUNG/26-169                .......................................................g-YKNIEEVLLNWN.......SL.LPK.VD..E.Y..................V...........S.....D.....NGT..I.I...SLLK..LYGTIPV..E.......IK............G...SV....F.Y...........IPVSIWFPRQFPE...........................KSP..Y..V..Y..V.VPTDSM..............IIK...A.SK...TVS.D..K....GRI....TT..K...........Y.I..E..N.WDS.........GKKLlniltlqltkilivqP---.------.......--------ifhkdvnlkdlieeliqifsieppv.......................................
A0A2I0UT15_LIMLA/499-619               .......................................................t-IQETTSVITQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
E4XLR9_OIKDI/18-138                    .......................................................m-VKQVEKMQRFFK.......DL.QPS.VK..R.Y..................T...........H.....D.....NGH..S.E...ELAN..LTGTIPA..Y.......YK............G...KQ....Y.N...........FPIEMWLLTSFPE...........................SAP..L..V..F..V.RPTSTM..............SIR...Q.GR...HVD.A..N....GKV....YL..P...........Y.L..N..E.WSA.........SRSN...............LNGL.LGVIAT.......CFGSDPPV................................................................
A0A671REU3_9TELE/21-133                ....................................................aiee----LNKVPRVHP.......DM.KLV.T-..-.-..................-...........-.....A.....RKT..L.D...FCVC..LDGNVST..-.......--............G...CS....Y.N...........LPILLWLLDSFPF...........................TPP..I..C..F..L.RPTSSM..............VIR...E.GK...HVD.S..K....GRI....HL..P...........G.L..H..S.WDH.........PKSS...............VNGL.LAEMIV.......KFEEEPPL................................................................
A0A0M9A6L5_9HYME/32-152                ........................................................TKKHVMKVLNLYK.......GL.KYN.VE..P.F..................V...........F.....N.....DGS..H.K...ELFN..LQGTIPV..S.......YK............G...TY....Y.N...........IPICIWLMDTHPN...........................NAP..M..C..Y..V.KPTADM..............NIK...V.SM...FVD.H..N....GKI....YL..P...........Y.L..H..D.WLP.........HSSD...............LLSL.IQIMIV.......TFGEQPPV................................................................
A0A0D2Q3U6_GOSRA/34-155                .......................................................i-LRHLLSLLQEFP.......GF.KPS.TG..R.F..................M...........H.....N.....DGT..E.V...NLLR..ATGCVHV..A.......NS............-...TT....P.T...........IPLVIWLHENYPQ...........................KAP..L..V..F..V.SLHPMT..............PVH...R.HH..pFVDnT..T....GAT....SP..P...........Y.I..L..T.WKY.........PPCN...............LSEL.LRNLVQ.......LFSIDHP-f...............................................................
A0A0D1ZTB8_EXOME/1-49                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.-----M..............MIR...P.GQ...YVG.G..D....GKI....YH..P...........Y.L..A..H.WRDa.......wERSN...............VVDF.LSILSD.......VFAKEPPV................................................................
A0A3Q0CHI7_MESAU/21-141                ........................................................TVEELKNVNTHFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DTS..Q.K...DLLN..FTGTIPV..M.......YQ............G...IT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..K....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A1Y2HNI7_9FUNG/25-115                ........................................................VFHDVDVLLSRYA......tCL.FPK.LD..T.Y..................V...........H.....P.....DGV..T.S...RILC..IYGTVPV..A.......FS............G...AS....Y.N...........IPVEIWIPEPYPS...........................SAP..L..V..Y..V.RPTQA-..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------wpstrqrtwmptgacf................................................
A0A094GEY4_9PEZI/26-148                ........................................................TYHDVAQALSHYS.......SL.SPK.TE..V.Y..................T...........Y.....E.....NGV..S.E...LLLQ..LSGTLPV..T.......FR............G...TT....Y.R...........FPVTVWIPHQYPR...........................AEP..V..V..Y..V.SPAEGM..............MVR...A.GQ...HVD.P..Q....GRV....YH..P...........Y.L..A..G.WAEf.......hDKSN...............ILDF.LAILRD.......VFAKEPPV................................................................
A0A6P7IHQ3_9TELE/21-141                .......................................................v-AHEIHTALTYFK.......DL.VPM.MD..K.Y..................V...........Y.....S.....DGT..I.K...NMMS..LSGTIPV..K.......IK............D...AI....Y.K...........TPICLWIEENYPL...........................TAP..I..C..Y..V.RPTHEM..............MVL...R.GK...YVS.T..N....GEV....LL..P...........Y.L..E..E.WRN.........AECD...............LVSL.LQVMTV.......VFEEIPPL................................................................
A0A2Y9PAR5_DELLE/1-89                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...--MN..LTGTIPV..P.......YR............G...TT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGEEPPV................................................................
S2JCU0_MUCC1/20-141                    ........................................................TFRDVDAVLQTYL.......SL.KPK.MD..T.Y..................T...........S.....N.....DGH..T.E...LLLC..LHGTVPI..T.......YR............S...IP....Y.N...........IPVAFWIPKEYPK...........................SSP..I..P..Y..V.KPTANM..............LIR...E.GR...HVD.K..S....GMC....YH..H...........Y.R..S..S.WSS........dQKHT...............FLEL.VAILQQ.......VFAQEPPV................................................................
A0A3Q2ZW01_KRYMA/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSTM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
W4GT51_9STRA/25-145                    .......................................................v-RYDVETLLRQIP.......SI.SPQ.NG..V.Y..................T...........H.....N.....NGS..T.S...TMLS..LTGTIPI..Y.......YG............G...NQ....Y.N...........IPVEIWMPEAYPF...........................AAP..T..C..F..V.RPTTDM..............MIR...P.GH..pHVD.Q..N....GLI....VV..P...........Y.S..T..N.WDS.........-DHS...............LVEL.VGYHCS.......IFGAQPPV................................................................
A0A5J5MGA1_MUNRE/21-60                 ........................................................TVHETVNVFTLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIP-..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------................................................................
W5PID5_SHEEP/21-141                    .......................................................t-VRETVNVISLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A2G5DDC1_AQUCA/40-161                .......................................................i-RQHLLTLIETYP.......SL.QIK.TA..T.F..................T...........H.....N.....DGR..T.V...NLLQ..ADGTIPM..I.......YQ............N...VT....Y.N...........IPVVIWLMETYPR...........................HPP..C..V..Y..V.VPTRDM..............IIK...R.PH..sHVN.P..S....GFC....SI..P...........Y.L..H..K.WVY.........PSAN...............LVDL.VRDLSH.......LFGLDPPL................................................................
A0A5B8MLP0_9CHLO/109-230               .......................................................i-RQHILDVVSEFP.......SL.AVS.VT..G.F..................T...........H.....N.....DGR..D.V...KILK..VEGTAPM..Y.......FQ............G...RK....Y.N...........LPLTLWLLEGYPR...........................SPP..R..V..Y..L.TPTKDM..............IIK...S.NH..rFVD.A..S....GCV....NS..P...........Y.L..E..Q.WSF.........PSSN...............LRDL.TTTLCI.......HFGQDPPL................................................................
A0A3B6MZ42_WHEAT/30-154                ......................................................vp--DHLATLAEAFP.......SL.RPR.TA..L.F..................T...........H.....D.....DGR..A.A...RLLQ..AAGTIPI..V.......HA............G...VS....Y.D...........LPAVVWLPERYPR...........................CPP..L..V..F..L.SPARGT..............VLR...T.DH..pLVD.R..S....GLVa.aaAA..P...........Y.L..R..S.WAF.........PSSN...............LRDL.VRSLSH.......AFGIDPPL................................................................
C4R3M9_KOMPG/25-159                    .......................................................c-YQDVSLILMKYS.......SL.KPR.TR..V.F..................A...........D.....N.....KGQ..D.Q...LLLS..LYGSIPC..K.......HH............N...VT....Y.E...........IPITIWIPLDYPN...........................SHP..T..I..Y..V.TPSNET.............hVLN...P.NN...YVD.A..N....GKV....YH..P...........F.I..S..Q.WHSvy.....gaDKYNdpkk......vqenrLLKL.VEVIGD.......AFGREFP-l...............................................................
A0A341D0K7_NEOAA/21-141                ........................................................TMEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...NLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A1L8GI47_XENLA/21-141                ........................................................TIEELKELNRTFP.......NF.IFS.MG..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..LTGTVPM..K.......HQ............G...TT....Y.N...........IPICLWILDSHPF...........................APP..L..C..F..L.KPSQNM..............GVR...V.GR...HID.A..Q....GRM....YL..P...........Y.L..Q..S.WSH.........PKST...............VCGL.IREMAV.......KFEEELPL................................................................
A0A183BH29_9TREM/24-104                .................................................ndgrscx-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..V.......YR............D...QT....Y.N...........IPIAIFVQESHPH...........................VAP..M..V..Y..V.RPTSTM..............EIT...P.SS...FVD.I..T....GLV....KL..P...........Y.L..S..D.WKH.........----...............----.------.......--------vtpvyeisglniqnlk................................................
A0A665TUK9_ECHNA/16-136                ........................................................TVREITNVITQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..T.......YR............G...NV....Y.N...........IPVCLWLLDSYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A667WPS3_9TELE/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A6P5T4Z8_PRUAV/48-172                .....................................................ilt---DVVQLLFHIP.......SL.GLT.RG..-.-..................R...........F.....Q.....KGE..P.V...-VLV..IKGTIPI..F.......YK............G...HP....Y.K...........TPIKIWVPFGYPK...........................DSP..K..VrvV..V.EDQAIM..............SIK...L.PH..pYVD.AgaG....GLV....NV..P...........Y.M..Q..A.WIE.........AHSEr.............tLTDL.VINMCE.......CFSVDPPV................................................................
A0A3M7N3F4_9EURO/52-174                ........................................................TYSDLAHTLSRYP.......SL.APR.TD..V.Y..................T...........F.....E.....NGT..H.A...LLVR..LVGTVPV..N.......FR............G...TV....Y.R...........FPIALWIPHAYPY...........................EPP..M..V..Y..V.TPTDDM..............VVR...Q.GQ...HVA.G..D....GRI....YH..H...........Y.L..A..H.WPQa.......wDRSH...............VADL.LTILSG.......IFANEPP-p...............................................................
A0A4S2JHF4_9HYME/25-145                ........................................................TKKHVISVLNLYK.......GL.VYK.IE..P.F..................V...........F.....N.....DGS..R.K...ELLN..LQGTIPV..V.......YK............G...SC....Y.N...........IPICIWLMDTHPN...........................NAP..M..C..Y..V.KPTADM..............HIK...V.SM...FVD.H..N....GKI....YL..P...........Y.L..H..D.WVP.........HNSD...............LLAL.IQVMIV.......TFGEQPPV................................................................
A0A663M501_ATHCN/1-47                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.-----M..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
W9C8Y3_SCLBF/26-148                    ........................................................TYNDVAQTLSQYT.......SL.SPR.TD..V.Y..................T...........Y.....E.....NGA..S.S...LLLH..LSGTLPV..N.......FR............G...TT....Y.R...........FPIALWIPHAYPQ...........................EAP..L..V..Y..V.TPVEGM..............VVR...A.GQ...HVD.P..Q....GKV....YH..P...........Y.L..M..R.WPDy.......wDKSN...............VLDF.LAILRD.......IFAKEPPV................................................................
A0A3Q7RF78_VULVU/21-141                ........................................................TVEELKNVNRFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..K....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
K3W4Y0_GLOUD/25-146                    ......................................................vr--GDVYQLLRQIP.......SL.QPN.CG..M.F..................A...........H.....N.....DGT..T.S...TLLN..LEGTIPI..F.......YR............G...NQ....Y.N...........IPVEFWIVESYPM...........................APP..V..C..F..V.RPTADM..............MVK...P.GH..pHVT.S..D....GFV....KI..P...........Y.T..S..D.WRQ.........-RNT...............----.------.......--------vstpvrvedrsvslkveit.............................................
F0XDK4_GROCL/25-147                    ........................................................TYNDVAQALSQFP.......SL.SPR.TD..V.H..................T...........F.....S.....NGA..S.A...LLLH..LSGTLPA..V.......FR............G...TT....Y.R...........YPISVWVPHAYPR...........................EAP..L..V..Y..V.TPTENM..............MVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..V..G.WSEf.......wDKSS...............IVDF.LAILRD.......VFAKEPPV................................................................
A0A6I8QX42_XENTR/21-141                ........................................................TIEELKDLNRTFP.......SF.IFS.ME..T.Y..................T...........F.....R.....DGS..Q.K...DLLN..LTGTVPM..K.......HQ............G...TT....Y.N...........IPICLWILDSHPF...........................APP..L..C..F..L.KPSGNM..............GIR...V.GR...HID.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VTGL.IREMAV.......KFEEELPL................................................................
A0A3Q7RE83_VULVU/21-141                ........................................................TVEELKNVNRFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..K....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A1E5V0J5_9POAL/43-165                .......................................................i-RNHLVALAEAFP.......SL.HPK.AA..L.F..................T...........H.....N.....DGR..A.A...HLLQ..ADGTIPI..H.......HA............G...AS....Y.N...........LPAVIWLPETYPR...........................SPP..L..V..F..L.SPTRDM..............VIK...P.HH..pLVD.R..S....GLV...aNA..P...........Y.L..R..S.WVF.........PSSN...............LVDL.VRSLSH.......LFGLDPPL................................................................
A0A2U1LP95_ARTAN/1-59                  ........................................................-------------.......-M.SPK.TA..V.F..................T...........H.....N.....DGR..S.V...NLLQ..SEGTIPM..V.......YQ............N...VT....Y.N...........IPVVIWLMETYPL...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------lvvcqvagrvw.....................................................
A0A1B0GS10_MOUSE/64-106                .......................................................r-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.------..............---...-.GK...HVD.A..N....GKI....YL..P...........Y.L..H..D.WKH.........PRSE...............LLEL.IQIMIV.......IFGEEPPV................................................................
A0A4Y7INC5_PAPSO/33-149                .......................................................i-RQHFLSLLNNFP.......SL.KPS.ID..T.F..................T...........Y.....D.....EGT..T.V...KLLV..ATGYFPV..S.......PN............-...--....-.-...........IHLAIWIHESYPF...........................VAP..F..V..L..L.SSASTS..............KTS...H.AH..pFVS.P..L....GEV....FI..P...........Y.L..H..L.WNH.........PQSN...............LLDL.ARSLVH.......IFTYQHP-f...............................................................
A0A1X0NHS1_9TRYP/72-158                ................................................nlkqtqpg-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...-S....Y.I...........LPIQIWLTHQYPI...........................EPP..L..I..F..L.LSTEQG.............cKVS...S.NH..rYVD.A..T....GRC....HI..P...........E.L..A..A.WQP.........GTST...............LSAV.IKELEY.......LLEK----egvspl..........................................................
A0A498N006_LABRO/128-248               ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPF...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
H3APP2_LATCH/21-141                    .......................................................t-VREIGNVIAQYK.......DL.KPV.TD..A.Y..................V...........F.....N.....DGS..S.R...ELMS..LNGTVPV..A.......YR............G...NT....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSTM..............MIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PHSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A3B1JD81_ASTMX/34-146                ...........................................vycderyyvsvlf-------------.......--.---.--..-.V..................V...........F.....N.....DGS..S.R...ELMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A5K4F9H6_SCHMA/21-141                .......................................................v-RRDVTCALKAFK.......EL.RPK.FE..E.F..................I...........K.....N.....DGT..S.R...RLVS..LDGTIPV..R.......YM............G...ST....Y.N...........IPIAIFLFEAYPH...........................EAP..V..V..Y..V.RPTNTM..............QIK...P.SD...FVD.S..D....GLV....QL..P...........Y.M..T..D.WKH.........PDAD...............LVEL.ISVLQA.......VFGETSPV................................................................
A0A3Q7XMW7_URSAR/23-143                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTVPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A4P9W483_9FUNG/7-114                 .......................................................v-LHEAESVLLQFS.......GL.APK.TD..T.Y..................T...........H.....E.....DGR..T.V...VLLC..LHGTIAI..T.......YR............A...VT....Y.N...........IPVAIWVPFTYPQ...........................HPP..I..C..H..V.TPTATM..............LIR...A.SK...HVD.L..S....GKI....YH..P...........Y.L..A..Y.WHM.........-RS-...............----.------.......--------evgrvwr.........................................................
A0A671G1Y9_RHIFE/423-543               .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..L.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A1R2CFS4_9CILI/25-143                ........................................................VYNEISRLLQIYS.......NL.SPK.A-..V.Q..................L...........S.....I.....NGS..V.F...FILE..LVGTIPV..L.......YQ............Q...KT....Y.N...........IPIKIQIPPGYPN...........................ISP..I..L..I..V.TPSPDM..............MIK...S.SE...YVQ.E..D....GKT....TL..D...........I.Q..R..K.WNN.........-RCQ...............TSHL.IEEAKK.......AFSDKMPV................................................................
G9NY91_HYPAI/25-147                    ........................................................TYGDVATVLARYP.......TL.TPR.TD..V.Y..................T...........F.....P.....NGA..S.S...LLVH..LTGTIPT..L.......FR............G...TT....Y.R...........FPVSIWVPHAYPR...........................EAP..L..A..Y..V.TPTETM..............MVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..A..G.WGDf.......wDKSS...............LNDF.LSVLSD.......VFAKEPPV................................................................
A0A093GCU2_DRYPU/10-129                ........................................................TIEELRNVNKTYP.......NF.TFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........MPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............IIGL.IKEMIA.......KFEEELPL................................................................
Q7Q6B6_ANOGA/22-142                    ........................................................TKKDVMNALRIYH.......GL.QHR.VE..E.Y..................V...........F.....N.....DGS..T.K...MLLN..LHGTIPV..K.......YK............G...NT....Y.N...........IPICIWLMDTHPK...........................NAP..I..C..Y..V.KPTPEM..............RIK...V.SA...YVD.F..N....GKI....YL..P...........Y.L..H..D.WNP.........KNAD...............LLDL.IQIMSV.......TFGEVPPV................................................................
W2S6U5_9EURO/28-151                    ........................................................TYSDLVSTLQKYP.......AI.AVKgTK..E.Y..................V...........Y.....D.....NGR..P.E...LLLH..LGGVLPV..S.......FR............G...TL....Y.H...........FPILIWIPYAYPY...........................DAP..M..I..Y..V.DPKDDI..............VVN...P.GQ...HVA.P..D....GRV....YH..S...........Y.L..A..H.WRDt.......wERSN...............VVDF.LSILSD.......VFAKEPPV................................................................
A0A1U8BD99_NELNU/33-152                .......................................................i-RQHLLALLQDFP.......TL.SPS.AD..T.F..................V...........H.....N.....DGT..S.V...YLLN..ARGSLRI..S.......RA............-...-T....L.L...........VPLIIWVPQDYPV...........................APP..I..I..F..L.LPTSDH..............PIL...S.NH..pFVH.L..S....GLT....TF..P...........Y.L..N..N.WNR.........SRSN...............LSDL.AHNLVQ.......LFAHHHPL................................................................
A0A4U5QF48_POPAL/37-158                .......................................................i-RQHLVSLTSTFP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..T.V...NLLQ..ADGTVPM..T.......FE............S...VT....Y.N...........IPVIIWLIESYPR...........................HPP..C..V..Y..V.NPTRDM..............VIK...R.SH..sFVN.P..S....GLV....AV..P...........Y.L..Q..N.WIY.........PSSN...............LVDL.ARELSM.......LFGRDPPL................................................................
A0A177V1Y4_9BASI/25-147                .......................................................v-YIDIDRVLIAFS.......SL.SPR.TE..V.Y..................T...........H.....D.....DGR..S.Q...LLLE..LTGTIPI..Q.......YK............G...NT....Y.H...........IPVSFWIPHGYPR...........................EPP..I..V..Y..V.TPTTTM..............LVR...K.GK...HVD.P..N....GRV....SV..D...........Y.L..D..V.WSRk.......pEACN...............LIDL.IHACRE.......IFSQQPPV................................................................
A0A5F9DEW6_RABIT/21-72                 ........................................................TVEELKNVNTFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...VS....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------dmnsk...........................................................
A0A2A3E0U5_APICC/22-142                ........................................................TKKHVMKVLNLYK.......GL.KYN.VE..P.F..................V...........F.....N.....DGS..R.K...ELFN..LQGTIPV..S.......YK............G...NY....Y.N...........IPICIWLMDTHPN...........................NAP..M..C..Y..V.KPTADM..............SIK...V.SM...FVD.H..N....GKI....YL..P...........Y.L..H..D.WLP.........HSSD...............LLSL.IQIMIV.......TFGEQPPV................................................................
A0A074YKE3_AURPU/26-149                .......................................................a-YSDSVAALSAYP.......SL.SPR.TD..V.Y..................T...........Y.....N.....TGQ..P.A...LLLR..LSGTLPV..N.......FR............G...TV....Y.R...........FPVTIWLPHAYPA...........................DPEgiM..V..F..V.IPGDGM..............AIR...P.GQ...HVS.V..D....GRV....YH..P...........Y.L..R..D.WSV........nQRPN...............IIDF.LRLLQD.......VFAREPPV................................................................
A0A1S3EA67_CICAR/40-161                .......................................................i-RQHLLTLITTFP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..T.V...NLLQ..ADGTIPM..T.......YQ............S...VT....Y.N...........IPVVIWLMESYPR...........................HPP..C..V..Y..V.NPTRDM..............IIK...R.PH..pHVN.P..S....GLV....SV..P...........Y.L..H..N.WIY.........PSSN...............LVDL.VLSLSL.......IFGRDPPL................................................................
A0A6J0P0K1_RAPSA/37-158                .......................................................i-RQHLLNLISSYP.......SL.EPK.TA..T.F..................I...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......YH............G...VT....Y.N...........IPVIIWLLESYPR...........................HPP..C..V..Y..V.NPTADM..............IIK...R.PH..aHVT.P..S....GLV....SL..P...........Y.L..Q..N.WVY.........PSSN...............LVDL.VSDLGA.......AFARDPPL................................................................
A0A6J5U1Y0_PRUAR/41-162                .......................................................i-RNHLVSLTTAYP.......SL.DPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..AEGTVPM..S.......FQ............G...VT....Y.N...........IPVIIWLMESYPR...........................QPP..V..V..Y..V.NPTRDM..............IIK...R.PH..aHVT.P..S....GLV....SI..P...........Y.L..H..N.WVY.........PSSN...............LVEL.AKNLSA.......VFGQDPPL................................................................
A0A383ZIC4_BALAS/21-141                .......................................................t-VRETVSVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...TT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGEEPPV................................................................
A0A2P5D9A9_TREOI/44-165                .......................................................i-RQHLVSLTTAYP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTVPM..S.......FQ............G...VT....Y.N...........IPVVVWLMETYPR...........................HPP..C..V..Y..V.NPTRDM..............IIK...R.PH..pHVN.P..S....GLV....SI..P...........Y.L..Q..N.WVY.........PSSN...............LVDL.VRTLSL.......VFGRDPPL................................................................
W9IHE0_FUSOX/25-147                    .......................................................a-YNDVAQALDRFP.......SL.SPR.TD..V.H..................T...........F.....S.....NGA..N.A...LLLH..LSGTLPV..N.......FR............G...TT....Y.R...........FPISIWVPHAYPR...........................EPP..M..I..Y..V.VPTETM..............MIR...P.GQ...HID.P..Q....GLV....YH..P...........Y.L..V..G.WAEf.......wDKSN...............LRDF.LNILTD.......IFAKEPPV................................................................
J9JJA5_ACYPI/22-142                    ........................................................TKKEIIKTLNYYH.......GL.ICN.FE..T.F..................L...........F.....S.....NRI..E.K...KLVN..LSGTVPV..T.......FK............G...TT....Y.H...........IPICIWLMDTHPN...........................NAP..I..C..Y..V.KPTLDM..............RIK...M.SM...YVD.H..N....GKI....YL..P...........Y.L..H..N.WTP.........TTSN...............LLDL.IGIMTA.......TFSETPPV................................................................
A0A6J0KE37_RAPSA/41-162                .......................................................i-RQHLLTLISSYS.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..S.A...ILLQ..ADGTIPM..P.......FQ............G...VS....Y.N...........IPVVVWLLESYPR...........................DPP..R..V..Y..V.NPTRDM..............IIK...R.PH..sNVS.P..S....GLV....SL..P...........Y.L..H..A.WVY.........PSSN...............LLDL.AAQLSS.......AFSRDPPL................................................................
A0A3L8SWZ1_CHLGU/21-141                .......................................................t-IQETASVITQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
A0A182G9Q0_AEDAL/17-137                ........................................................TKKDVSECLKQYK.......AL.SCR.YE..E.Y..................V...........F.....N.....DGT..V.K...QLIN..LQGTIPV..R.......YK............G...NT....Y.H...........IPICIWLLDTHPR...........................YAP..I..C..Y..V.KPTSDM..............HIK...V.SM...YVD.H..N....GKI....YL..P...........Y.L..H..E.WTP.........MQSD...............LLGL.IQVMIV.......TFGEYPPV................................................................
A0A7J6IJ73_COLFN/25-147                ........................................................TYNDVAQALSQYP.......SL.SPR.TD..V.H..................T...........F.....D.....TGI..S.A...LLLH..LTGTVPV..I.......FR............G...TT....Y.R...........FPISVWVPHAYPR...........................EAP..L..V..Y..V.TPTESM..............MVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..V..G.WSAf.......wDKST...............ILDF.LAILRD.......IFAKEPPV................................................................
G5A206_PHYSP/25-145                    ......................................................vr--GDVYNLLGQIP.......SL.QPN.CG..T.F..................A...........H.....N.....DGT..T.S...TLLN..LEGTIPI..F.......YR............G...SQ....Y.N...........IPVEFWVVETYPL...........................APP..V..C..F..V.RPTADM..............MVK...P.GH..pHVT.S..D....GYV....KI..P...........Y.T..S..D.WRP.........-DFT...............LLEL.VAHMCS.......IFGNMPPV................................................................
D8PKB0_SCHCM/28-150                    ........................................................VIQHVADALGRYA.......TL.HIK.SD..V.Y..................T...........Y.....D.....DGR..S.H...LLLC..VHGLLPV..T.......FR............G...AT....Y.N...........IPLSVWIPLDYGS...........................APP..L..V..Y..V.VPTTGM..............LVR...K.SR...DVD.P..S....GLV....EG..D...........Y.A..R..N.WMRk.......sEGCT...............LVGL.LESLQH.......QFGLEPPV................................................................
A0A6G1B1H0_CROCR/29-149                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GVS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
Q0CS33_ASPTN/33-155                    ........................................................TYSDVANVLAQYP.......SL.SPR.TE..V.Y..................T...........Y.....E.....NGF..S.A...LLLQ..LSGTVPV..S.......FR............G...TI....Y.K...........FPITLWVPNTYPR...........................DPP..L..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WTEa.......wERSS...............LVDL.LLILRE.......VFAKEPPV................................................................
A0A669R143_PHACC/22-142                .......................................................t-IQETNSVISQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NI....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFAEEPPV................................................................
A0A1V9Z0E3_9STRA/26-146                .......................................................v-RQDVETLLRQIP.......SL.APQ.SG..V.Y..................T...........H.....N.....NGT..T.S...TMLS..LTGTIPI..Y.......YN............G...NQ....Y.N...........IPVEIWMPEAYPF...........................AAP..T..C..Y..V.RPTADM..............MIK...S.GH..pHVD.Q..N....GLI....ML..P...........Y.S..T..H.WDS.........-DHS...............LAEL.IGYQCS.......VFGTQPPV................................................................
A0A665TWE7_ECHNA/21-141                .......................................................a-VEELQKIHRIFP.......GI.SPF.TG..T.Y..................T...........F.....S.....DGT..Q.K...DLLK..LIGNIPV..K.......YE............G...HS....Y.N...........FPIQLWLMDSFPF...........................TPP..I..C..L..V.RPTPSM..............VIR...E.GK...HVD.P..R....GRI....HL..P...........G.L..H..N.WDY.........PKSS...............VVGL.LNEMIA.......KFEEDPPL................................................................
A0A3L6RCI8_PANMI/29-152                .......................................................v-RKHVLAVLQEFP.......TL.SPS.VD..T.Y..................T...........S.....D.....DGA..S.T...VLLN..ARGLLAV..S.......PA............-...-L....P.P...........VLLTVWLPREYPY...........................RPP..L..V..Y..A.FPAAPS.............aSLV...P.DH..pFVD.H..R...tGRVh..rTL..P...........Y.L..E..D.WAV.........PRSS...............LAGL.VRSLVA.......ALRTCHP-l...............................................................
A0A1S3JUC1_LINUN/24-144                .......................................................a-KRDILQAFSNFK.......DL.RPN.VD..S.F..................V...........F.....N.....DGN..R.K...ELLC..LEGTIPV..T.......YR............G...TT....Y.N...........IPVCLWLLETHPY...........................NPP..M..V..Y..V.KPTATM..............QIK...P.GQ...HVD.A..N....GRV....YL..P...........Y.L..H..E.WRH.........PQSD...............LFGL.IQIMGI.......IFGENPPV................................................................
A0A6P6ESC1_OCTDE/21-141                ........................................................TVEELKNVNTFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NV....Y.N...........IPVRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIT...V.GK...HVD.V..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A0P1A980_PLAHL/976-1096              ......................................................vr--GDVYNLLGQIP.......SL.QPN.CG..T.Y..................T...........H.....N.....DGT..T.S...TLLN..LEGTIPI..F.......YR............N...NQ....Y.N...........IPVEFWIVETYPM...........................SPP..V..C..F..V.RPTIDM..............MVK...P.NH..pHVT.S..D....GYV....KI..P...........Y.T..S..D.WRQ.........-DFT...............LLEL.IAHICS.......IFGNMPPV................................................................
A0A4W2E5C7_BOBOX/21-127                .......................................................t-VRETVNVISLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.-...----..-------..-.......-R............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..R..F..V.KPTSSM..............TIK...T.AK...HVD.A..N....GKI....CL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A0D0AGP2_9AGAM/24-146                .......................................................v-FVDADAAIVRFA.......AL.RPK.TD..V.Y..................T...........Y.....D.....DGR..T.Q...LLLC..VHGLLPI..Q.......YR............G...SA....Y.N...........IPIAVWITKDYPR...........................APP..I..V..Y..V.VPTQDM..............LVR...P.SK...YVD.V..S....GRC....NI..E...........Y.S..Q..S.WERk.......sEACN...............LSAL.FEALQD.......HFSHSPPL................................................................
A0A6A6Z769_9PEZI/26-148                ........................................................TYSDVAETLSHYP.......SL.SPK.TE..V.Y..................T...........Y.....E.....NGA..S.A...LLLQ..LSGTLPV..T.......FR............G...AT....Y.A...........FPIQLWVPHRYPQ...........................EAP..M..V..Y..V.VPSQDM..............LVR...P.GQ...HVS.G..D....GRV....YH..P...........Y.L..A..Q.WGKy.......wDKST...............IFDF.LAVLRG.......VFTKEPPV................................................................
A0A5F9CE76_RABIT/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
H6BPL4_EXODN/26-148                    .......................................................a-YSDLAHVLARHP.......GL.APR.TD..V.Y..................T...........F.....E.....NGA..S.A...LLVH..FKGTIPV..T.......FR............G...NT....Y.R...........FPISLWIPYAYPY...........................EPP..I..C..Y..V.TPTVEM..............MIR...P.GQ...HVG.G..D....GKI....YH..P...........Y.L..A..Q.WREt.......wERSN...............IVDF.LSILSD.......VFAKEPPV................................................................
A0A6P7L0K5_BETSP/24-145                .......................................................t-LSDLQQVQSRFS.......DL.RLY.VN..F.Y..................C...........F.....P.....NKE..K.R...RLVY..LAGTIPV..R.......YE............G...LE....Y.N...........IPVCIWLHETHPV...........................SRP..R..C..C..V.CPSISM..............VIN...P.SC..pCVD.S..A....GNI....SL..S...........G.L..S..N.WTN.........GVST...............LSLL.ISEMRQ.......AFQKDTPL................................................................
A0A2Y9RDU0_TRIMA/1-47                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.-----M..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
R0FIL7_9BRAS/36-157                    .......................................................i-RQHLLNLVSSYT.......SL.DPK.TA..T.F..................T...........H.....N.....DGR..S.V...TLLQ..ADGTIPM..P.......FQ............G...VS....Y.N...........IPVVIWLLESYPH...........................SPP..C..V..Y..V.NPSRDM..............IIK...R.PH..sNVS.P..S....GLV....AL..P...........C.L..H..N.WVY.........PSSN...............LVDL.AAHLSA.......AFSRDPPL................................................................
A0A2K5I6D8_COLAP/12-132                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LAGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A0C2TR12_AMAMU/24-146                ........................................................VYADIDAALARFS.......TL.RPK.TD..V.Y..................T...........Y.....D.....DGR..T.Q...LLLC..VHGLLPI..T.......FK............R...AS....Y.N...........IPVALWITREYPK...........................DPP..I..A..Y..V.VPTNDM..............LVK...P.GR...CVD.V..S....GRC....SP..E...........Y.I..A..H.WGRk.......sEGCT...............LIAL.LEALQD.......QFSREPPL................................................................
A0A1G4IQB5_9SACH/31-148                ........................................................TFQDVSETLIGNR.......FL.RPR.TR..V.F..................T...........E.....T.....DGK..S.S...LLLC..LYGKVPA..A.......IA............-...--....-.-...........VPVHVWVPPEYPI...........................VAP..F..V..L..V.DLESLGe............nRLQ...V.SN...VLN.S..N....GKV....SL..R...........G.L..K..Y.WEP.........ETSR...............IATL.LQELVY.......LAQQD---ali.............................................................
A0A3Q1J2S4_ANATE/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
O76258_CAEEL/21-141                    .......................................................a-KKDIIGALSQFK.......DL.SPG.TD..T.F..................M...........F.....P.....DGK..R.R...TAFR..LKGTIPV..Y.......YK............G...AC....Y.N...........IPVTVYLWDTHPY...........................YAP..I..C..Y..V.NPTSTM..............VIK...E.SE...HVN.K..E....GKV....FL..P...........Y.L..N..E.WRF.........PGYD...............LSGL.LQVMAM.......VFQEKCPV................................................................
A0A3Q7X1B8_URSAR/23-143                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTVPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A1R3KY17_COCAP/41-162                .......................................................i-RQHLLSLNSHYP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......YQ............G...VT....Y.N...........IPIIIWLMESYPR...........................HPP..V..V..Y..V.NPTRDM..............IIK...R.PH..pHVT.P..S....GLV....SM..P...........Y.L..Q..N.WIY.........PSSN...............LVDL.VLNLSS.......AFSRDPPL................................................................
A0A1Z5KPY1_FISSO/26-147                ...........................................rdasallrssvga-------------.......HL.QPI.AA..A.H..................F...........E.....D.....DGT..E.A...TVLV..LQGTIAT..H.......YR............A...NT....Y.H...........ILVDMFLAPGYPR...........................RPP..I..C..F..V.RLAENM..............YFK...E.NH..mHMG.T..D....GKV....YL..P...........Y.L..H..E.WTS.........QTHN...............LIEL.VVAMSS.......VFSADPPV................................................................
K1VD15_TRIAC/23-131                    ....ilsevldilrkyrslavrtdafselatleatdislrlwpnitapaapwnapd-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........------------T...........................APP..M..A..F..V.VPTKDM..............GVR...K.GR...EVD.P..G....GRI....TV..-...........-.A..Q..E.WWQ.........-DRQ...............LQTF.INKMIE.......VFSRQPPV................................................................
H0X073_OTOGA/21-141                    .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGEEPPV................................................................
A0A5E4NG73_9HEMI/1-65                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------MDTHPN...........................NAP..I..C..Y..V.KPTLDM..............RIK...M.SM...YVD.H..N....GKI....YL..P...........Y.L..H..N.WTP.........TSSN...............LLDL.IGVMTV.......TFSETPPV................................................................
B4KZ07_DROMO/22-142                    ........................................................TRKDVVDVITAYR.......SL.TYN.LE..K.F..................V...........F.....N.....DGS..V.K...DLFA..LQGTIPV..V.......YK............N...NT....Y.Y...........IPICIWLMDTHPQ...........................NAP..M..C..F..V.KPTPTM..............QIK...V.SM...YVD.H..N....GKV....YL..P...........Y.L..H..D.WQP.........HSSD...............LLSL.IQVMIV.......TFGDHPPV................................................................
F7B2L2_CALJA/18-138                    ........................................................TVEELKNVNMFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...NLLN..FAGTIPV..I.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A673MLM2_9TELE/1-107                 .......................................................m-------------.......--.KVI.SA..T.Y..................T...........S.....S.....DSL..Q.K...DLLK..LVGNIAV..R.......YH............G...RS....Y.N...........LPILLWLLDSFPF...........................APP..I..C..F..L.RPTSSM..............VIR...E.GK...HVD.S..K....GRI....HL..P...........G.L..H..S.WDH.........PKSS...............VNGL.LAEMIA.......KFEEEPPL................................................................
A0A6P5AV40_BOSIN/1-102                 .....................................................mvq-------------.......--.---.--..-.-..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..I.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQDELPL................................................................
A0A0B7F4L8_THACB/23-145                ........................................................IYNDVDATLAAYP.......TL.RPK.ND..V.Y..................T...........F.....N.....DGR..A.Q...LLLC..VHGLIPI..T.......FR............Q...AT....Y.N...........IPIAIWLPLEYPR...........................LPP..L..V..Y..V.VPTSEM..............LVK...S.SK...NVD.P..S....GEC....TF..D...........Y.L..D..N.WRRk.......sEGCN...............LRAL.IEVMQE.......NFSREPPV................................................................
A0A0K8LAE5_9EURO/74-190                .......................................ifnleflvlmkvvhpaa-------------.......--.---.--..-.-..................-...........Y.....E.....TGF..S.A...LLLH..LTGTIPV..S.......FR............G...TV....Y.K...........FPIALWIPNTYPR...........................EPP..M..V..Y..V.TPTPDM..............AVR...V.GQ...HVT.L..E....GKV....YH..H...........Y.L..A..H.WAEa.......wDRSN...............LIDF.LMILRE.......VFAKEPPV................................................................
A0A1V6YVZ7_PENNA/32-154                ........................................................TYHDVANALSQYP.......SL.SPR.TD..V.Y..................T...........Y.....E.....TGF..S.A...LLLH..LVGTLPV..T.......FR............G...TT....Y.R...........FPIALWIPNTYPH...........................EPP..I..A..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GQV....YH..H...........Y.L..A..H.WAEa.......wDRST...............IVDF.LSILQD.......IFAKEPPV................................................................
A0A3N4K2V6_9PEZI/31-153                .......................................................t-YIDVATALFNTP.......SL.SPR.TE..V.Y..................T...........H.....E.....DGR..P.E...LLLH..LHGTIPV..L.......FR............G...AS....Y.N...........IPLTIWLPHTYPR...........................QPP..M..A..F..V.TPAKDM..............LIR...P.GN...HVD.P..S....GKC....YH..P...........Y.L..A..N.WVNy.......sDRSN...............VVDL.CDVLRG.......VFGREPPV................................................................
A0A3R7GBA4_9EURO/33-155                ........................................................TYYDVANVLAQYP.......SL.SPR.TD..V.Y..................T...........Y.....E.....TGF..S.A...LLLH..LTGTIPV..S.......FR............G...TV....Y.K...........FPIALWIPNTYPR...........................EPP..M..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wDRSN...............LVDF.LMILRE.......VFAKEPPV................................................................
A0A7N8YG63_9TELE/3-119                 ....................................................eeci--------HRLYS.......EM.KPS.TG..T.Y..................T...........F.....S.....DSS..Q.K...DLLK..IIGNIPV..K.......YE............G...RS....Y.N...........FPIQLWLMDSFPF...........................TPP..I..C..L..L.RPTPNM..............VIR...E.GK...HVD.G..R....GRI....YL..P...........G.L..H..N.WDY.........PKSS...............VVGL.LTEMIA.......KFEEDPPL................................................................
A0A6P6JS58_CARAU/24-145                ......................................................vl--DEIKDVSADFP.......HL.QLY.VD..C.Y..................L...........Y.....P.....NKD..K.K...RLVY..LGGTVPV..T.......YE............D...AT....Y.N...........IPVCIWIHETHPK...........................NPP..R..C..F..V.CPSPSM..............IIN...A.KS..sSVD.A..N....GRV....LL..H...........C.L..S..N.WKI.........GWSN...............LSIV.LEEMIA.......AFQRETPL................................................................
A0A1F8A0S3_9EURO/33-155                ........................................................TYYDVASVLAQYP.......SL.SPR.TE..V.Y..................T...........Y.....E.....NGF..S.A...LLLQ..LTGTVPV..T.......FR............G...TV....Y.K...........FPISLWVPNTYPR...........................EPP..I..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wERST...............LVDL.VSILRE.......VFAKEPPV................................................................
W5LXD4_LEPOC/23-143                    ........................................................TVREITNVISHYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTIPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LFGL.IQVMIV.......VFGEEPPV................................................................
A0A2T9Z6D2_9FUNG/27-149                ......................................................cn---QIQEVLVKYR......rYL.LLK.VD..E.Y..................I...........S.....E.....AGL..K.L...PLLK..FYGTVPV..V.......FR............N...SS....F.N...........IPVSIWFPRDFPE...........................KPP..Y..I..Y..V.QPTEQM..............VIR...E.SK...VVN.S..S....GRV....KT..D...........L.S..E..K.WETg.......tKNIR...............FISL.LEEIIG.......IFSIEPPV................................................................
A0A178Z701_9EURO/26-148                ........................................................TYSDLAHVLARNP.......SL.APR.TD..V.Y..................T...........Y.....E.....NGA..P.A...LLLQ..FKGTIPV..N.......FR............G...NT....Y.R...........FPIVLWIPHAYPY...........................EAP..M..C..Y..V.TPTDEM..............VIR...P.GQ...HVG.G..D....GRI....YH..P...........Y.L..A..H.WREh.......wERSN...............ILDF.MSILSD.......IFAKEPPV................................................................
A0A674DPI4_SALTR/21-141                .......................................................a-IEELQKVHQIHP.......AM.KPV.AG..T.Y..................T...........F.....S.....DGT..Q.K...DLLK..LIGNIPV..K.......YE............G...RS....Y.N...........LPILLWLMDSFPF...........................TPP..I..C..L..L.RPTTNM..............VIR...E.GK...HVD.A..R....GRI....YL..P...........S.L..H..N.WDH.........PKSS...............VVGL.LAEMIS.......QFEEEPPL................................................................
A0A3N4HRU4_ASCIM/1-93                  ......................................................tt------HLLSTVP.......TL.SPR.TA..V.Y..................T...........H.....T.....TGH..S.E...LLLQ..LSGTLPT..P.......FR............G...QT....Y.N...........FPITLWIPRTYPR...........................EPP..H..V..Y..V.TPPKEM..............VVA...P.GN...HVD.T..G....GRC....YH..P...........Y.L..A..G.W--.........----...............----.------.......--------................................................................
A0A6I9Y497_9SAUR/21-141                .......................................................a-VQETVNVTGQYK.......DL.KPV.MD..N.Y..................V...........F.....N.....DGS..S.R...ELMS..LTGTIPV..N.......YR............G...HI....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GRI....YL..P...........Y.L..H..E.WKH.........PQSD...............LIGL.IQVMIV.......VFGDEPPV................................................................
A0A2T3B3V4_AMORE/28-150                ........................................................TYNDVAQALSHYS.......SL.SPR.TD..V.Y..................T...........Y.....E.....NGA..S.A...LLLH..LSGTLPV..A.......FR............G...TT....Y.R...........FPIALWIPHGYPR...........................EAP..L..A..Y..V.TPTEGM..............MVR...P.GQ...HVD.P..Q....GMI....YH..P...........Y.L..V..G.WSEf.......wDKSN...............IVDF.LAILRD.......IFAKEPPV................................................................
A0A7N8Y4E5_9TELE/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A2K5ZAD9_MANLE/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A5J5MGA1_MUNRE/61-121                ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-----------PY...........................NPP..I..C..F..V.KPTSSM..............TIK...A.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PESD...............LLGL.VQIMIV.......VFGDEPPV................................................................
A0A4S8LPJ3_DENBC/21-143                ........................................................VYADVDNTLQRFP.......TL.RPK.SD..V.Y..................T...........W.....D.....DGR..T.Q...LLLC..VHGVLPI..Q.......FR............N...AS....Y.H...........IPIAVWLTRSYPS...........................EPP..I..P..Y..V.VPTHDM..............LIK...A.GP...HLD.L..S....GRC....SI..D...........Y.L..A..Q.WQRk.......sESCS...............LLAL.LEAMQA.......HFSRDPPV................................................................
A0A6P3IR03_BISBI/1-47                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.-----M..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQDELPL................................................................
A0A671RF73_9TELE/21-141                .......................................................a-IEELNKVPRVHP.......DM.KVI.SA..T.Y..................T...........S.....S.....DSL..Q.K...DLLK..LVGNIAV..R.......YH............G...CS....Y.N...........LPILLWLLDSFPF...........................TPP..I..C..F..L.RPTSSM..............VIR...E.GK...HVD.S..K....GRI....HL..P...........G.L..H..S.WDH.........PKSS...............VNGL.LAEMIV.......KFEEEPPL................................................................
A0A2K5ZMR4_MANLE/1-103                 ........................................................-------------.......--.---.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A2K6DP04_MACNE/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A3Q1CD33_AMPOC/24-145                .......................................................t-LSDLQSVRARFS.......DL.RLY.VD..F.Y..................C...........F.....P.....NKE..K.K...KLVY..LAGTLPV..Y.......YE............G...AE....Y.N...........IPVCIWLHETHPV...........................SRP..R..C..Y..V.CPSVAM..............VIN...P.SC..pYVD.A..S....GNI....SV..D...........A.L..N..K.WSQ.........GMSD...............LSQL.VSEIRR.......AFQKDTPL................................................................
A0A1Y2V0U0_9PEZI/25-147                ........................................................TYNDVAQALSQYP.......SL.SPR.TD..V.H..................T...........F.....D.....NGV..S.A...LLLH..LSGTIPV..I.......FR............G...TT....Y.R...........FPISIWIPHAYPR...........................EAP..L..G..Y..V.TPTENM..............MVR...P.GQ...HVD.P..Q....GRI....YH..P...........Y.L..V..G.WAEf.......wDKSS...............LLDF.LAILRD.......IFAKEPPV................................................................
A0A674KHA9_TERCA/21-141                ........................................................TVQETTSVITQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LIGL.IQIMIV.......VFGEEPPV................................................................
A0A5M6BYK4_9TREE/24-146                ......................................................ll--SEVMQILAERR.......TL.AVK.TD..A.F..................T...........F.....D.....SGQ..T.A...LLLL..LHGTLPI..N.......YK............G...AT....Y.H...........IPLHVWVPHEYPR...........................SPP..L..A..F..V.VPTKEM..............GVR...K.GR...EVE.P..S....GRV....RA..E...........V.V..E..Q.WWRs.......wENKS...............VEIL.LRQLTA.......VFSAAPPV................................................................
A0A4U5R6X0_POPAL/33-152                .......................................................i-RKHLLSLIQDYP.......TF.TIS.TN..T.F..................F...........H.....D.....DGT..T.V...NLLC..ATGHLHL..A.......NH............-...-T....P.S...........IPLTIWIHENYPC...........................MPP..M..V..Y..V.LSDSTS..............PIH...Q.DH..pFVH.S..S....GAT....SS..P...........Y.L..Q..T.WAF.........PRCH...............LTEL.VHNLVK.......IFSRDHP-f...............................................................
A0A6I9W424_9HYME/25-145                ........................................................TRKHVISVLNLYK.......GL.VYK.IE..P.F..................V...........F.....N.....DGS..R.K...ELLN..LQGTIPV..V.......YK............G...SC....Y.N...........IPICIWLMDTHPN...........................NAP..M..C..Y..V.KPTVDM..............HIK...V.SM...FVD.H..N....GKI....YL..P...........Y.L..H..D.WVP.........HNSD...............LLAL.IQVMIV.......TFGEQPPV................................................................
A0A446UJL9_TRITD/43-165                .......................................................i-RNHLVALADAFP.......SL.HPK.AA..L.F..................T...........H.....N.....DGR..A.A...HLLQ..ADGTVPI..H.......HA............G...AT....Y.N...........LPAVIWLPETYPR...........................SPP..L..V..F..L.SPTRDM..............LIK...P.HH..pLVD.R..S....GLV...aNA..P...........Y.L..R..S.WVF.........PSSN...............LLDL.VRSLSH.......LFGLDPPL................................................................
A0A6P4XUM5_BRABE/232-353               ......................................................tq--LDVRNAVTNFK.......DL.KVH.VD..V.F..................S...........T.....P.....GAS..K.R...ELLC..LKGTVPV..I.......YK............E...ST....Y.N...........IPLKVWLFEDHPN...........................AAP..V..C..Y..I.VPTANM..............RIN...D.RC..kHVN.A..N....GKV....QL..P...........Y.L..D..D.WKD.........ANSD...............LFSL.IQVMRI.......VFGEEPPV................................................................
A0A6J2AG84_ACIJB/4-105                 .....................................................sge-------------.......--.---.--..-.-..................M...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YH............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GVS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A232EJM5_9HYME/25-172                ........................................................TRKDVIRVLNHYR.......SL.HWK.IE..P.F..................V...........F.....N.....DGT..R.K...ELIN..LQGTIPV..N.......FK............G...NT....Y.H...........IPICIWVMDTHPN...........................NAP..M..C..Y..V.TPTPDM..............NIK...V.GN...FVD.H..N....GKI....YL..P...........Y.L..H..E.WIP.........VSLSgskyfvv.clhlfnlL---.------.......--------nvycfylqhksdlhsliqvmiiifgehppv..................................
A0A024G5B4_9STRA/19-139                .......................................................v-RNDVFDVLNQIT.......SL.LPA.SG..I.F..................T...........Y.....N.....DGS..S.G...NHLF..LAGTIPI..Y.......FR............N...DR....Y.N...........IPVEIWIVETYPM...........................APP..V..C..F..V.RPTAEM..............MIR...P.RH..pHVS.K..E....GFI....VV..P...........Y.L..T..D.WQE.........-NNT...............LVEL.VAQLSS.......IFGGIPPV................................................................
A0A093HNL6_STRCA/10-129                ........................................................TIEELKNVNKTYP.......NF.VFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPICLWIMDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..R....GRI....YL..P...........Y.L..Q..S.WSH.........PKST...............VIGL.IKEMIA.......KFEEELPL................................................................
A0A5A7SSD8_CUCME/44-165                .......................................................i-RQHLVALTTAFP.......SL.VPR.TA..S.F..................T...........H.....N.....DGR..S.V...NLLQ..SDGTVPM..S.......FQ............G...VT....Y.N...........IPVVIWLMESYPR...........................HPP..C..V..Y..V.NPTRDM..............IIK...R.PH..pHVN.P..S....GMV....SI..P...........Y.L..Q..N.WIY.........PSSN...............LVEL.VRNLSV.......MFGRDPPL................................................................
A0A091FSA7_9AVES/8-128                 .......................................................t-IQETTSVITQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
A0A1L9RND3_ASPWE/33-155                ........................................................TYYDVASALAQYP.......SL.SPR.TD..V.Y..................T...........F.....E.....TGF..S.A...LLLH..ITGTLPV..S.......FR............G...TI....Y.K...........FPIALWIPSTYPR...........................EPP..I..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wDRST...............IVDF.LYILRE.......VFAKEPPV................................................................
A0A398ABS0_BRACM/27-144                .........................dtmrswglahahlddvlahiretlycfpwmk-------------.......--.---.--..-.-..................-...........-.....-.....SDP..V.A...NLLN..LTGDVEY..I.......YK............G...NS....F.K...........AFITIYLPESYPK...........................DPP..Q..A..W..V.VCEDGI.............tGIN...H.KQ..mHVA.A..N....GSV....SI..P...........Y.L..W..D.WDE.........----...............----.------.......--------gviedhnrlrd.....................................................
T0MIV5_CAMFR/246-347                   .....................................................edr-------------.......--.---.--..-.-..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
F1QGE6_DANRE/22-142                    ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A5N5WX30_9EURO/33-155                ........................................................TYYDVALALGQYP.......SL.SPR.TE..V.Y..................T...........Y.....E.....NGF..S.A...LLLQ..LVGTVPV..T.......FR............G...TV....Y.K...........FPISLWVPNTYPR...........................EPP..I..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wERST...............LVDL.LSILRE.......VFAKEPPV................................................................
A0A3P8Z5M4_ESOLU/42-120                ......................................................sy-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............G...NI....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A4U1FR35_MONMO/63-103                ..................................................hhsrtp----------VFS.......NL.RYS.VD..T.Y..................V...........F.....K.....DSS..Q.K...NLLN..FTGTIPV..M.......YQ............-...--....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------a...............................................................
A0A017S2A7_9EURO/33-155                ........................................................TYYDVANTLAQYP.......SL.SPR.TD..V.Y..................T...........Y.....E.....TGF..S.T...LLLL..IAGTIPV..P.......FR............G...TL....Y.K...........FPVALWIPTAYPR...........................EPP..I..V..Y..V.TPTNDM..............VVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WLEa.......wDRST...............IADL.LGILRD.......VFATEPPV................................................................
A0A3P9Q3Y5_POERE/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSTM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A6J2VF15_CHACN/24-145                .......................................................v-LDDIRKVTGVYP.......DL.HLY.VD..F.Y..................Y...........Y.....R.....NND..R.K...KLVN..LGGTIAV..C.......YE............G...HT....Y.N...........IPVCLWIHETHPH...........................SPP..R..C..Y..V.RPSASM..............IIN...T.KS..sCVD.A..S....GQV....LL..H...........C.L..T..N.WKI.........GWSN...............LLIV.LEEMRA.......AFQRETPL................................................................
A0A226MTH4_CALSU/21-141                .......................................................t-IQETNSVISQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NI....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFAEEPPV................................................................
A0A1S3KKT3_SALSA/11-116                .................................................ntedtvk-------------.......--.---.--..-.-..................A...........F.....S.....DGT..Q.K...DLLK..LIGNIPV..K.......YE............G...RS....Y.N...........LPILLWLMDSFPF...........................TPP..I..C..L..L.RPTTNM..............VIR...E.GK...HVD.A..R....GRI....YL..P...........S.L..H..N.WDH.........PKSS...............VVGL.LAEMIS.......QFEEEPPL................................................................
A0A2I4EGI7_JUGRE/44-165                .......................................................i-RQHLLSLSSSCP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..S.I...HLLQ..AEGTVPM..S.......FQ............G...LT....Y.N...........IPVVLWLMESYPR...........................HPP..C..V..Y..V.NPTRDM..............VIK...R.PH..pFVN.P..S....GVV....SV..P...........Y.L..Q..N.WVY.........PSSN...............LVDL.VRSLSL.......YFGRDPPL................................................................
A0A2I3GC93_NOMLE/36-120                ....................................................kysm-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......TY............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIC.......QV------lrgtspv.........................................................
A0A3Q1GUL1_9TELE/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
G3PB52_GASAC/21-141                    ......................................................ai--DELQKIYRIHP.......GI.VPS.AG..T.Y..................T...........F.....S.....DHT..Q.K...DLVR..LLGNIPV..Q.......YG............G...RS....Y.N...........FPIELWLMDSFPF...........................TPP..I..C..L..L.RPTSNM..............FIR...E.GK...HVD.G..G....GRI....HL..P...........E.L..S..N.WDY.........PKSS...............VVSL.LAEMIV.......KFEEHPPL................................................................
A0A4P9Z856_9ASCO/26-160                .......................................................a-YHHIHRFLTRYLp.....aGF.KIR.TA..V.H..................T...........S.....E.....TGT..T.Q...LLIC..LTGIIKS..L.......ME............-...--....-.P...........VSVSIWIPHNYPFaddaq................rpgdpnGIP..I..V..Y..V.LAPPGT..............SIR...L.GN...NID.A..Q....GKV....YH..P...........Y.L..S..Q.WYS.........----...............----.------.......--------gmvpggaadeflltrlmevlamtisql.....................................
A0A444C159_ENSVE/33-153                .......................................................i-RDHLLSLFDDFR.......TL.SPG.SD..A.F..................T...........H.....D.....DGT..I.V...HLLH..ANGVLPV..S.......SS............-...-L....P.P...........VLLKIWLHQAYPF...........................VAP..I..V..Y..V.FPATHE.............gMVV...H.DH..pFIA.P..S....GAA....VL..P...........Y.L..Q..A.WQY.........PNSN...............LTDL.ARNLVK.......VFGICHP-y...............................................................
A0A6J3MD14_9PEZI/25-147                .......................................................a-YTDIARTLSVHT.......SL.LPR.TD..A.Y..................T...........Y.....E.....SGA..P.A...LLLN..LDGTIPA..N.......FR............G...TT....Y.R...........FPIKLWVPQAYPQ...........................EPP..M..V..Y..V.HPSKEM..............LIR...P.GQ...HVG.I..D....GRI....YH..P...........Y.L..R..D.WASa.......wDRAN...............IVSF.LEILQQ.......VFAKETPV................................................................
A0A317SLK7_9PEZI/31-153                .......................................................a-YNDVATALFNTP.......SL.SPR.TE..V.Y..................T...........H.....E.....DGR..P.E...LLLH..LHGTIPV..L.......FR............G...AT....Y.N...........IPLTIWLPHTYPR...........................QPP..M..A..F..V.TPAKDM..............LIR...P.GN...HVD.P..S....GRC....YH..P...........Y.L..A..N.WINy.......sDRSN...............IVDL.CDVLRG.......VFGREPPV................................................................
A0A6D2HNR6_9BRAS/37-158                .......................................................i-RQHLLNLISAYP.......SL.EPK.TA..S.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......FH............G...VT....Y.N...........IPVIIWLLESYPR...........................HPP..C..V..Y..V.NPTADM..............IIK...R.PH..aHVT.P..S....GLV....SL..P...........Y.L..Q..N.WVF.........PSSN...............LVDL.VSDLSA.......AFALDPPL................................................................
A0A199W4Z4_ANACO/37-151                .......................................................i-RHHLLSLSDIFP.......AF.RAA.LS..P.F..................V...........H.....N.....DGR..S.A...VLLH..VHGPIPT..-.......--............-...--....-.Y...........IPISVWLVEAYPY...........................VPP..L..V..Y..L.SPPSGT..............AVA...D.KH..pFVD.P..S....GTV....FS..H...........Y.N..L..S.WTF.........PSSN...............LVDL.VRDLSV.......LFAVHPPL................................................................
A0A3Q7PKM2_CALUR/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YK............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
M0SI59_MUSAM/38-162                    .......................................................i-RQHLVALAEAYP.......SL.RPR.AA..T.F..................T...........H.....D.....DGR..S.A...HLLQ..AEGTLPI..V.......YR............G...AA....Y.N...........LPSAVWLLEPYPR...........................RPP..A..V..F..L.TPTRDM..............LVK...P.GH..pLVE.P..S....GLVr.aaAV..P...........Y.L..A..T.WVF.........PASN...............LVDL.VRSLSH.......LFGLDPPL................................................................
A0A2H1A1Q6_CANAR/26-163                .......................................................a-YSHLYHFLSAYLp.....qGF.KVR.TA..V.F..................T...........S.....A.....SGQ..A.Q...LLIN..LYGNLDC..G.......--............-...-T....C.L...........VPLNIWIPLNYPFrdenv................sslepnGVP..M..V..F..V.VPDTGL..............VIR...P.NN...NVD.S..S....GRF....YH..P...........F.M..S..S.WHEn......ytPTSQtk..........efsLLSL.MACLRA.......TFEQNSPL................................................................
A0A6P5BKE1_BOSIN/30-80                 ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..I.......YQ............G...VS....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------dins............................................................
A0A5N6F542_9EURO/33-155                ........................................................TYYDVASVLAQYP.......SL.SPR.TE..V.Y..................T...........Y.....E.....NGF..S.A...LLLQ..LTGTVPV..T.......FR............G...TV....Y.K...........FPISLWIPNTYPR...........................EPP..I..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wERST...............LVDL.VSILRE.......VFAKEPPV................................................................
A0A2K5V1D3_MACFA/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A1V6SC06_9EURO/32-154                ........................................................TYHDVANALAQYP.......SL.SPR.TD..V.Y..................T...........Y.....E.....TGF..S.A...LLLH..LVGTLPV..T.......FR............G...TT....Y.R...........FPIALWIPNTYPR...........................EPP..I..A..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GQV....YH..H...........Y.L..A..H.WAEa.......wDRST...............IADL.LSILQD.......IFAKEPPV................................................................
UEVLD_MOUSE/21-141                     ........................................................TVEELKNVSVSFP.......HF.RYS.VD..T.Y..................V...........F.....K.....DTS..Q.K...DLLN..FTGTIPV..M.......YQ............G...KT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..K....GRI....YL..P...........Y.L..Q..N.WSH.........PKSA...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A6J3ATP7_VICPA/9-129                 .......................................................t-VRETINVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A2L2TP33_9HYPO/25-147                .......................................................a-YSDVAQALDRFS.......SL.SPR.TD..V.H..................T...........F.....S.....NGA..N.A...LLLH..LSGTLPV..N.......FR............G...TT....Y.R...........FPLSIWVPHAYPR...........................EPP..M..I..Y..V.VPTETM..............MIR...P.GQ...HID.P..Q....GFV....YH..P...........Y.L..V..G.WAEf.......wDKSN...............LRDF.LNILTD.......VFAKEPPV................................................................
A0A0F4YI01_TALEM/33-164                ........................................................TYHDVVRALAQYP.......SL.GPR.TD..V.H..................Iesdr..dvrpaF.....E.....NGT..S.A...LLLH..LVGTLPV..S.......FR............G...TV....Y.H...........FPIDVWIPNIYPL...........................APP..I..V..Y..V.TPTAEM..............VVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wDRSS...............IVDL.LTILRE.......VFSKEPPV................................................................
A0A1U8MV58_GOSHI/34-155                .......................................................i-LRHLLSLLQEFP.......GF.KPS.TG..R.F..................M...........H.....N.....DGT..E.V...NLLR..ATGCVHV..A.......NS............-...TT....P.T...........IPLVIWLHENYPQ...........................KAP..L..V..F..V.SLHPMT..............PIH...R.HH..pFVDnT..T....GAT....SP..P...........Y.I..L..T.WKY.........PPCN...............LSEL.LRNLVQ.......LFSIDHP-f...............................................................
A0A364KMA8_9EURO/400-522               ........................................................TYHDVARALAQYP.......SF.GPR.TD..V.Y..................T...........Y.....E.....NGT..P.S...LLLH..LVGTLPV..S.......FR............G...NS....Y.N...........IPIDTWIPSTYPL...........................EAP..I..V..Y..V.TPTPDM..............VVR...S.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WHEa.......wDRSS...............IVEL.FGVLRD.......IFSKEPPV................................................................
A0A6P4YC35_BRABE/9-121                 .......................................................i-HEEVSRVLSDYP.......GL.RAV.QE..S.V..................S...........As..gkR.....RKR..R.Q...VAIS..LEGHLPT..M.......QG............G...MV....C.D...........IPVLVRLAPDHPR...........................SPP..E..C..F..V.EGRNFG..............ELE...-.--...---.-..-....-RV....HI..P...........Y.L..S..N.WQH.........PYSS...............LCEL.LDNLTF.......--------slhshg..........................................................
A0A286X7I2_CAVPO/1-89                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...--MN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
F4P9F9_BATDJ/1-120                     .......................................................m---DVEAVLKDHP.......GL.GPK.TD..L.Y..................T...........Q.....N.....DGR..Q.L...VLLC..ISGTIQI..N.......FS............G...SV....Y.N...........IPIALWLPSTYPS...........................QPP..F..A..H..V.LPTPTM..............VIK...P.SK...HVD.I..S....GRV....YH..P...........F.L..A..Y.WHL........rPDST...............LQQF.LKVLQE.......IFSAESPV................................................................
A0A2P6NWA4_9EUKA/27-148                .......................................................i-KSDIYNLTRNAN.......NL.RPS.QD..T.F..................V...........S.....D.....DGQ..S.Y...LLVL..IGGTIPI..R.......YE............G...AT....Y.N...........IPVDMWIPKNYPQ...........................GPP..L..C..F..V.VGSRDL..............LIK...K.EH..hSVD.P..N....GRC....HV..S...........Y.T..N..Q.WRS.........DTCD...............LLGL.MYSLTT.......AFSKDPPL................................................................
A0A2U4CDT0_TURTR/34-154                ........................................................TMEELKNVNTFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...NLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
D8T0J2_SELML/38-159                    .......................................................i-RQHLVNVIQHFP.......GL.QAR.TA..G.F..................T...........H.....N.....DGR..Q.A...NLLQ..ADGTIPM..Y.......YQ............D...VK....Y.N...........IPVTIWLTEPYPR...........................KPP..L..V..Y..V.SPTRDM..............IIK...P.RH..rLVD.A..S....GMV....SV..P...........Y.L..Q..Q.WVF.........PRSN...............LVEL.VQNLSL.......HFGHDPPL................................................................
A0A0L0SU60_ALLM3/26-146                ........................................................VYNDAAMTLAAYP.......NL.LPK.LD..Q.F..................T...........H.....V.....DGK..V.S...HILC..LYGTIPV..G.......YK............G...ST....Y.N...........IPIELWLPEMYPV...........................VAP..Y..A..F..V.KPTATM..............LIN...P.SK...DVD.A..N....GKV....FH..A...........Y.L..H..Y.WDY.........RSSN...............LVNA.VGVLQQ.......AFAVDPPV................................................................
A0A672KPX2_SINGR/10-54                 ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTVPV..S.......YR............G...--....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------................................................................
A0A6I9QZH3_ELAGV/32-151                .......................................................i-REHLLSLLKDIP.......TL.SPS.TG..T.F..................I...........H.....D.....DGT..A.A...HLLY..AHGILPI..S.......PS............-...-M....Q.P...........ILLRIWLHQCYPF...........................KPP..I..V..Y..I.FATQNT..............SIL...H.GH..pFVD.S..S....GAT....TS..P...........Y.L..K..S.WQY.........PRSN...............LSDL.AHDLIK.......IFHLCPP-y...............................................................
B7QIP7_IXOSC/22-142                    .......................................................a-KKDVSNALQHYR.......NL.SPM.SS..Q.F..................V...........F.....N.....DGT..K.K...ELFC..LDGTIPV..S.......YK............G...NV....Y.N...........IPVCVWLLDTHPY...........................NSP..M..C..Y..V.KPTAYM..............QIK...V.SR...HVD.Q..T....GRV....FL..P...........Y.L..H..E.WNP.........NSSD...............LLGL.IQVMII.......VFGETPPV................................................................
A0A6D2JZX9_9BRAS/46-158                .......................................................i-MRHLVDLVSSDV.......LL.QYK.IE..-.P..................V...........E.....H.....NGS..S.V...NLLQ..AYGSIPS..S.......V-............-...--....-.-...........--VTICFPQDYPH...........................RCP..R..V..R..V.NPRDDA..............VFS...D.TS...CVD.S.sS....GAV....SH..A...........Y.L..G..S.WKC.........HESN...............LASL.VEELSR.......EFTSHPPL................................................................
A0A3D8R0B7_9EURO/33-155                ........................................................TYYDVANVLAKFP.......ML.TPE.TA..V.Y..................T...........Y.....E.....NGF..S.A...LLLQ..LSGTLPV..T.......FR............G...TV....Y.K...........FPIALWIPNTYPR...........................EPP..I..V..Y..V.KPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAGa.......wERAS...............LLDL.LSILQD.......VFAKEPPV................................................................
ELC_ARATH/37-158                       .......................................................i-RQHLLNLISSYP.......SL.EPK.TA..S.F..................M...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......FH............G...VT....Y.N...........IPVIIWLLESYPR...........................HPP..C..V..Y..V.NPTADM..............IIK...R.PH..aHVT.P..S....GLV....SL..P...........Y.L..Q..N.WVY.........PSSN...............LVDL.VSDLSA.......AFARDPPL................................................................
A0A1S3BEQ5_CUCME/44-165                .......................................................i-RQHLVALTTAFP.......SL.VPR.TA..S.F..................T...........H.....N.....DGR..S.V...NLLQ..SDGTVPM..S.......FQ............G...VT....Y.N...........IPVVIWLMESYPR...........................HPP..C..V..Y..V.NPTRDM..............IIK...R.PH..pHVN.P..S....GMV....SI..P...........Y.L..Q..N.WIY.........PSSN...............LVEL.VRNLSV.......MFGRDPPL................................................................
A0A195CCW6_9HYME/22-142                ........................................................TKAHVISVLNTYQ.......GL.VYK.IE..P.F..................V...........F.....N.....DGS..R.K...ELLN..LQGTIPV..V.......FK............G...SY....Y.N...........IPICIWLMDTHPN...........................NAP..M..C..Y..V.KPTADM..............HIK...V.SM...FVD.H..N....GKI....YL..P...........Y.L..H..D.WVP.........HNSD...............LLAL.IQVMIV.......TFGEQPPV................................................................
R4FP34_RHOPR/7-127                     ......................................................as--RDIIKALDNYK.......NL.SWK.YD..R.F..................V...........F.....N.....DGR..F.K...DLVN..LEGTIPI..S.......YK............G...NP....Y.N...........IPVCIWLMDTHPN...........................NAP..M..C..F..V.KPTPDM..............QIK...V.SM...FVD.H..N....GKI....YL..P...........Y.L..H..D.WNP.........ASSD...............LSGL.IMVMIC.......AFGEHPPV................................................................
A0A6P6MEQ4_CARAU/21-141                .......................................................a-IEELNKVSRVHP.......DM.KVI.SA..T.Y..................T...........S.....S.....DSL..Q.K...ELLK..LVGNIPV..C.......YH............G...RS....Y.N...........LPILLWLLDSFPL...........................APP..I..C..F..L.RPTSSM..............VIR...E.GK...HVD.S..K....GRI....HL..P...........G.L..H..N.WDH.........PKSS...............VNGL.LAEMIA.......KFEEEPPL................................................................
A0A6A4LJ31_9ERIC/33-152                .......................................................i-RSHLFSLLQNFP.......FF.RPS.MG..A.F..................I...........H.....N.....DGA..T.A...NLLN..ATGDLQV..S.......RS............-...-T....P.P...........VPLTIWLHENYPH...........................VAP..I..V..L..V.SSNSRY..............PIQ...R.DN..pFVD.P..S....GAT....TS..P...........Y.L..Q..S.WFH.........PKSN...............LFDL.VHNLVK.......IFSHNHPL................................................................
A0A6P7H453_DIAVI/20-140                .......................................................a-YREIINITTQYR.......GL.HPE.QS..V.Y..................T...........F.....N.....DGT..R.M...DLIN..LTGTIPV..R.......YK............G...NI....Y.N...........IPICIWLIDTHPE...........................NAP..I..C..Y..V.KPTSDM..............SIK...V.SM...FVD.Q..N....GKV....YL..P...........Y.L..H..D.WVP.........NESD...............LLGL.IQVMIV.......TFGEQPPV................................................................
A0A176VQB4_MARPO/39-160                .......................................................i-RQHLLTLLQDFP.......GL.QVK.TA..N.F..................T...........H.....N.....DGR..T.V...NLLQ..ADGTIPM..Y.......FQ............D...VK....Y.N...........IPIVLWLLEAYPR...........................NCP..L..V..Y..V.TPTRDM..............IIK...P.RH..tYVD.A..S....GMV....NI..P...........Y.L..Q..Q.WVY.........PRSN...............LVEL.IQSTSL.......LFGQDPPL................................................................
A0A665TRX0_ECHNA/22-142                ........................................................TVREITNVITQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..T.......YR............G...NV....Y.N...........IPVCLWLLDSYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A162IJI4_9HYPO/56-171                ............................................vhfqpstsrpnn-------------.......--.---.-A..Y.V..................A...........F.....P.....NGS..S.A...LLLH..LTGTIPV..N.......FR............G...SI....Y.R...........FPISIWLPHAYPR...........................EPP..L..V..Y..V.TPAENM..............IVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..V..G.WAQf.......wDKSN...............IQDF.LSVLAD.......IFAKEPPV................................................................
A0A0L0N0E3_TOLOC/25-147                ........................................................TYSDVARALSRFS.......TL.APR.TD..V.H..................T...........F.....P.....DGT..S.A...LLLH..ISGTLPV..V.......FR............G...ST....Y.R...........FPLSIWVPHAYPR...........................EPP..L..V..Y..A.TPTETM..............MVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..V..R.WSEf.......wDKST...............LEDF.LNVLSD.......VFAKEPP-g...............................................................
A0A2K6KQG4_RHIBE/69-189                ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSYPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
W1P3D6_AMBTC/35-156                    .......................................................i-RDHLISLFQNFP.......TF.SPD.TE..Q.F..................T...........H.....D.....DGH..T.S...FLLN..AKGTLPI..T.......SS............L...RN....L.S...........FSITIWILETYPL...........................FSP..L..V..Y..L.SLDPGV..............IIR...S.HH..pLVD.P..S....GFV....ST..Y...........Y.L..L..N.WAY.........PSSN...............LLEL.VRNLRH.......VLNIDPPI................................................................
K1RAV3_CRAGI/33-153                    ......................................................ar--RDVTNAMTQFK.......DL.RPS.HD..S.F..................I...........F.....N.....DGN..R.K...ELLN..LDGTIPV..T.......YK............G...SI....Y.N...........IPIGIWILDTHPY...........................NPP..M..V..F..V.KPTSAM..............QIK...P.GR...NVD.T..N....GKV....DL..P...........Y.L..R..D.WRY.........PQSD...............LLGL.IQILVI.......VFGEEPPV................................................................
A0A2N5TAW0_9BASI/19-141                ......................................................al--TQIKTVLEHYL.......TL.TPK.TE..P.F..................T...........F.....D.....DGR..T.A...LLVA..LSGTIPV..D.......YR............A...LR....Y.N...........IPIAVWLPFHFPN...........................EPP..I..I..Y..L.TPTQEM..............VIR...K.GT...HVE.P..S....GKC....IA..G...........Y.F..H..S.WQNk.......pEACS...............LKDL.LESLQD.......LFSKQPPL................................................................
Q4DJK6_TRYCC/140-223                   ..................................................qapphr-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....Y.V...........LPLQIWLTHLYPI...........................EPP..L..V..F..L.LSAEQG.............cRIA...S.NH..kYVD.A..T....GRC....HT..P...........E.L..A..A.WHP.........VSSS...............LCDV.VKKLGQ.......LLS-----aeglipl.........................................................
G1MHQ6_AILME/21-141                    .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YK............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A1D2M6L0_ORCCI/45-118                ....................................................vfnn-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........--VVIWLLDTHPI...........................NAP..M..V..F..V.KPTPDM..............RIK...V.SR...HVD.H..N....GKV....YL..P...........Y.L..H..E.WTG.........ANSD...............LLGL.IQVLIC.......TFSEQPPV................................................................
A0A420U7W5_FUSOX/25-147                .......................................................a-YNDVAQALDRFP.......SL.SPR.TD..V.H..................T...........F.....S.....NGA..N.A...LLLH..LSGTLPV..N.......FR............G...TT....Y.R...........FPISIWVPHAYPR...........................EPP..M..I..Y..V.VPTETM..............MIR...P.GQ...HID.P..Q....GLV....YH..P...........Y.L..V..G.WAEf.......wDKSN...............LRDF.LNILTD.......IFAKEPPV................................................................
W7HTD1_9PEZI/27-149                    ........................................................TYSDVATLLHHYR.......SL.SPK.TD..V.Y..................T...........Y.....D.....DGT..S.D...LLLC..LHGTLPV..S.......FR............G...AT....Y.N...........IPLNIWVPHQYPA...........................VPP..T..V..L..V.VPGKNM..............GIR...P.TN...HVD.T..N....GRS....YH..P...........Y.L..A..Y.WSQn.......pDKSS...............LIDL.CGQLKD.......VFSKEPPL................................................................
A0A2B7XLK5_9EURO/33-155                .......................................................a-YSDVVNLLAQYP.......GF.APR.TD..V.Y..................T...........Y.....E.....NGA..P.A...LLLH..VAGTLPV..T.......FR............G...AV....Y.R...........FPITIWVPKAYPR...........................EPP..M..V..Y..V.TPTQDM..............LVR...P.GQ...HVS.G..E....GRV....YH..H...........Y.L..A..H.WSEa.......wDRST...............IVDF.LYILRE.......IFAKEPPV................................................................
W9XA66_9EURO/26-148                    ........................................................TYSDLAHVLARNP.......GL.APR.TD..V.Y..................T...........F.....E.....NGT..A.A...LLVH..FQGTVPV..D.......FR............G...SP....Y.R...........IPISLWIPHAYPY...........................EPP..I..C..Y..V.TPTEEM..............VIR...P.GQ...HVG.G..D....GKI....YH..P...........Y.L..A..H.WREt.......wARCN...............VVDF.LSILAD.......IFGREPPV................................................................
A0A2K5N2K8_CERAT/21-101                ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............P...KS....V.I...........VGLIKEMIAKFQE...........................ELP..L..Y..S..V.PSS---..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------dearqvdll.......................................................
A0A5N3XV07_MUNRE/38-158                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..I.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A1S2Z9F9_ERIEU/36-119                ....................................................kysm-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......TY............G...TT....Y.N...........IPIHLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A672LBX7_SINGR/23-143                .......................................................t-SRDITSVASHYK.......DL.KAV.MD..N.Y..................V...........F.....N.....DGS..T.K...ELLS..LTGTVPV..S.......YR............G...NV....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKP.........PQSE...............LLGL.IQVMIV.......VFGEEPPV................................................................
A0A1Y1HW97_KLENI/42-163                .......................................................i-RQHLLAVVQDYP.......GL.TAK.TG..T.F..................T...........H.....N.....DGR..A.S...HLLK..LEGTVPM..F.......YQ............N...VK....Y.N...........IPITAWLLEGYPR...........................QCP..L..V..Y..V.TPTRDM..............IIK...P.RH..qFVD.A..S....GMV....AA..P...........Y.L..R..E.WVF.........PRSN...............LVDL.CGTLSV.......LFGSDPPL................................................................
Q4DUY3_TRYCC/77-162                    .................................................eqapphr-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....Y.V...........LPLQIWLTHLYPI...........................EPP..L..A..F..L.LSAEQG.............cRIA...S.NH..kYVD.A..T....GRC....HT..P...........E.L..A..A.WHP.........VSSS...............LCDV.VKKLGQ.......LLS-----aegliplc........................................................
A0A5E4EPT6_PRUDU/47-168                .......................................................i-LSDVIQLLDQYP.......SL.GLT.RR..R.F..................Q...........-.....-.....-PE..E.P...AVLV..VRGTIPI..F.......YT............N...RV....Y.K...........IPVEIWVPHSYPT...........................SPP..R..A..C..V.TLDDQNa............tAIK...L.RH..pYVD.A..Rr..gGLI....NV..P...........H.M..L..D.WHS.........-ERT...............LVVL.VTTMCE.......CFSRDPPL................................................................
A0A2C9W5C3_MANES/40-161                .......................................................i-RQHLLSLIATYP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......YQ............G...VT....Y.N...........IPIIVWLMDSYPR...........................HPP..C..V..Y..V.NPTRDM..............IIK...R.PH..pYVN.P..S....GLV....SV..P...........Y.L..Q..N.WIY.........PSSN...............LVDL.VRELSG.......FFGRDPPL................................................................
A8NFJ3_COPC7/21-143                    ........................................................VYADVDAVLLRYP.......TL.RPK.SD..V.Y..................T...........F.....D.....DGR..S.Q...LLLC..VHGLLPI..T.......YR............H...AS....Y.N...........IPLNVWLTRDYPR...........................HPP..L..V..Y..V.VPTADM..............LVR...P.SK...ALE.V..S....GRC....NH..E...........Y.L..Q..H.WQRk.......dEGCS...............LLGL.LQDLQD.......NFSREPPV................................................................
A0A5E4CBX8_MARMO/21-141                ........................................................TVEELKNVNMFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...HT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...I.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A099ZLR0_TINGU/8-128                 ........................................................TVQETSSVITQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
A0A3Q3X6E3_MOLML/2-106                 ......................................ykfhdvaveelqkihrif-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-PGMIPS..T.......GT............Y...RS....Y.N...........FPVQLWLLDSFPF...........................APP..I..C..L..L.RPTANM..............VIR...E.GK...HVD.A..R....GRI....FL..P...........G.L..H..N.WDY........qPKSS...............VVGL.LREMTA.......KFEEDPPL................................................................
T0QDE1_SAPDV/27-147                    .......................................................v-RQDVETLLRQIP.......SL.APQ.SG..V.Y..................T...........H.....N.....NGT..T.S...TMLS..LSGTIPI..Y.......YN............G...NQ....Y.N...........IPVEIWMPEAYPF...........................AAP..T..C..Y..V.RPTADM..............MIR...P.GH..pHVD.Q..N....GLI....LL..P...........Y.S..T..H.WDS.........-DHS...............LVEL.IGYQCS.......VFGTQPPV................................................................
H3ECX1_PRIPA/40-160                    ......................................................ak--GDVMAVMRVYK.......DL.KCD.SE..L.Y..................M...........Y.....P.....DGK..K.R...QAFK..LYGTIPV..N.......YR............G...SI....Y.N...........IPISIYLWDSHPY...........................YAP..I..C..N..V.VPTATM..............IIK...E.SE...HVN.K..Q....GRV....FL..P...........Y.L..N..E.WRF.........PGYD...............LYGL.IQMMVM.......IFQERCPL................................................................
A0A0A2L128_PENIT/32-154                ........................................................TYHDVANALSQYP.......SL.SPR.TD..V.Y..................T...........Y.....E.....TGF..S.A...LLLH..LVGTLPV..T.......FR............G...TT....Y.R...........FPIALWIPNTYPR...........................EPP..I..A..Y..V.TPTQEM..............TVR...V.GQ...HVT.L..E....GQV....YH..H...........Y.L..A..H.WAEa.......wDRST...............IADL.LSILRD.......IFAKEPPV................................................................
A0A1X7RHP8_ZYMTR/25-147                ........................................................TYSDAARALSAYP.......SI.SPR.TE..V.Y..................T...........H.....E.....NGA..S.A...LLLT..LSGTLPV..S.......FR............G...ST....Y.R...........FPVKLWLPHAYPQ...........................DAP..I..V..Y..V.EPGKEM..............LIR...P.GQ...HVG.V..D....GRV....YH..P...........Y.L..R..D.WRGm.......wDRAG...............LQEF.LELLQQ.......VFAKEPPV................................................................
C6HLQ0_AJECH/33-120                    ........................................................TYNDVTNLLAQYP.......GF.VLR.TD..V.Y..................T...........Y.....E.....NGT..P.A...LLLQ..LTGTLPV..T.......FR............G...AL....Y.R...........FPITIWVPKTYPR...........................EPP..F..V..Y..V.TPTQDM..............LVR...P.GQ...H--.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------rstivd..........................................................
A0A194XEZ2_9HELO/26-148                ........................................................TYNDVAQALSHYS.......SL.SPR.TD..V.Y..................T...........Y.....E.....NGK..S.A...LLLH..LSGTLPV..V.......FR............G...TT....Y.R...........FPVALWVPHAYPL...........................EPP..L..V..Y..V.TPTEGM..............MVR...P.GQ...HVD.P..Q....GKI....YH..P...........Y.L..V..G.WAEf.......wDKSN...............ILDF.LAILRE.......VFAKEPPV................................................................
A0A1G4MFQ7_LACFM/28-149                ........................................................TFHDVACTLSTYK.......QL.RPR.TR..V.F..................T...........D.....I.....YGR..S.Q...LLLC..LYGKI--..-.......--............G...TE....Y.P...........LPILIWIPTEYPI...........................VAP..L..V..Y..L.DFESLQs............pPVD...L.AG...IVD.S..N....GSL....NL..P...........T.L..S..Q.WNS.........EHCN...............LLQL.VADLDN.......--------lrsdyfaiptpl....................................................
A0A5J9WM40_9POAL/42-164                .......................................................i-RNHLVALAEAFP.......SL.HPK.AA..L.F..................T...........H.....N.....DGR..A.A...HLLQ..ADGTIPI..H.......HA............G...AS....Y.N...........LPAVVWLPEPYPR...........................SPP..L..V..F..L.SPTRDM..............VVK...P.NH..pLVD.R..S....GLV...aNA..P...........Y.L..R..S.WVF.........PSSN...............LVDL.VRSLSH.......LFGLDPPL................................................................
B4H4C4_DROPE/22-142                    ........................................................TKKDVIDVVTTYR.......SL.TYD.LQ..K.F..................V...........F.....N.....DGS..Y.K...DLFT..LQGTIPV..V.......YK............N...NT....Y.Y...........IPICIWLMDTHPQ...........................NAP..M..C..F..V.KPTPSM..............HIK...V.SM...YVD.H..N....GKV....YL..P...........Y.L..H..D.WQP.........NSSD...............LLSL.IQVMIV.......TFGDHPPV................................................................
A0A091KRS5_9GRUI/8-127                 ........................................................TIEELKNVTKTYP.......NF.TFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIHLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..N....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VIGL.IKEMIA.......KFEEELPL................................................................
A0A5A7QPK8_STRAF/124-210               ....................................................vtsa----STHLIETYP.......SL.QPK.TA..V.F..................T...........H.....N.....DGQ..P.P...P---..GHGTIPI..F.......FQ............G...VT....Y.N...........IPVIMWLMDSSPE...........................ER-..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------aihmqaedegcatpvwrlrqvvdama......................................
A0A1L0DLW4_9ASCO/26-161                .......................................................a-FNDIYRFLSVYLs.....qGF.KIR.TA..V.Y..................T...........S.....Q.....QGN..S.N...LLVN..LYGSLNC..K.......--............-...-N....I.E...........VPLNIWVPLNYPFadns..................vaepnGVP..I..V..Y..V.VATPDM..............LIR...P.GN...NVD.L..Q....GRF....YH..P...........Y.L..S..L.WHLellp.gssnAEYN...............LLNL.MSCLIT.......TFNKDSPL................................................................
A0A4P9ZX35_9FUNG/23-150                ........................................................TTQHIYDVLHHFP.......TL.RPK.YD..F.Y..................A...........LrqgssS.....NGA..R.E...PTLS..TFGTLPV..T.......YH............G...QT....Y.Q...........FPVCLYYPVRYPQ...........................VPP..V..V..D..V.VPTADM..............AVV...P.GK...CVN.A..Q....GHV....HH..P...........Y.L..S..Q.WEAq.......pQQKN...............AVEL.LRALQI.......VFSHEPPV................................................................
A0A286UUE3_9AGAM/23-145                .......................................................v-YIDTLAVLEQYP.......SL.RPK.TD..V.Y..................T...........Y.....D.....DGR..S.Q...LLLC..VHGLVPI..A.......FR............N...AS....Y.N...........IPVAIWVTLAYPA...........................EPP..L..V..Y..V.VPTSDM..............LIK...P.SP...RVD.L..S....GRC....SF..E...........Y.T..E..N.WVRk.......pDSCS...............IQAL.IEAMRS.......HFSAEPPL................................................................
A0A1S3KL34_SALSA/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..T.R...TLVS..LTGTVPV..S.......YR............G...NI....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A2N5SU59_9BASI/19-141                ......................................................al--TQIKTVLEHYL.......TL.TPK.TE..P.F..................T...........F.....D.....DGR..T.A...LLVA..LSGTIPV..D.......YR............A...LR....Y.N...........IPIAVWLPFHFPN...........................EPP..I..I..Y..L.TPTQEM..............VIR...K.GT...HVE.P..S....GKC....IA..G...........Y.F..H..S.WQNk.......pEACS...............LKDL.LESLQD.......LFSKQPPL................................................................
A0A1U8A8W4_NELNU/38-159                .......................................................i-RQQLLSLVNTYP.......SL.QPK.TA..T.F..................T...........H.....N.....DGR..T.V...NLLQ..AEGTIPM..F.......YQ............E...VM....Y.N...........IPVVIWLMESYPR...........................QPP..C..A..Y..V.APTRDM..............IIK...R.PH..pHVN.P..S....GLV....SL..P...........Y.L..Q..N.WIY.........PSSN...............LVDL.VRNLSL.......TFGRDPPL................................................................
A0A016SD90_9BILA/23-143                ......................................................ak--SDILGALAEFK.......DL.LPD.TE..S.F..................T...........F.....P.....DGK..R.K...TAFR..LHGTIPV..Y.......YK............G...VR....Y.N...........IPISVYLWDTHPY...........................YAP..I..C..Y..V.SPTPTM..............VIR...E.SE...HVT.K..Q....GRV....FL..P...........Y.L..S..E.WRF.........PGYD...............LNGL.LQVMAM.......VFQEKCPV................................................................
A0A3R7D102_CLOSI/1-47                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.-----M..............QIK...A.NN...FVD.T..N....GLV....CL..P...........Y.I..S..E.WKH.........PGSD...............LVGL.LAVLQV.......TFGERPPV................................................................
A0A5F8GVK3_MONDO/21-141                ........................................................TVEELTKVNMLYP.......NF.RFS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..N.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSI...............ITGL.ISEMII.......KFQEELPL................................................................
C4M9Z1_ENTHI/46-139                    ..................................................nylqya-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...---T..LVGTIPI..Q.......YL............G...AN....Y.N...........IPIMIMFPYDYPM...........................KPP..F..F..F..T.DPSPDM..............VIV...P.QH..pYAM.D..D....RTI....IH..P...........L.L..Q..R.WND.........SSNS...............LDVL.VC-LQL.......DFSNYPPL................................................................
A0A6J0XHH1_ODOVR/1-47                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.-----M..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A0L1J1T8_ASPNO/405-527               ........................................................TYYDVASVLAQYP.......SL.SPR.TE..V.Y..................T...........Y.....E.....NGF..S.A...LLLQ..LTGTVPV..T.......FR............G...TV....Y.K...........FPISLWVPNTYPR...........................EPP..I..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wERST...............LADL.VSILRE.......VFAKEPPV................................................................
E5R1C7_ARTGP/28-150                    ........................................................TYSDTAQLLAQFP.......SF.SPR.TD..V.Y..................T...........Y.....E.....NGA..S.A...LLLH..LTGTLPV..H.......FR............G...AL....Y.W...........FPIAIWVPNTYPD...........................ASP..M..V..Y..V.TPTSEM..............LVR...P.GQ...HVS.S..D....GKI....YH..H...........Y.L..A..H.WAEa.......rDRST...............LVDF.LLILKD.......VFAKEPPV................................................................
A0A6J2HZW0_9PASS/21-140                ........................................................TIEELKNVSKTYP.......NF.TFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIQLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VIGL.IKEMIA.......KFEEELPL................................................................
A0A2K5SC42_CEBIM/69-189                ........................................................TVEELKNVNMFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A287AW55_PIG/1-103                   ........................................................-------------.......--.---.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FSGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIT.......KFQEELPL................................................................
A0A5F5PLM2_HORSE/37-119                .....................................................ysm-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......TY............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A177WWW4_BATDL/1-120                 .......................................................m---DVEAVLKDHP.......GL.GPK.TD..L.Y..................T...........Q.....N.....DGR..Q.L...VLLC..ISGTIQI..N.......FS............G...SV....Y.N...........IPIALWLPSTYPS...........................QPP..F..A..H..V.LPTPTM..............VIK...P.SK...HVD.I..S....GRV....YH..P...........F.L..A..Y.WHL........rPDST...............LQQF.LKVLQE.......IFSAESPV................................................................
A0A195EGD8_9HYME/22-142                ........................................................TKKHVINVLNTYK.......GL.VYK.LE..P.F..................V...........F.....N.....DGS..R.K...ELLN..LQGTIPV..V.......YK............G...SC....Y.N...........IPICIWLMDTHPN...........................NAP..M..C..Y..V.KPTADM..............HIK...V.SM...FVD.H..N....GKI....YL..P...........Y.L..H..D.WVP.........HNSD...............LLAL.IQVMIV.......TFGEQPPV................................................................
A0A6J2AK85_ACIJB/14-134                ........................................................TVEELKNVNRFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YH............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GVS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
B0XLN9_CULQU/523-642                   ....................................................ekls-----VDCLKQYK.......AL.AYR.VE..E.Y..................A...........F.....N.....HGT..V.K...QLLN..LKGTIPV..R.......YK............G...NT....Y.H...........IPVAIWLLDTHPR...........................YAP..L..C..Y..V.QPTSDM..............YIK...V.SM...YVD.H..N....GKI....YL..P...........Y.L..H..D.WNP.........AHSD...............LLGL.IQVMIV.......TFGDYPPV................................................................
A0A2Y9D898_TRIMA/21-141                .......................................................t-VRETINVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A674KEW1_TERCA/21-141                ........................................................TIEELKNVVKIYP.......NF.RFS.MD..T.Y..................T...........F.....K.....DGS..L.K...DLLN..FSGTVPV..K.......YR............G...NS....Y.N...........IPICLWILDSHPF...........................APP..I..C..L..L.KPTINM..............EIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKSI...............IIGL.IKEMIE.......KFEEELPL................................................................
A0A080WI68_TRIRC/1-58                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..M..V..Y..V.TPTSEM..............LVR...P.GQ...HVS.S..D....GRI....YH..H...........Y.L..A..H.WAEa.......rDRST...............LVDF.LLILKE.......VFAKEPPV................................................................
A0A1R3KXC0_9ROSI/24-145                .......................................................i-LRHLLSLIQEYP.......SF.RPS.TD..K.F..................M...........H.....N.....DGT..E.V...NLLC..ASGCVHV..A.......AT............S...AA....P.P...........IPLVIWIHENYPQ...........................KPP..L..V..F..V.SLDPVN..............PIH...R.HH..pFVD.T..S....GVT....SP..P...........Y.I..L..T.WKF.........PSCN...............LSGL.LRNLVQ.......LFSYDHP-f...............................................................
L8I8S7_9CETA/8-128                     .......................................................t-VRETVNVISLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A398A238_BRACM/37-158                .......................................................i-RQHLLNLISSYP.......SL.EPK.TA..T.F..................I...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......YH............G...VT....Y.N...........IPVIIWLLESYPR...........................HPP..C..V..Y..V.NPTADM..............IIK...R.PH..aHVT.P..S....GLV....SL..P...........Y.L..Q..N.WVY.........PSSN...............LVDL.VSDLGA.......AFATDPPL................................................................
A0A5N6PEA9_9ASTR/33-152                .......................................................i-RRHLLSLLREFS.......SL.NPA.ID..T.Y..................I...........H.....N.....DGA..M.V...NLLK..VEGYLHI..S.......QS............-...-L....P.L...........VHVIIWVHEHYPY...........................VAP..M..V..Q..V.KMDQTK..............PIR...S.NH..pFVD.P..L....GVT....TS..A...........Y.L..H..T.WGP.........FGYD...............LLGL.AHNLVK.......IFSLDHP-f...............................................................
A0A368H4P5_ANCCA/23-143                ......................................................ak--SDILGALAEFK.......DL.LPD.TE..S.F..................T...........F.....P.....DGK..R.K...TAFR..LHGTIPV..Y.......YK............G...VR....Y.N...........IPISVYLWDTHPY...........................YAP..I..C..Y..V.SPTPTM..............VIR...E.SE...HVT.K..Q....GRV....FL..P...........Y.L..S..E.WRF.........PGYD...............LNGL.LQVMAM.......VFQEKCPV................................................................
A0A2U1MKZ3_ARTAN/28-149                .......................................................i-LEHLVSLFDSYP.......TL.YPR.SF..S.F..................T...........R.....T.....DGL..H.G...NYLS..LIGTIPM..V.......HL............G...VT....Y.H...........APIVIKVMETYPH...........................DAP..L..V..F..V.NPDRCM..............VIN...K.NN..pFVC.P..C....GLV....ST..D...........Y.L..T..H.WVS.........TSSN...............LLDL.CRDLST.......CFGNNPPL................................................................
A0A1A6AH82_9TREE/24-146                .......................................................i-INEVIRILSERR.......TL.SVK.TD..A.F..................T...........F.....D.....SGQ..T.A...LLLL..LHGTLPI..T.......YR............G...AT....Y.H...........IPMHVWVPHEYPR...........................SPP..I..L..F..V.VPTKEM..............GIR...K.SR...EVD.P..S....GRV....NE..E...........A.V..E..Y.WWKs.......wPTQD...............LETI.LKHLTT.......IFSAAPPV................................................................
A0A2Y9S8Q2_PHYMC/21-141                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...NLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A0C3HBN5_9PEZI/26-148                ........................................................TYNDVAQTLSHYS.......SL.SPR.TD..V.Y..................T...........Y.....E.....TGA..S.A...LLLH..LSGTIPV..V.......FR............G...TT....Y.R...........FPIAIWVPHGYPR...........................EAP..V..V..Y..V.TPTDGM..............VVR...P.GQ...HVD.P..Q....GKI....YH..P...........Y.L..V..G.WAEf.......wDKSN...............VLDF.LAILRD.......IFAKEPPV................................................................
A0A1S3FGR5_DIPOR/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LE..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTISM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGEEPPV................................................................
A0A672TQT7_STRHB/21-141                .......................................................t-IQETASVITQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
A0A2S6CGF2_9PEZI/494-616               ........................................................TYSDTARALVLYP.......SL.APR.TE..V.Y..................T...........H.....E.....NGT..S.A...LLLT..VSGTLPV..A.......FR............G...TT....Y.H...........FPVKLWVPHAYPY...........................EAP..N..V..F..V.TPGKDM..............LVR...P.GQ...HVA.V..D....GRV....YH..P...........Y.L..R..D.WGRm.......wERAS...............ISEL.AECLQQ.......IFGREPPV................................................................
G3WRC7_SARHA/21-141                    .......................................................t-VRETVSVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGN..S.R...ELMS..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGEEPPV................................................................
U5D8G3_AMBTC/40-161                    .......................................................i-SQHLVGLVQHFP.......SL.QVK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..AEGTIPM..V.......YH............D...VV....Y.N...........IPAVVWLVESYSR...........................LPP..L..V..F..V.TPTRDM..............IIK...R.AH..pNVN.P..S....GLV....SV..P...........Y.L..Q..H.WVY.........PSSN...............LVDL.VKNLSH.......HFGLDSPL................................................................
A0A093YRI9_9PEZI/26-148                ........................................................TYNDVAQALSHYS.......SL.SPK.TE..V.Y..................T...........Y.....E.....NGV..S.E...LLLQ..LSGTLPV..A.......FR............G...TT....Y.R...........FPVTVWIPHQYPR...........................AEP..V..V..Y..V.SPAEGM..............MVR...A.GQ...HVD.P..Q....GRV....YH..P...........Y.L..A..G.WAEf.......hDKSN...............ILDF.LAILRD.......VFAKEPPV................................................................
A0A183L4S3_9TREM/1-78                  .......................................................m-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............G...ST....Y.N...........IPIAIFLFEAYPH...........................KSP..M..V..Y..V.RPTNTM..............QIK...P.SD...FVD.S..A....GLV....QL..P...........Y.M..T..D.WKH.........PDAD...............LVEL.ISVLQA.......VFGETSPV................................................................
G1X8K1_ARTOA/45-151                    ....................................................kpts-------------.......--.---.--..T.A..................T...........Y.....D.....DGR..S.D...LLLC..IQGTLPV..A.......FR............G...AT....Y.N...........IPLNIWVPHQYPN...........................TPP..T..V..M..V.VPGKNM..............GIR...P.TN...HVD.T..N....GRC....YH..P...........Y.L..A..Y.WSQn.......pDKST...............LIDL.CGQLKD.......VFGKEPPL................................................................
J7RAK5_KAZNA/38-160                    .......................................................a-FHDCVVALSLYK......sNL.RPR.TR..V.F..................T...........N.....P.....SGE..A.Q...LLLC..LYGDF-V..N.......VQ............-...VS....G.P...........VPILIWVCSQYPL...........................KAP..V..V..F..V.DVEKLGp...........drEVR...V.GG...QID.S..N....GQI....YL..P...........I.L..H..Q.WDP.........KLSN...............VVKL.IKELET.......LIQTQ---qlv.............................................................
A0A2Y9RDR0_TRIMA/21-141                .......................................................t-VRETINVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A3P9CN69_9CICH/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
D7KZS2_ARALL/37-158                    .......................................................i-RQHLLNLISSYP.......SL.EPK.TA..S.F..................M...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......FH............G...VT....Y.N...........IPVIIWLLESYPR...........................HPP..C..V..Y..V.NPTADM..............IIK...R.PH..aHVT.P..S....GLV....SL..P...........Y.L..Q..N.WVF.........PSSN...............LVDL.VSDLSA.......AFARDPPL................................................................
A0A1U7RE64_ALLSI/21-141                ........................................................TIEELKNVNKIYP.......NF.LFS.MD..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPI..T.......YH............G...HS....Y.N...........IPVRLWILDSHPF...........................APP..I..C..F..L.KPTVNM..............GIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VIGL.IKEMTA.......KFDEELPL................................................................
A0A642UH28_DIURU/25-162                .......................................................v-YNHVCQFLGVHYrq...nlRF.KVK.TR..E.F..................I...........D....pQ.....SGQ..S.A...LLVN..LSGTIPA..S.......VQqv.......yapG...TH...pN.P...........VPIDIWIPFNYPE...........................QIP..V..V..Y..A.QADHSHg............lYLQ...A.NN...NFD.T..S....GRF....YH..P...........M.L..S..Q.WHSdp.....rnPHNN...............LLSL.MDVVVQ.......SVSANSPV................................................................
A0A2V1AYX7_9ASCO/26-163                .......................................................a-YSHLYHFLSAYLp.....eGF.KIR.TA..V.Y..................T...........S.....V.....SGH..S.Q...LLIN..LYGNLDC..G.......--............-...-T....C.L...........VPLNIWIPLNYPFqdeni................pshepnGVP..E..V..F..V.VPEHGL..............VIR...P.NN...NVD.S..Q....GRF....YH..P...........F.I..A..S.WHQn......ytPTSStk..........qfsLLSL.MGCLKA.......TFEQTPPL................................................................
A0A2P6V3Y2_9CHLO/34-155                ......................................................le--QHMTELVQDIP.......SL.HVK.TR..E.Y..................T...........H.....T.....DGR..T.V...ELLL..AEGTVPM..W.......YQ............G...VK....Y.N...........IPVAVWLPERYPL...........................AAP..L..V..Y..V.VPTPDM..............VIK...P.RH..sFVD.A..S....GLV....NT..L...........Y.I..G..Q.WQY.........PTSN...............LRDM.AQDMSM.......HFGGDPPL................................................................
B4MMU9_DROWI/22-142                    ........................................................TKKDVVDVVTTYR.......SL.SYD.LQ..K.F..................V...........F.....N.....DGT..S.K...DLFT..LQGTIPV..V.......YK............S...NT....Y.F...........IPICIWLMDTHPQ...........................NAP..M..C..F..V.KPTPTM..............QIK...V.SM...YVD.H..N....GKV....YL..P...........Y.L..H..D.WQP.........HSSD...............LLSL.IQVMIV.......TFGDHPPV................................................................
A0A5N6KQW5_9ROSI/54-163                ...................................................wykil-------------.......--.---.TT..V.T..................A...........F.....D.....NGT..P.A...LLLL..VWGLIPV..E.......WQ............G...AT....Y.R...........YPIDIWIPHAYPR...........................DAP..I..A..Y..I.KPTSDM..............AVR...P.GQ...HVS.V..E....GRI....YH..P...........F.L..A..Q.WPTq.......pDRSN...............ITDF.VFILRD.......IFSKEPPV................................................................
A0A0P7UF22_SCLFO/19-105                ..............................................egmkptvety-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............R...RS....Y.N...........LPILMWLLDSFPF...........................TPP..I..C..L..L.RPTLNM..............VIR...E.GR...HVN.T..K....GRI....HL..P...........A.L..H..N.WDY.........PKSS...............VNSL.LMEMIE.......RFEEDPPL................................................................
A0A5N6TDU3_9EURO/33-155                ........................................................TYHDVALVLAQYP.......SL.SPR.TE..V.Y..................T...........Y.....E.....NGF..S.A...LLLQ..LTGTVPV..T.......FR............G...TV....Y.K...........FPIAVWVPNTYPR...........................EPP..I..V..Y..V.TPTQDM..............AVR...M.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wERST...............LVDL.LSILRE.......VFAKEPPV................................................................
A0A5A7PFN2_STRAF/83-153                ....................................................vtsa----STHLIETYP.......SL.QPK.TA..V.F..................T...........H.....N.....DGQ..P.P...P---..GHGTVPI..F.......FQ............G...VT....Y.N...........IPVIMWLMDSSPE...........................ER-..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------aihmqaeiat......................................................
A0A0M9FWV1_9TRYP/73-173                ...............................................ikekepqlq-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...-T....F.M...........LPIQIWLSHQFPI...........................EPP..F..I..Y..L.VCSSASenpkipegvdtsviKIV...S.NH..pNVD.F..T....GLC....FC..R...........E.L..A..E.WNP.........SSSS...............LCYT.IERFSR.......ALER----ssrcpi..........................................................
A0A5A8CK82_CAFRO/24-148                ......................................................vr--RDVLEAMRQAP.......YL.IPK.QD..ElF..................Q...........Ev..spG.....DWQ..P.C...KLLS..LEGVLAY..S.......HS............S...SV....Y.Y...........CPIQMYVQTKHPR...........................SKP..T..V..Y..V.RPTPDM..............MIE...R.GA..eYVD.K..A....GQI....TI..P...........S.L..T..S.YTE.........-STG...............LAAV.LREMAF.......IFATAPPV................................................................
A0A1S3IUW8_LINUN/85-205                .......................................................a-KRDILQALSHFK.......DL.KPN.VD..S.F..................V...........F.....N.....DGN..R.K...ELLC..LEGTIPV..T.......YR............G...TT....F.N...........IPVCLWLLETHPH...........................NPP..M..V..Y..V.KPTANM..............QIM...S.GQ...HVD.T..N....GKV....YL..S...........Y.L..H..E.WRH.........PQSD...............LLGL.IQIMCI.......IFGDNPPV................................................................
A0A0K0FY90_STRVS/20-140                .......................................................a-FTDIQRALNSFV.......HL.KDS.VE..L.F..................T...........Y.....P.....SGK..R.K...NVLT..LAGTIPV..V.......YK............N...NT....Y.H...........IPVALYLDEKHPY...........................QAP..Y..C..Y..V.KPTSEM..............EIR...E.SK...VVD.V..T....GRI....YL..P...........Y.L..N..E.WKW.........PSHS...............LVEL.LKVMCR.......EFENGCPV................................................................
A0A5D2UPN2_GOSMU/41-133                .......................................................i-RQQLVSLISNYP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......FQ............G...VT....Y.N...........IPIIIWLMESYPR...........................YAP..A..V..Y..V.NPTRDM..............IIK...R.PH..pHVS.P..S....G--....--..-...........-.-..-..-.---.........----...............----.------.......--------pspsp...........................................................
A0A1Y2VYS8_9PEZI/25-147                ........................................................TYNDVAQALSQYP.......SL.SPR.TD..V.H..................T...........F.....D.....NGV..S.A...LLLH..LTGTIPV..I.......FR............G...TT....Y.R...........FPISLWIPHAYPR...........................EAP..L..G..Y..V.TPTENM..............MVR...P.GQ...HVD.P..Q....GRI....YH..P...........Y.L..V..G.WTEf.......wDKSS...............LLDF.ITILRD.......IFAKEPPV................................................................
A0A2U9BIL4_SCOMX/24-145                .......................................................t-RCDLQMVRALYS.......DL.RLY.VD..F.Y..................C...........F.....P.....NNE..K.K...KLVY..LAGTLPV..N.......FE............G...SE....Y.N...........IPVCIWLHETHPA...........................SRP..R..C..Y..V.CPSFSM..............VMN...P.SC..pCVD.R..S....GNI....SL..T...........V.L..E..T.WTH.........GVSD...............LSLL.VSEMRR.......AFQVDTPL................................................................
A0A1S3W293_ERIEU/21-141                ........................................................TVEELKNVNMIFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YH............G...TT....Y.N...........IPIHLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A3Q7PK46_CALUR/23-143                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..LTGTIPV..M.......YQ............G...NT....Y.N...........IPICLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A6P8F2J8_CLUHA/24-145                .......................................................v-LADVRSATATYT.......DL.NLH.VD..F.Y..................C...........Y.....P.....NNE..K.K...KLVY..LGGTIPV..V.......YE............G...NV....Y.N...........IPIRIWIHETHPK...........................SPP..K..C..S..V.CPSVFM..............VIN...A.KS..sFVD.A..S....GHV....HL..H...........C.L..N..N.WKI.........GWSS...............LSIV.LEEMRA.......AFQRETPL................................................................
A0A372RQD5_9GLOM/27-151                ........................................................VFRDVDATLAVFK.......AL.IPK.TD..I.Y..................A...........H.....D.....DGT..V.E...VLLC..LYGTIPI..T.......FR............S...TP....Y.N...........IPVAFWIPTDYPM...........................VPP..I..A..F..V.VPTSNM..............LVK...K.SQ...HVD.V..S....GRC....SH..P...........Y.L..E..H.WNPpp.....hnEESN...............LVSL.CSLLQN.......IFGQNPPV................................................................
A0A6P7KYC3_BETSP/24-145                .......................................................t-LSDLQQVQSRFS.......DL.RLY.VN..F.Y..................C...........F.....P.....NKE..K.R...RLVY..LAGTIPV..R.......YE............G...LE....Y.N...........IPVCIWLHETHPV...........................SRP..R..C..C..V.CPSISM..............VIN...P.SC..pCVD.S..A....GNI....SL..S...........G.L..S..N.WTN.........GVST...............LSLL.ISEMRQ.......AFQKDTPL................................................................
I0Z3J2_COCSC/36-157                    .......................................................v-RQHLLDLVSEFP.......TL.VLK.QQ..Q.Y..................T...........H.....T.....NGS..T.V...QLLM..ADGTLPM..Y.......YQ............G...VK....Y.N...........IPVSIWLPEAYPR...........................QQP..I..M..Y..V.VPTSDM..............IIK...P.QH..sFVD.P..S....GMV....FS..P...........Y.L..R..N.WIY.........GRSN...............LVDM.AQDTSM.......QFGHDPPL................................................................
A0A6I9QX82_ELAGV/33-150                ........................................................IRHHLVSMIDAFP.......SL.RPS.VA..T.F..................T...........Y.....N.....DGR..N.A...ILLR..SEGTIPT..S.......GG............-...--....-.H...........LPVSIWLLEPYPH...........................VPP..A..V..F..L.SPVRGT..............LIR...P.GH..aHVD.P..S....GAV....DA..T...........Y.L..R..S.WRF.........PASN...............LAEL.VHSLSL.......LFSLDPPL................................................................
A0A7E5A0A2_PANRE/23-143                ......................................................ak--SDVKLTLSEFT.......DL.NPG.PE..L.Y..................T...........F.....P.....DKT..R.R...NVLA..LTGTIPI..N.......YK............G...NR....Y.H...........IPVALHLMDNHPY...........................APP..F..V..H..V.KPTPQM..............AIR...E.SE...HVD.H..T....GRV....FL..P...........Y.L..N..E.WRY.........PQHD...............TVGL.IQVLIF.......AFQDKCPV................................................................
A0A2K6RHQ0_RHIRO/21-141                ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSYPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A401SKM9_CHIPU/21-141                ........................................................TIEDLKNVHKIFP.......EL.KSS.MD..T.Y..................T...........F.....S.....DGS..Q.K...DLLN..LIGTIPV..R.......YQ............G...SS....Y.N...........IPIRIWILDSHPF...........................GPP..L..C..F..L.RPTSNM..............IIR...E.GK...HVD.L..Q....GRI....YL..P...........Y.L..Q..H.WSH.........PKTN...............VVGL.LHEMIT.......KFEEVPPL................................................................
A0A3G2S6A7_9BASI/23-145                ........................................................IMSDMDTILTEYP.......TL.RPR.TD..V.Y..................T...........Y.....N.....DGR..S.M...LLLL..LDGTIAV..P.......FR............G...SV....Y.N...........IPMHFWFPRVYPQ...........................EPP..I..V..Y..V.VPMRDM..............LLR...S.GA...HTT.P..E....GCV....QV..P...........Y.I..H..T.WLRk.......pEASS...............LLEL.VRECQA.......AFSLEPPV................................................................
A0A5N7B6F4_9EURO/33-155                ........................................................TYHDVASVLAQYP.......SL.SPR.TE..V.Y..................T...........Y.....E.....NGF..S.A...LLLQ..LTGTVPV..T.......FR............G...TV....Y.K...........FPISLWVPNTYPR...........................EPP..I..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WTEa.......wERST...............LVDL.VSILRE.......VFAKEPPV................................................................
R9AFS0_WALI9/23-145                    .......................................................v-SRDVCGLLEMNE.......TL.SPR.TE..V.Y..................T...........H.....D.....NGR..S.E...LLVN..VYGTLPI..Q.......FR............D...AT....Y.N...........IPLSLWLPLDYPA...........................SPP..W..V..Y..V.VPTATM..............LVR...A.GH...GVE.S..S....GLV....RS..P...........Y.V..F..D.WARk.......pEACN...............LVDL.AYALRN.......SFEMFPPL................................................................
A0A2U3X0Z7_ODORO/37-119                .....................................................ysm-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......TY............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A383ZIG5_BALAS/21-141                ........................................................TMEELKNVNMFFP.......HF.IYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...NLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.T..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A2R6R126_ACTCC/45-166                .......................................................i-RQHLVSLSDAYP.......SL.QPK.TA..T.Y..................T...........H.....N.....DGR..T.V...NLLQ..ADGTVPM..L.......FQ............G...VT....Y.N...........IPVVFWLMESYPR...........................HPP..L..A..Y..V.NPTRDM..............IIK...R.PH..pFVN.P..S....GMV....ST..P...........Y.L..Q..N.WVY.........PSSN...............LPDL.ARDLSH.......YFARDPPL................................................................
A0A2T7P4Y9_POMCA/540-660               ......................................................ar--RDVSHALQQYR.......DL.RPS.LE..P.F..................V...........F.....N.....DGT..T.Q...HLVQ..LEGTIPV..M.......YK............G...NT....Y.N...........IPIQLWILDSHPY...........................NPP..M..V..F..V.RPTNNM..............QIK...A.GR...YVD.M..N....GKV....DM..P...........F.L..R..E.WRW.........PKSD...............LVGL.IQILII.......TFGEECPV................................................................
A0A3Q2GFJ8_CYPVA/21-141                .......................................................a-IEELQKIHRIFP.......DL.DPH.PG..T.Y..................T...........F.....T.....DSS..Q.K...DLLK..LIGVIPV..K.......YD............G...RS....Y.N...........IPIQLWLLDSFPF...........................TPP..I..C..L..L.KPTSNM..............VIR...E.GK...HVD.A..K....GRI....HL..P...........G.L..H..N.WDY.........PRSS...............VVGL.LNEMIK.......KFEEVPPL................................................................
W5PI27_SHEEP/21-141                    ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DST..Q.K...DLLN..FTGTIPV..I.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSI...............IVGL.IKEMVA.......KFQEELPL................................................................
A0A2U4CDT5_TURTR/1-47                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.-----M..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A5F4W9X2_CALJA/36-148                ........................................................TVEELKNVNMFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...NLLN..FAGTIPV..I.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........GI--...............----.------.......--------adrlvlldlseg....................................................
A0A7N5KA92_AILME/36-119                .....................................................rys-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..------V..D.......TY............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..H..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A5F5PX43_HORSE/21-141                ........................................................TMEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTVPV..M.......YH............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A485L049_9STRA/25-145                .......................................................v-RQDVETLLRQIP.......SL.GPQ.SG..I.F..................T...........H.....N.....NGS..T.S...TMLS..LSGTIPI..Y.......YG............G...NQ....Y.N...........IPVEIWLPEAYPF...........................AAP..T..C..F..V.RPTADM..............MIR...P.GH..pHVD.Q..N....GLI....HL..P...........Y.S..T..N.WDS.........-DHS...............LVEL.IGYQCS.......VFGATPPV................................................................
A0A314XYG9_PRUYE/48-166                .....................................................ilt---DVIQLLLHIP.......SL.GLT.RG..R.F..................Q...........K.....-.....--E..E.P...VVLV..IEGTIPI..F.......YN............G...HP....H.K...........TPIKIWVPFGYPT...........................DSP..K..V..R..V.VVEDQAi............tSIK...L.PH..pYVD.AgaG....GLV....NV..P...........Y.M..Q..A.WIE.........AHSE...............----.------.......--------rtltglcrptpskr..................................................
A0A0Q3I8R7_BRADI/42-164                .......................................................i-RNHLVALADAFP.......SL.HPK.AA..L.F..................T...........H.....N.....DGR..A.A...HLLQ..ADGTIPI..H.......HG............G...AT....Y.N...........LPAVIWLPEPYPR...........................SPP..L..F..F..L.SPTRDM..............LIK...P.HH..pLVD.R..S....GLV...aNA..P...........Y.L..R..S.WVF.........PSSN...............LLDL.VRSLSH.......LFGLDPPL................................................................
A0A673K0M3_9TELE/12-128                ......................................ttnnvteislyfscnflt-------------.......--.---.--..-.-..................V...........F.....N.....DGT..A.R...TLVG..LTGTIEV..F.......YE............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A6P6MPM0_CARAU/24-145                ......................................................vl--DEIKDVSADFP.......HL.QLY.VD..C.Y..................L...........Y.....P.....NKD..K.K...RLVY..LGGTVPV..T.......YE............D...AT....Y.N...........IPVCIWIHETHPK...........................NPP..R..C..F..V.CPSPSM..............IIN...A.KS..sSVD.A..N....GRV....LL..H...........C.L..S..N.WKI.........GWSN...............LSIV.LEEMIA.......AFQRETPL................................................................
A0A2I0AM06_9ASPA/52-173                .......................................................i-RQHLVSLVEAYP.......SL.HPQ.SS..S.F..................T...........H.....N.....DGR..T.V...NLLQ..ADGTIPI..F.......FG............G...VM....Y.N...........IPACIWLLERYPF...........................SHP..S..V..F..L.NPTRDM..............VIK...A.NH..pHVD.R..S....GCV....RV..P...........Y.L..Q..N.WVY.........PSSN...............LVDL.VRSLSQ.......IFSSDPPL................................................................
A0A091D757_FUKDA/76-196                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTLPV..M.......YQ............G...HQ....Y.N...........IPVRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............AIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMTA.......KFQEELPL................................................................
A0A1F5LBM0_9EURO/32-154                ........................................................TYHDVANALAQYP.......SL.SPR.TD..V.Y..................T...........Y.....E.....TGF..S.A...LLLH..LVGTLPV..T.......FR............G...TT....Y.R...........FPIALWIPNTYPR...........................EPP..I..A..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GQV....YH..H...........Y.L..A..H.WAEa.......wDRSS...............IADL.LSILQD.......VFAKEPPV................................................................
A0A2H5PRU2_CITUN/41-162                .......................................................i-RQHLLTLISTFP.......SL.DPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTVPM..P.......FQ............G...VT....Y.N...........IPVIIWLMESYPR...........................HPP..C..V..Y..V.NPTRDM..............IIK...R.PH..pHVT.P..S....GLV....SI..P...........Y.L..Q..N.WIY.........PSSN...............LVDL.VRELSA.......CFSREPPL................................................................
A0A553PCQ9_TIGCA/25-145                .......................................................t-LRDVLATVKAFT.......GL.GYN.VD..K.F..................V...........F.....D.....NGD..E.H...LLAH..VKGTIPI..S.......YK............S...NT....Y.N...........IPVCFWLPRDYPK...........................YAA..M..G..F..I.QPTADM..............QIK...A.SP...NVD.Q..N....GRI....QL..P...........Y.L..L..D.WSY.........PDSN...............LVEL.IQLCIL.......IFSKAPPV................................................................
A0A1W0X549_HYPDU/470-520               ........................................................TAKDVFKVISYYP.......DL.RPT.MA..Q.Y..................V...........F.....P.....DGS..S.R...ELMN..LSGTIPI..T.......YR............G...VD....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------lslc............................................................
A0A2I3HE51_NOMLE/21-142                ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIC.......QV------lrgtspv.........................................................
A0A067DDL2_CITSI/41-162                .......................................................i-RQHLLTLISTFP.......SL.DPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTVPM..P.......FQ............G...VT....Y.N...........IPVIIWLMESYPR...........................HPP..C..V..Y..V.NPTRDM..............IIK...R.PH..pHVT.P..S....GLV....SI..P...........Y.L..Q..N.WIY.........PSSN...............LVDL.VRELSA.......CFSREPPL................................................................
A0A6G1PFI8_9TELE/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A5J5D6X5_9PERO/22-142                ........................................................TVREITNVISQYK.......DL.KPL.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A5N4DMQ7_CAMDR/21-141                .......................................................t-VRETINVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A2K6KQJ8_RHIBE/21-141                ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSYPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A183WE80_TRIRE/21-128                .....................................................rsy----VTSALEAYK.......EL.RPK.FE..D.F..................I...........H.....N.....DGT..T.R...KLVS..LDGTIPV..R.......YM............G...ST....Y.N...........IPIAIFLFEVYPN...........................KSP..M..V..Y..V.RPTNTM..............QIK...P.SD...FVD.S..A....GLV....QL..P...........Y.M..T..D.WKH.........VKV-...............----.------.......--------sysrdla.........................................................
A0A3R7P236_PENVA/24-144                .......................................................t-KRDVLTALQHYR.......GL.GPK.LD..K.F..................V...........F.....R.....SGT..S.R...YLLC..LEGTIPV..T.......YK............G...ST....Y.N...........IPICIWLLDNHPL...........................SSP..M..V..Y..V.KPTPDM..............LIK...A.SR...HVD.Q..N....GKV....YL..P...........Y.L..H..E.WNP.........NSSD...............LPGL.IQIMIM.......TFSEMPPV................................................................
A0A3P9Q359_POERE/21-129                .....................................................vah---QMYVSLTYFT.......NL.VPE.MA..E.Y..................V...........Y.....K.....DGT..A.K...SLMS..LTGTIPV..V.......FS............G...KT....Y.N...........IPICVWIQQNYPN...........................SPP..I..C..Y..V.KPTREM..............TVV...K.GK...YIA.S..D....GEV....TI..P...........Y.L..K..D.WKK.........VKK-...............----.------.......--------kkrkvif.........................................................
A0A2U3X0Z1_ODORO/21-141                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A445HJK2_GLYSO/34-155                .......................................................i-RQHLVALTTAFP.......SL.EPK.TA..S.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..T.......FQ............G...VT....Y.N...........IPVVIWLMESYPR...........................HPP..C..V..Y..V.NPTRDM..............IIK...R.PH..pHVN.P..S....GLV....SV..P...........Y.L..Q..N.WTY.........PSSN...............LVDL.ILNLSL.......HFGRDPPL................................................................
A0A6J1U656_9SAUR/21-141                .......................................................a-VQETANVTAQYK.......DL.KPV.MD..N.Y..................V...........F.....N.....DGS..S.R...ELMS..LTGTIPV..N.......YR............G...NI....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GRI....YL..P...........Y.L..H..E.WKH.........PQSD...............LIGL.IQVMIV.......VFGEEPPV................................................................
A0A2I0W013_9ASPA/43-164                .......................................................i-RQHLVSLVEAYQ.......SL.RPK.AS..S.F..................T...........H.....N.....DGR..T.V...NLLQ..ADGTIPI..V.......YD............G...VV....Y.N...........IPATIWLVERYPL...........................IPP..S..V..F..L.NPTRDM..............VIK...L.NH..pHVD.R..S....GFV....HA..P...........Y.L..K..N.WIY.........PSSN...............LVDL.VRSLSQ.......IFSNDPPL................................................................
A0A6J3RVA4_TURTR/21-141                .......................................................t-VRETVSVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...TT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGEEPPV................................................................
A0A091W717_OPIHO/8-127                 ........................................................TIEELKNVNKTYP.......NF.RFS.MS..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIQLWILDSHPF...........................APP..I..C..F..L.KPTVNM..............GIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VIGL.IKEMIA.......KFEEELPL................................................................
F4S7B0_MELLP/23-145                    .......................................................v-FTQVESALQAYP.......SL.SPK.TE..S.Y..................T...........F.....D.....DGR..A.A...LLLC..LSGTIPV..T.......YR............A...AR....Y.N...........IPIAIWIPHDFPL...........................QPP..I..V..Y..V.TPTSEM..............VIR...K.SA...HIE.P..S....GQC....HA..T...........Y.L..Q..S.WTSk.......pEACS...............LSPL.LIHLQD.......LFSREPPL................................................................
E1ZQP5_CHLVA/29-140                    .......................................................v-QQHMTDLVTDLP.......SL.HVK.SR..N.Y..................V...........H.....T.....DGR..T.V...QLLL..AEGTLPM..Y.......YQ............A...HK....Y.N...........IPVAIWLPEQYPL...........................AAP..M..A..Y..V.VPTPDM..............VIK...P.RH..sFVD.A..S....GLV....HT..P...........Y.I..G..Q.WQY.........PSSN...............LRDM.A-----.......--------qvc.............................................................
A0A2U9BWU3_SCOMX/21-141                ......................................................va--HEIYVAKTCFK.......NI.EPM.MD..K.Y..................V...........Y.....N.....DGT..K.K...DLMS..LTGTLPV..M.......FD............D...ET....Y.N...........IPICLWLEENYPQ...........................SAP..I..C..Y..V.RPTREM..............VIL...R.GD...YTS.S..N....GQV....QL..P...........Y.L..E..E.WKS.........GECD...............LVTL.LQVMQF.......MFGDFPPV................................................................
K7F3U4_PELSI/14-134                    ........................................................TVQETTSVITQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LIGL.IQIMIV.......VFGEEPPV................................................................
S7RTX8_GLOTA/23-145                    ........................................................VYADANAVLSRFP.......TI.RPK.TD..V.Y..................T...........F.....D.....DGR..T.Q...LLLC..LHGLLPI..T.......FR............Q...AS....Y.N...........IPIAIWITHDFPR...........................RPP..L..V..Y..V.VPTSEM..............LVK...A.GK...YMD.V..S....GKC....NI..T...........Y.I..Q..N.WERk.......sEACN...............LLSL.MEEMQD.......EFSREPPV................................................................
W2QT70_PHYPN/25-145                    ......................................................vr--GDVYNLLGQIP.......SL.QPN.CG..T.F..................A...........H.....N.....DGT..T.S...TLLN..LEGTIPI..F.......YR............G...NQ....Y.N...........IPVEFWVVEAYPM...........................SPP..V..C..F..V.RPTADM..............MVK...P.GH..pHVT.S..D....GYV....KI..P...........Y.T..S..D.WRP.........-DFT...............MLEL.VAHMCS.......IFGNMPPV................................................................
A0A6A2YUN1_HIBSY/41-162                .......................................................i-RQHLLSLTFHYP.......SL.QPK.TA..T.F..................T...........H.....N.....DGL..S.V...NLLQ..TDGTIPM..P.......FQ............G...VT....Y.N...........IPVVIWLIESYPR...........................YPP..G..V..Y..V.NPTRDM..............IIK...R.PH..pHVS.P..S....GLV....SI..P...........Y.L..Q..N.WVY.........PSSN...............LVDL.ISNLSS.......AFSLDPPL................................................................
A0A0D2GS94_9EURO/26-148                ........................................................TYSDLAHVLTHNP.......SF.APR.TD..V.Y..................T...........F.....E.....NGA..P.A...LLLQ..FKGTIPV..H.......FR............G...NT....Y.R...........FPIVLWIPHAYPY...........................EAP..M..C..Y..V.TPTEEM..............MIR...P.GQ...HVG.G..D....GRI....YH..P...........Y.L..A..R.WREh.......wERSN...............ILDF.MSILSD.......IFAKEPPV................................................................
A0A6P8V3D5_GYMAC/11-131                .......................................................v-AREIYDALTHFK.......SL.VPL.MD..R.Y..................V...........Y.....N.....DGN..T.K...NLMS..LTGTIPV..M.......FE............D...QT....Y.N...........IPVCLWIEESYPQ...........................TAP..I..C..F..V.RPTHEM..............MLI...G.GQ...YIS.N..S....GEV....VL..P...........Y.L..E..E.WKC.........GECD...............LLSL.LRVMVV.......VFGDFPPV................................................................
A0A2K5SC88_CEBIM/21-141                ........................................................TVEELKNVNMFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A673N5K6_9TELE/31-81                 ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTVPV..S.......YR............G...GL....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------encl............................................................
A0A137Q4B8_9AGAR/21-143                ........................................................VYSHVDAALGRFP.......AL.RPK.LD..V.Y..................I...........F.....D.....DGR..S.H...LLLC..VHGLLPI..K.......YR............N...AQ....Y.N...........IPVAVWITREYPR...........................HPP..I..V..Y..V.VPSADL..............LVK...A.SR...SVD.V..S....GRC....NL..E...........Y.M..Q..Q.WERk.......sEGCN...............LSAL.LDAMVD.......HFSREPPL................................................................
A0A2G4T994_RHIZD/9-130                 ........................................................TFHDVDAVLQTYV.......SL.KPK.MD..T.Y..................T...........S.....N.....DGH..T.Q...LLLC..LHGTIPI..T.......YR............S...IP....Y.N...........IPVAFWVPKEYPS...........................TSP..I..P..Y..V.KPTANM..............LIR...E.GR...HVD.K..S....GLC....YH..Q...........Y.R..S..S.WSN........dQKHN...............LLEL.IAILQQ.......VFAQEPPV................................................................
A0A643C336_BALPH/7-127                 .......................................................t-VRETVSVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...TT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGEEPPV................................................................
A0A287S681_HORVV/101-223               .......................................................i-RNHLVALADAFP.......SL.HPK.AA..L.F..................T...........H.....N.....DGR..A.A...HLLQ..ADGTVPI..H.......HA............G...AT....Y.N...........LPAVIWLPETYPR...........................SPP..L..V..F..L.SPTRDM..............LIK...P.HH..pLVD.R..S....GLV...aNA..P...........Y.L..R..S.WVF.........PSSN...............LLDL.VRSLSH.......LFGLDPPL................................................................
A0A1E3B1H8_9EURO/33-155                ........................................................TYYDVANALAQYP.......SL.SPR.TD..V.Y..................T...........Y.....E.....TGF..S.T...LLLL..IAGTIPV..P.......FR............G...TL....Y.K...........FPVALWIPTTYPR...........................EPP..M..V..Y..V.TPTHDM..............VVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WLEa.......wDRSS...............IADL.LSILRD.......VFATEPPV................................................................
A0A328DSS0_9ASTE/41-162                .......................................................i-RQHLLALIEAYP.......SL.QPK.TG..I.F..................T...........H.....N.....DGR..T.V...YLLQ..ADGTVPM..L.......FQ............G...VT....Y.N...........IPVVIWLMESYPR...........................HPP..L..V..F..V.NPTRDM..............IIK...R.PH..pFVN.P..S....GIV....AI..P...........Y.L..Q..S.WIY.........PSSN...............LVEL.ARNLGH.......YFSRDPPL................................................................
A0A3P8SN78_AMPPE/21-141                .......................................................v-SHDIHVALTYFQ.......NL.VPV.MD..K.F..................V...........Y.....N.....DGT..T.K...NLMS..LTGTVPV..M.......IS............D...KT....Y.N...........IPICLWIEETYPQ...........................TAP..I..C..Y..V.KPTSEM..............MVI...R.GN...YIS.S..N....GEI....LL..P...........Y.L..Q..H.WNK.........DQCD...............IVSL.LQVMVA.......MFGEAPPV................................................................
A0A2G3CTM6_CAPCH/50-170                .......................................................i-RRHLVSLVQDYP.......HF.KPY.ID..A.F..................A...........H.....G.....DGT..S.V...NLLN..ANGELQV..S.......SS............-...-T....P.A...........IPLTIWLHESYPF...........................VAP..I..V..L..V.STNTTY..............PIY...D.NH..pFVD.S.sS....GAV....SS..Y...........Y.L..V..N.WKY.........PGCN...............LSDL.VHNLVK.......IFSLNHP-f...............................................................
A0A3Q4MZ44_NEOBR/24-145                .......................................................t-LCDLHSVQSLFP.......DL.RLY.VD..F.Y..................C...........F.....P.....NKQ..K.K...KLLF..LAGTLPV..Q.......YE............G...SE....Y.N...........IPVCIWLHETHPS...........................SRP..R..C..Y..V.CPSVSM..............VIN...P.TC..pCVD.A..A....GNI....RL..D...........A.L..T..N.WAE.........GVSN...............LSLL.VSEMRR.......AFQKDTPL................................................................
A0A674P2S1_TAKRU/21-141                .......................................................v-SREIKAAVFHYK.......DL.QPV.VD..K.Y..................V...........Y.....N.....DGT..T.K...NLMS..LTGTIPV..A.......YD............G...KT....Y.N...........IPVCVWLEESYPQ...........................TCP..L..C..Y..I.KPTPEM..............MIM...Q.SK...NIT.S..N....GEV....LL..K...........Y.L..D..E.WSP.........DICD...............LVSL.LQVMIS.......LFEDTPPL................................................................
A0A4Z2JC71_9TELE/22-142                ......................................................sv--REITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..T.......YR............G...NI....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGDEPPV................................................................
A0A455CC02_PHYMC/21-141                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...NLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A3B0KNR9_DROGU/22-142                ........................................................TKKDVMDVITTYR.......SL.TYD.LQ..K.F..................V...........F.....N.....DGS..H.K...DLFT..LQGTIPV..V.......YK............N...NT....Y.Y...........IPICIWLMDTHPQ...........................NAP..M..C..F..V.KPTPTM..............QIK...V.SM...YVD.H..N....GKV....YL..P...........Y.L..H..D.WQP.........NSSD...............LLSL.IQVMIV.......TFGDHPPV................................................................
A0A2I0UT15_LIMLA/21-140                ........................................................TIEELKNVSKTYP.......NF.TFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIHLWILDSHPF...........................APP..I..C..F..L.KPTVNM..............GIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VIGL.IKEMIA.......KFEEELPL................................................................
A0A6P5YQ93_DURZI/37-158                .......................................................i-RQNLIAITYHYP.......SL.QPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......FQ............G...VT....Y.N...........IPIIIWLMESYPR...........................HPP..V..V..Y..V.NPTRDM..............IIK...R.PH..pCVT.P..S....GLV....SI..P...........Y.L..Q..N.WIY.........PSSN...............LVDL.VLNLSS.......AFSRDPPL................................................................
A0A6P6A421_DURZI/33-153                .......................................................i-LRHLLSFLQENP.......TF.RPS.TG..R.F..................M...........H.....N.....DGT..E.V...NLLY..ASGCLHV..S.......NS............-...-T....P.P...........IPLIIWLHENYPR...........................KAP..L..V..F..V.SLDPMT..............PIH...R.HH..pFVDnT..S....GAT....SP..P...........Y.I..L..T.WKY.........PPCN...............LTDL.LRNLAH.......LFSHDHP-f...............................................................
W3XDQ3_PESFW/25-147                    ........................................................TYNDVAQALSHYP.......SL.SPR.TD..V.H..................T...........F.....D.....NGA..S.A...LLVH..LSGTIPI..V.......FR............G...QT....Y.R...........FPISIWVPHAYPR...........................EAP..L..G..Y..V.TPTESM..............MIR...P.GQ...HVD.P..Q....GRI....YH..P...........Y.L..A..G.WAEf.......wDKSS...............ILDF.LAILRD.......IFAKEPPV................................................................
A0A0R3T6J5_RODNA/383-503               ......................................................ak--SDIEKALQAFH.......SL.RIK.IQ..D.Y..................T...........S.....D.....NGQ..T.S...RLLC..LDGTIPV..V.......YE............G...NT....Y.N...........IPLAVYFIHQHPY...........................YPP..I..A..F..V.RPTPNM..............QIK...P.SQ...NVD.T..S....GKI....FL..P...........Y.L..T..D.WKY.........PGSS...............TQKL.LEILQG.......VFGARTPV................................................................
A0A3B6MWR5_WHEAT/43-165                .......................................................i-RNHLVALADAFP.......SL.HPK.AA..L.F..................T...........H.....N.....DGR..A.A...HLLQ..ADGTVPI..H.......HA............G...AT....Y.N...........LPAVIWLPETYPR...........................SPP..L..V..F..L.SPTRDM..............LIK...P.HH..pLVD.R..S....GLV...aNA..P...........Y.L..R..S.WVF.........PSSN...............LLDL.VRSLSH.......LFGLDPPL................................................................
A0A672M2Q1_SINGR/24-145                .......................................................v-LDDIKDVTTDFP.......HL.QLY.VN..Y.Y..................F...........Y.....P.....NND..K.K...KLVY..LGGTVPI..T.......YE............G...AT....Y.N...........IPVCIWIHETHPK...........................NPP..R..C..F..V.CPSPSM..............IIN...A.KT..sNVD.A..N....GRV....LL..H...........C.L..S..N.WKI.........GWSN...............LSIV.LEEMIA.......AFQRETPL................................................................
A0A1S9DB08_ASPOZ/382-504               ........................................................TYYDVASVLAQYP.......SL.SPR.TE..V.Y..................T...........Y.....E.....NGF..S.A...LLLQ..LTGTVPV..T.......FR............G...TV....Y.K...........FPISLWVPNTYPR...........................EPP..I..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wERST...............LVDL.VSILRE.......VFAKEPPV................................................................
A0A498NB59_LABRO/22-142                .......................................................t-ARDITNVMSHYK.......DL.KPV.MD..N.Y..................V...........F.....N.....DGS..T.K...ELLS..LTGTVPV..N.......YR............G...NV....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKP.........PQSE...............LLGL.IQVMVV.......VFGEEPPV................................................................
A0A2I0S0C1_9PEZI/25-147                ........................................................TYSDTARALALYP.......SF.APR.TE..V.Y..................T...........H.....E.....NGT..S.A...LLLT..VSGTLPV..A.......FR............G...TT....Y.H...........FPVKVWVPHAYPY...........................EAP..N..V..F..V.TPGNDM..............LVR...P.GQ...HVA.V..D....GRV....YH..P...........Y.L..R..D.WGRm.......wERAS...............ISEL.AECLQQ.......IFGREPPV................................................................
A0A7M7M2M7_NASVI/25-145                ........................................................TRKDVIRVLNHYR.......SL.HWK.IE..P.F..................V...........F.....N.....DGT..R.K...ELIN..LQGTIPV..N.......FK............G...NT....Y.H...........IPICIWVMDTHPN...........................NAP..M..C..Y..V.TPTPDM..............NIK...V.GN...FVD.H..N....GKI....YL..P...........Y.L..H..E.WIP.........HKSD...............LHSL.IQVMII.......IFGEHPPV................................................................
A0A383ZJ66_BALAS/21-141                .......................................................t-VRETVSVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...TT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGEEPPV................................................................
A0A1Y2WM51_9PEZI/25-147                ........................................................TYNDVAQALSQYP.......SL.SPR.TD..V.H..................T...........F.....D.....NGV..S.A...LLLH..LSGTIPV..I.......FR............G...TT....Y.R...........FPISLWIPHAYPR...........................EAP..L..G..Y..V.TPTENM..............MVR...P.GQ...HVD.P..Q....GRI....YH..P...........Y.L..V..G.WAEf.......wDKSS...............LLDF.IAILRD.......IFAKEPPV................................................................
A0A2K5DC34_AOTNA/21-141                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A4V1XDG8_9PEZI/25-147                ........................................................TYNDVAQALSQYS.......SL.SPR.TD..V.H..................T...........F.....D.....NGI..S.A...LLLH..LSGTIPV..V.......FR............G...TT....Y.R...........FPISIWVPHAYPR...........................EAP..L..A..Y..V.TPTENM..............MVR...P.GQ...HVD.P..Q....GRI....YH..P...........Y.L..A..A.WPEf.......wDKSS...............LLDF.LAILRD.......IFAKEPPV................................................................
W9WH85_9EURO/26-148                    ........................................................TYSDLAHILARNP.......SF.APR.TD..V.Y..................T...........F.....E.....NGA..S.A...LLLQ..FKGTIPV..N.......FR............G...NT....Y.R...........FPIAIWVPHAYPY...........................EAP..M..C..Y..V.TPTEEM..............MIR...P.GQ...HVG.G..D....GKI....YH..P...........Y.L..A..H.WREh.......wERSN...............ILDF.LSILSD.......IFAKEPPV................................................................
A0A6I9TUS7_SESIN/31-152                .......................................................i-RQHLLYLTEAYP.......SL.QPK.TA..V.F..................T...........H.....N.....DGR..T.V...NLLQ..ADGTVPM..S.......FQ............G...VT....Y.N...........IPVIIWLMESYPR...........................HAP..L..V..F..V.NPTRDM..............IIK...R.PH..pFVS.P..N....GVV....SI..P...........Y.L..H..S.WVF.........PASN...............LVEL.VRNLSH.......FFARDPPL................................................................
A0A484D3N2_PERFV/22-142                ........................................................TVREITNVISQYK.......DL.KPL.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NI....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A1J6IXI1_NICAT/37-158                .......................................................i-RQHLLSLIETYP.......SL.QPK.TA..T.F..................T...........H.....N.....DGR..T.V...NLLQ..ADGTVPM..V.......YQ............D...VT....Y.N...........IPVIIWLMESYPR...........................HSP..L..V..F..V.NPTRDM..............IIK...R.PH..qFVN.P..S....GVV....SI..P...........Y.L..Q..N.WIY.........PSSN...............LVEL.ARNLSH.......FFGRDPPL................................................................
A0A1X7R8K1_9SACH/35-151                ........................................................TFHDSMVTLTQFG.......QL.RPR.TR..V.F..................T...........G.....S.....DGL..S.R...LLLM..LYGSL--..-.......--............-...--....N.G...........IPILIWLPEDYPA...........................TAP..L..V..Y..I.DIEKMD.............aSQK...Y.GS...LIQ.N..D....GQL....NL..S...........MfF..N..V.WDP.........QTSN...............IAQM.VQAIDQ.......--------lertsliess......................................................
A0A3N0YL56_ANAGA/76-181                ......................................................vl--SEISTVLSHHQ.......YL.EPV.LE..R.F..................V...........F.....N.....DGT..A.K...TLIS..LTGTVEM..F.......YK............G...KR....Y.N...........IPVSLWLKESYPH...........................SAP..I..C..Y..L.KPTREM..............VVV...T.SR...HVS.S..N....GEI....QL..P...........Y.L..D..E.WKH.........Q---...............----.------.......--------ykyrdl..........................................................
H2RCW9_PANTR/21-141                    ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPM................................................................
A0A6P8F4X7_CLUHA/24-145                .......................................................v-LADVRSATATYT.......DL.NLH.VD..F.Y..................C...........Y.....P.....NNE..K.K...KLVY..LGGTIPV..V.......YE............G...NV....Y.N...........IPIRIWIHETHPK...........................SPP..K..C..S..V.CPSVFM..............VIN...A.KS..sFVD.A..S....GHV....HL..H...........C.L..N..N.WKI.........GWSS...............LSIV.LEEMRA.......AFQRETPL................................................................
A0A0B7NQD5_9FUNG/20-128                ........................................................TFRDVDAVLQTYL.......SL.KPK.MD..T.Y..................T...........S.....N.....DGH..T.E...LLLC..LHGTVPI..T.......YR............S...IP....Y.N...........IPVAFWIPKEYPK...........................ASP..I..P..F..V.KPTANM..............MIR...E.DQ...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------agqaiklkhtflelvailqqvfaqeppv....................................
A0A452RY41_URSAM/1-47                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.-----M..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A1W0X599_HYPDU/210-258               ......................................................tm-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..A.......QY............G...AS....Y.N...........IPVEIWIMDSHPY...........................NPP..L..C..Y..V.KPTPDMr............sSIT...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------vtstrtae........................................................
A0A166JDB7_9AGAM/25-147                ........................................................VYADIDSALARYQ.......TL.RPK.SD..V.Y..................T...........Y.....D.....DGR..T.Q...LLLC..VHGLLPI..T.......FR............Q...AS....Y.N...........IPIAIWITREHPR...........................VPP..I..A..Y..V.VPTTDM..............LVK...A.GK...HVE.H..S....GRC....HV..E...........Y.V..Q..H.WERk.......sEACN...............ISGL.LEAMQD.......QFSREPPV................................................................
A0A0F4ZCP5_9PEZI/25-147                .......................................................s-YYDISQVLATYP.......NL.NLQ.NE..V.H..................T...........F.....S.....NGA..S.A...LMLN..IYGTIPV..V.......FR............G...HT....Y.Y...........FPISVWVPHAYPR...........................EPP..I..V..Y..V.TPTPKM..............VVR...P.GQ...YVD.P..Q....GQV....YH..P...........Y.L..S..G.WPTf.......wDKST...............IVDL.LAILID.......VFAKEPPL................................................................
A0A3Q3AX56_KRYMA/24-145                ......................................................al--QDLQTVRARFC.......DL.RLY.VD..F.Y..................C...........F.....P.....NNE..K.K...KLVY..LAGTLPV..L.......FE............G...SE....Y.N...........FPVCIWLHETHPV...........................SRP..R..C..F..V.CPSVSM..............AIN...R.SC..pFVD.A..S....GSV....SL..D...........G.L..R..N.WTH.........GASN...............LSLL.MSEMRR.......AFQKDTPL................................................................
T1GMH8_MEGSC/26-145                    ........................................................TKKDVVQALNAYR.......-L.QYK.VE..S.F..................V...........F.....N.....DGS..S.K...MLFT..LYGTIPV..V.......YK............N...NT....Y.Y...........IPISIILMDTHPH...........................NTP..M..C..F..V.KPTPTM..............QIK...V.SM...YVD.H..N....GKI....YL..P...........Y.L..H..D.WNP.........VQSD...............LLSL.IQVMIV.......TFGEFPPV................................................................
A0A2V0P918_9CHLO/34-155                .......................................................i-REHMSELLKMFP.......TL.TIS.AS..E.F..................H...........T.....N.....DGR..V.L...NLLK..AQGTVPI..H.......FQ............G...VK....Y.N...........IPVIVWLPERYPM...........................HAP..L..V..Y..V.TPTPNM..............VIK...Q.NH..sCVD.P..S....GQV....RS..P...........Y.V..T..A.WLH.........PSSD...............LSSM.VQEMCM.......VFGAEPPL................................................................
A0A383ZIC3_BALAS/1-47                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.-----M..............GIS...V.GK...HVD.T..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A3Q2WQI6_HAPBU/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A3Q7W4I0_URSAR/23-143                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTVPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A091E9C1_CORBR/8-127                 ........................................................TIEELKNVSKTYP.......NF.TFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIHLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..R....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............LIGL.IKEMIA.......KFEEELPL................................................................
A0A6P5LRK7_PHACI/21-141                ........................................................TVEELTKVNMSYP.......NF.RFS.MD..T.Y..................V...........F.....K.....DNS..Q.K...DLLN..FTGTIPV..N.......CQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTPNM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............ITGL.IREMII.......KFQEELPL................................................................
A0A2G9H5P9_9LAMI/30-150                .......................................................i-RQHLNSLFRDFA.......SL.EPS.IG..I.F..................T...........H.....N.....DGS..E.V...KLLN..ANGELTV..S.......RQ............-...-A....P.P...........VPLTIWVHEFYPQ...........................MAP..I..V..Y..V.NLENCM.............yPVY...E.NH..pFVD.Y..S....GAI....IS..S...........Y.L..S..N.WNL.........TKCN...............LSDL.VHNLIK.......LFSHNHP-f...............................................................
A0A2Y9GQN8_NEOSC/32-152                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..S.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A553HVK8_9PEZI/25-140                ........................................................TYNDVARALSQYP.......SL.SPR.TD..V.-..................-...........-.....-.....---..H.T...LLLH..LSGTIPV..V.......FR............G...TT....Y.R...........FPISIWVPHAYPR...........................EPP..L..G..Y..V.TPTDTM..............MVR...P.GQ...HVD.P..Q....GRV....YH..P...........Y.L..V..H.WVEf.......wDKSS...............ILDF.LAILRD.......IFAKEPPV................................................................
A0A2H3J7L6_WOLCO/25-147                .......................................................v-WAHVTALLDRHR.......TV.RPK.TD..V.Y..................T...........F.....D.....DGR..T.Q...LLLC..LHGLLPI..A.......FR............G...AA....Y.H...........IPVAIWLPRDYPR...........................RPP..L..V..Y..V.VPTSDM..............LVR...P.GP...DMD.P..S....GMC....RI..D...........Y.L..R..N.WEAk.......sEGCS...............LAAL.AQAMQD.......AFSRAPPV................................................................
C1H516_PARBA/33-155                    ........................................................TYNDVANLLFQHP.......DF.SPQ.TD..V.Y..................T...........Y.....E.....NGT..P.A...LLLH..ISGTLPV..T.......FR............G...AI....Y.R...........FPLTIWVPKGYPH...........................EPP..M..M..Y..V.TPTQDM..............LVR...P.GQ...HVS.G..E....GRV....YH..H...........Y.L..A..H.WADa.......wDRST...............IVDF.LYILRD.......IFAKEPPV................................................................
A0A5N3XUG8_MUNRE/9-129                 .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A3P8VIM5_CYNSE/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.R...DLLS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPF...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKP.........KVSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A0D2FE01_9EURO/26-148                ........................................................TYSDLAHVLARNP.......GF.APR.TD..V.F..................T...........F.....E.....NGA..S.A...LLVH..FRGTIPV..N.......FR............G...NI....Y.R...........FPISLWVPHTYPY...........................EPP..I..W..Y..V.TPTEDM..............MIR...P.GQ...HVS.G..D....GKV....YH..P...........Y.L..A..H.WREa.......wERSN...............IVDF.LSILSD.......VFAKEPPV................................................................
A0A024UFD9_9STRA/25-145                .......................................................v-RYDVETLLRQIP.......SI.SPQ.HG..V.Y..................T...........H.....N.....NGS..T.S...TMMS..LTGTIPI..Y.......YG............G...NQ....Y.N...........IPVEIWIPEAYPF...........................AAP..T..C..F..V.RPTTDM..............MIR...P.GH..pHVD.Q..N....GLI....VV..P...........Y.S..T..N.WDC.........-DHS...............LVEL.VGYHCS.......IFGAQPPV................................................................
A0A1U8B0V4_NELNU/38-159                .......................................................i-RQQLLSLVNIYP.......SL.QPK.TA..T.F..................T...........H.....N.....DGR..T.V...NLLQ..AEGTIPM..F.......YM............E...VM....Y.N...........IPVVIWLMESYPR...........................QPP..C..V..Y..V.APTRDM..............IIK...R.PH..pHVN.P..S....GLV....SL..P...........Y.L..Q..N.WIY.........PSSN...............LVDL.VRNLSL.......VFGRDPPL................................................................
A0A3B1JMG0_ASTMX/21-141                .......................................................a-IEELQKLNRVYP.......DM.KLK.TG..S.Y..................T...........F.....S.....DST..Q.R...DLLN..LVGNIPV..K.......YK............G...HS....Y.N...........LPIQLWLLDSFPF...........................TPP..I..C..F..L.RPTSNM..............MIR...E.GK...HVD.A..K....GRI....YL..P...........G.L..H..N.WDH.........PKSS...............VSVL.LEEMIA.......KFEEDPPL................................................................
G3JKW1_CORMM/25-147                    ....................................................cydg----IARVLSRYP.......TL.SPR.TD..V.Y..................T...........S.....P.....DGA..S.A...LLVH..LSGTLPV..N.......FR............G...ST....Y.R...........FPLSIWIPHKYPR...........................EPP..M..I..Y..V.TPTESM..............VIR...A.GQ...HVD.Q..Q....GQV....YH..P...........Y.L..V..G.WQQf.......wDKST...............LQDF.LAILAD.......IFAKEPPV................................................................
A0A6J1JB02_CUCMA/44-165                .......................................................i-RQHLVSLTTAFP.......SL.VPR.TA..T.F..................T...........H.....N.....DGR..S.I...NLLQ..SDGTVPM..S.......FQ............G...VT....Y.N...........IPVVIWLMESYPR...........................HPP..C..V..Y..V.NPTRDM..............IIK...R.SH..pHVN.P..S....GMV....SI..P...........Y.L..Q..N.WIY.........PSSN...............LVEL.VRNLSV.......MFGRDPPL................................................................
A0A4V3WLI0_CAMSI/44-165                .......................................................i-RQHLVSLSESYP.......SL.QPK.TA..T.Y..................T...........H.....N.....DGR..T.V...NLLQ..ADGTIPM..L.......FH............G...VT....Y.N...........IPVALWLMESYPR...........................HPP..L..V..Y..V.NPTRDM..............IIK...R.PH..pFVN.P..S....GLV....ST..P...........Y.L..Q..N.WVY.........PSSN...............LLDL.ARDLSH.......YFGRDPPL................................................................
A0A096NGF1_PAPAN/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A078B356_STYLE/1-108                 ...............................................mailkfpge-------------.......--.---.--..-.-..................-...........-.....-.....--I..R.Q...NFIV..LKGAVQC..Q.......AS............P...QP...fN.T...........FPLKIVIPQGFPF...........................HPP..R..V..F..L.DMQISI..............KLL...Q.SK..tYLG.Q..M....NAF....KI..P...........Y.L..N..S.WTNs......aqQKSN...............LVDL.MGYIVG.......ILTNDPPV................................................................
Q4D380_TRYCC/124-207                   ..................................................qapphr-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....Y.V...........LPLQIWLTHLYPI...........................EPP..L..V..F..L.LSAEQG.............cRIA...S.NH..kYVD.A..T....GRC....HT..P...........E.L..A..A.WHP.........VSSS...............LCDV.VKKLCQ.......LLSA----egsipl..........................................................
A0A0K0J4I4_BRUMA/25-145                ......................................................ak--IDILSALSGFP.......DL.TPN.VE..D.F..................I...........Y.....P.....DKT..C.T...LAFC..LKGTIPV..F.......YK............G...KT....Y.N...........IPVALYLWDTHPY...........................YAP..I..C..Y..V.CPTPNM..............VLK...E.SK...TVD.D..L....GRI....SL..P...........Y.L..S..D.WTF.........PGYD...............LSGL.LQVMAM.......CFQDSCPV................................................................
A0A2Y9NWW5_DELLE/21-141                ........................................................TMEELKNVNTFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...NLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A6G0IYY3_LARCR/21-141                .......................................................v-SHEICLALTHFK.......NL.EPI.MD..T.Y..................V...........Y.....N.....DGT..T.K...DLMS..LSGTIPI..M.......FN............D...TS....Y.N...........IPVCLWIEETYPQ...........................TAP..I..C..Y..V.RPTQEM..............MLI...K.GN...YIS.G..N....GEI....LL..P...........Y.L..E..E.WQN.........GECD...............LTSL.IQVMAA.......TFGDFPPV................................................................
A0A803JBS5_XENTR/1-103                 ........................................................-------------.......--.---.MD..S.Y..................V...........F.....N.....DGS..S.R...ELLS..LSGTIPV..P.......YK............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSTM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PPSD...............LLGL.IQILIV.......VFGEEPPV................................................................
A0A6P8UIS2_GYMAC/22-142                ........................................................TVREITNVISQYK.......DL.KPL.MD..A.Y..................V...........F.....N.....DGS..T.R...DLLS..LTGTVPV..S.......YR............G...NT....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A1Y1UV45_9FUNG/1-88                  .......................................................m-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-TGVIPV..T.......YR............N...VT....Y.N...........IPIGIWVMYDYPA...........................SPP..D..F..F..V.MPTENM..............KIV...V.GK...HVT.A..D....GKI....VH..P...........Y.L..D..T.FNS........iPQNS...............LIEF.ISILRK.......IFSTETPV................................................................
A0A556TLG0_BAGYA/22-142                ........................................................TMREIINVINQYK.......DL.KPS.MD..I.Y..................V...........F.....N.....DGS..N.R...ELLS..LTGTVPV..S.......FK............G...IV....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PESD...............LFGL.IQVMIV.......VFGEEPPV................................................................
G1S7V5_NOMLE/21-141                    .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A2I4AIE3_9TELE/24-145                ......................................................al--QDLHTVRARFS.......DL.RLY.VD..F.Y..................C...........F.....P.....NNE..K.R...KLVY..LSGTLPV..L.......FE............G...SE....Y.N...........LPVCIWLHETHPA...........................LCP..C..C..F..V.CPSPTM..............VIN...R.SC..pFVD.A..T....GSV....SL..D...........G.L..R..N.WTH.........GTSN...............LSLL.MSEMRR.......AFQKDTPL................................................................
A0A4W6EIP8_LATCA/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A6P6I826_PUMCO/21-141                ........................................................TVEELKNVNRFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YH............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GVS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A4W3GH84_CALMI/40-159                .......................................................i-IKEFESVQATYR.......DL.IVD.FD..L.F..................S...........Y.....G.....NGV..K.K...KLVR..LRGTIPV..T.......CK............G...RV....R.K...........ISVCIWLHTLHPD...........................MMP..K..C..F..V.WLLTNK..............GIT...-.GN...WVD.I..N....DMM....TS..Q...........Y.L..N..N.WKS.........STSH...............LVGL.LEDIRI.......SFGERVP-p...............................................................
A0A1L7WJV8_9HELO/26-148                ........................................................TYNDVAQTLSHYS.......SL.SPR.TD..V.Y..................T...........Y.....E.....NGK..S.A...LLLQ..LSGTLPV..V.......FR............G...TT....Y.R...........FPITLWIPHAYPL...........................EPP..L..V..Y..A.TPTEGM..............MVR...P.GQ...HVD.P..Q....GKI....YH..P...........Y.L..V..G.WAEf.......wDKSN...............VLDF.LAILRE.......IFAKEPPV................................................................
A0A437DBC6_ORYJA/21-141                .......................................................a-VEELDKVNRVYP.......DM.QVS.TA..T.F..................T...........F.....S.....DST..Q.K...DLLK..ITGVIPV..K.......YE............G...RA....Y.N...........FPIQLWLLDSFPF...........................TPP..I..C..L..L.KPTSSM..............VIR...E.GK...HVD.A..K....GRV....HL..P...........G.L..H..T.WDY.........PKSS...............VVGL.LPEMIA.......KFEEDPPL................................................................
A0A4D8ZJF9_SALSN/32-153                .......................................................i-RQHLMQLVESYP.......SL.HPK.TS..V.F..................T...........H.....N.....DGR..A.V...NLLQ..ADGTVPI..S.......FH............G...AS....Y.N...........IPVIIWLVESYPS...........................RAP..L..V..F..V.NPTRDM..............IIK...R.PH..pFVS.P..N....GVV....SI..P...........Y.L..H..S.WLF.........PSSN...............LLEL.ATNLAQ.......FFASDPPL................................................................
F0Y722_AURAN/5-83                      ............................................avasfgdcggsp-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...-ALA..LVGTVAM..T.......YR............G...HR....Y.N...........LPVEIVLPPGYPA...........................APP..R..V..F..L.RPTPDM..............SVR...D.RH..rHVD.A..A....GVV....YL..P...........L.L..S..A.W--.........----...............----.------.......--------................................................................
A0A673UXC1_SURSU/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YK............G...NI....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
S4RNR7_PETMA/1-99                      ........................................................-------------.......--.---.--..-.-..................V...........F.....N.....DGT..A.R...ELVS..LNGTIPV..N.......YR............G...SI....Y.N...........IPVQLWLFDTHPY...........................NPP..I..C..F..V.KPTSTM..............LIK...Q.GK...HVD.A..N....GRV....YL..P...........Y.L..H..E.WKA.........NASD...............LVGL.IQVMLV.......VFGEEPPV................................................................
A0A671G5D9_RHIFE/21-141                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.VKEMIA.......KFQEELPL................................................................
A0A2Z6SC13_9GLOM/50-174                ........................................................VFRDVDAALAVFK.......AL.IPK.TD..I.Y..................A...........H.....D.....DGT..V.E...VLLC..LYGTIPI..T.......FR............S...TP....Y.N...........IPVAFWIPTDYPM...........................VPP..I..A..F..V.VPTSNM..............LVK...K.SQ...HVD.V..S....GRC....SH..P...........Y.L..E..H.WNPpp.....hnEESN...............LVSL.CSLLQN.......IFGQNPPV................................................................
A0A2V3ISL4_9FLOR/59-181                ........................................................IVRDVVDCCRNFR.......GL.KLE.LE..Q.F..................A...........V.....D.....AAQ..T.S...TLLV..LRGTIPV..K.......YK............S...AT....Y.N...........IPVAIFVPSHYPN...........................EAP..T..P..Y..V.RPTRQM..............VLR...P.RH..sHVD.T..L....GRV....YL..P..........hY.L..A..Q.WDP.........NQFT...............LYGV.VVAMVQ.......VFCIEPPV................................................................
A0A6A2WNQ1_HIBSY/41-162                .......................................................i-RQHLLSLVSNYP.......SL.ETK.AA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..T.......FQ............G...VN....Y.N...........ISVIIWLMESYPR...........................YAP..A..V..Y..V.NPTRDM..............IIK...R.PH..pHVS.P..S....GLV....SI..P...........Y.L..H..N.WIY.........PSSN...............LVDL.IGNLSS.......AFSRDPPL................................................................
A0A310SS95_9HYME/7-127                 .......................................................t-KKHGLKVLGLYK.......GL.MCN.VE..P.F..................V...........F.....N.....DGS..M.K...ELLN..LQGTIPV..S.......YK............G...HI....Y.N...........IPICIWIMDTHPN...........................NAP..M..C..F..V.KPTADM..............SIK...V.SM...YVD.H..N....GKI....YL..P...........Y.L..H..D.WLP.........YSSD...............LLRL.IQTMIS.......TFGEQPPV................................................................
A0A6P7K2D0_9TELE/41-162                .......................................................t-LSDLRRVRSLFS.......DL.RLY.VD..F.Y..................C...........F.....P.....NNQ..K.K...KLVY..LAGTVPV..H.......YE............G...SE....Y.N...........IPVCIWLHETHPV...........................SRP..R..C..Y..V.CPSVSM..............VIN...P.SC..pCVD.A..F....GNI....SL..D...........G.L..S..N.WTH.........GMSD...............LSLL.VSEMRR.......AFQKDTPL................................................................
W2QUZ2_PHYPN/1-60                      .......................................................m-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................SPP..V..C..F..V.RPTADM..............MVK...P.GH..pHVT.S..D....GYV....KI..P...........Y.T..S..D.WRP.........-DFT...............MLEL.VAHMCS.......IFGNMPPV................................................................
A0A2B4RB40_STYPI/304-425               ......................................................cq--TDVVKALKQFN.......SL.QPL.EG..M.F..................V...........Y.....N.....DGR..E.V...ELFS..LEGTIPV..L.......IR............G...IK....Y.N...........IPIQLWLQKRHPY...........................VPP..L..V..I..V.TPTDTM..............EIT...P.SP...LVD.T..N....GNV....YH..P...........C.L..H..T.WHL........eSKSN...............LLDL.LQILCE.......VFAMRPPV................................................................
A0A6J3D488_AYTFU/21-140                ........................................................TIEELKTVNKTYP.......NF.TFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTVNM..............GIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............IVGL.IKEMIA.......KFEEELPL................................................................
A0A0D7A6S4_9AGAR/25-147                ........................................................VYSQVNAALDRFL.......TL.RPK.TD..V.Y..................T...........Y.....D.....DGR..T.Q...LLLC..VHGLLPI..S.......FR............Q...AA....Y.N...........IPISLWIPHDFPR...........................IAP..L..S..Y..V.VPTSDM..............IVK...A.SK...HLD.V..S....GRL....SL..P...........Y.I..M..D.WEKk.......pEACN...............ISAL.LEAMQD.......QFSREPPV................................................................
A0A3Q1C2A7_AMPOC/1-103                 ........................................................-------------.......--.---.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A2K6SIX0_SAIBB/21-141                ........................................................TVEELKNVNKFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A3Q7WSJ0_URSAR/1-80                  .......................................................m-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A2P4ZW90_9HYPO/25-147                .......................................................t-YGDIATVLARYP.......TL.APR.TD..V.Y..................T...........Y.....P.....NGA..S.S...LLVH..LTGTIPT..L.......FR............G...TT....Y.R...........FPVSIWVPHAYPR...........................EAP..L..A..Y..V.TPTETM..............MVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..A..G.WGDf.......wDKSS...............LNDF.LSVLSD.......VFAKEPPV................................................................
A0A0C9ZRW7_9AGAM/24-146                .....................................................vll---DFDTALARFT.......TL.RPK.SD..V.Y..................T...........Y.....D.....DGR..T.Q...LLLC..LHGVLPI..S.......FR............G...AS....Y.N...........IPIAVWVTKEYPR...........................QPP..I..V..Y..V.VPTQDM..............LVR...P.SK...HVD.V..S....GQC....KV..E...........Y.I..Q..H.WEKk.......sEACN...............LSAL.LEALQQ.......EFSRGPPV................................................................
A0A7N8Y779_9TELE/35-155                .......................................................a-VEELQKIHRLYS.......EM.KPS.TG..T.Y..................T...........F.....S.....DSS..Q.K...DLLK..IIGNIPV..K.......YE............G...RS....Y.N...........FPIQLWLMDSFPF...........................TPP..I..C..L..L.RPTPNM..............VIR...E.GK...HVD.G..R....GRI....YL..P...........G.L..H..N.WDY.........PKSS...............VVGL.LTEMIA.......KFEEDPPL................................................................
A0A0D2E049_9EURO/26-148                ........................................................TYSDLAYVLSRNH.......GF.APR.TD..V.Y..................T...........F.....E.....NGV..S.A...LLVH..FKGTIPV..N.......FR............G...NV....Y.R...........FPISLWVPHTYPH...........................EPP..M..C..Y..V.TPTDDM..............VIR...P.GQ...YVG.G..D....GKV....YH..P...........Y.L..A..H.WREa.......wERSN...............LVDF.LSILAD.......VFAKEPPV................................................................
G5AZ94_HETGA/21-133                    .......................................................t-VCETVNVITLYK.......DL.KSV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTRTIPV..L.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................ED-..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------lkkglqkleemvtrldqevpevdkntellkkkdeelssalekmenqsen...............
A0A5N6PVI6_9ASTR/42-163                .......................................................i-RQHLLSLCDSHP.......SL.RHQ.TA..T.F..................T...........H.....N.....DGR..S.V...HLLR..SDGTVPM..V.......FQ............N...VT....Y.N...........IPIVIWLIESYPR...........................HPP..L..V..F..V.NPTRDM..............VIK...R.QH..sFVD.P..S....GLV....SI..P...........Y.L..Q..N.WVY.........PSSN...............LVDL.ARNLSN.......CFGNDPPL................................................................
A0A401KKD7_ASPAW/60-182                ........................................................TYYDVANVLGQYP.......SL.GPR.TE..V.Y..................T...........Y.....E.....NGF..S.A...LLLQ..LTGTLPV..T.......FR............G...TV....Y.K...........FPITLWIPNTYPR...........................EPP..L..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wERSS...............LIDF.LMILRE.......VFAKEPPV................................................................
A0A6P8EXQ8_CLUHA/22-142                ......................................................ai--AEILAAVSQNK.......HL.VPV.MD..K.F..................V...........F.....N.....DGT..T.K...NLLS..LSGTILM..Y.......YG............G...KG....Y.N...........IPVSLWLDESYPR...........................TAP..I..C..Y..V.KPTCEM..............MLL...P.GK...HVN.S..N....GQI....LL..P...........Y.L..N..D.WRH.........TACD...............LHSL.IQVISL.......TFGESLPV................................................................
A0A091T9T5_PHALP/19-139                .......................................................t-IQETTSVITQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
Q5KKQ1_CRYNJ/24-146                    ........................................................ITQEVLYVLQQRR.......TL.AVK.TD..A.F..................T...........F.....D.....SGH..T.A...LLLL..LHGTLPV..T.......YR............G...AI....Y.Q...........IPIHLWVPHEYPR...........................APP..L..I..F..V.MPTKDM..............GVR...K.SR...EVE.P..S....GRV....RE..E...........V.V..E..G.WWRa.......wEVKN...............LDML.LKHLAD.......VFSAAPPV................................................................
A0A1X2GZL2_SYNRA/20-142                ........................................................TFRDVDAVLQMYI.......SL.KPK.MD..T.Y..................T...........Y.....N.....DGH..T.Q...LLLC..LHGTVPI..T.......YR............S...IP....Y.N...........IPVAFWIPSEYPQ...........................HPP..I..P..Y..V.KPTANM..............LVR...E.GK...HVD.K..S....GLC....YH..P...........Y.R..S..S.WVEn.......vNKHN...............LLEL.VAILQQ.......VFGQEPPV................................................................
A0A150GV38_GONPE/2-119                 ....................................................ssdy-------LASVFP.......TL.IAK.LS..E.Y..................H...........G.....N.....DGR..H.H...NVLK..VEGTMPI..H.......YQ............G...NK....Y.N...........IPILMWLTERYPY...........................SPP..Q..V..F..V.VPTANM..............IIR...A.GN...FVN.P..S....GQV....TT..P...........L.L..R..S.WYF.........PASN...............LVDV.VLEMSQ.......VFGNEPPL................................................................
A0A667XEN2_9TELE/24-89                 .......................................................v-AHEIYVALTHYK.......YL.EPI.MD..K.Y..................V...........F.....N.....DGS..V.K...KLMS..LSGTIPV..L.......YN............D...KT....Y.N...........IPVCLWLEETHP-...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------gdgdp...........................................................
A0A1W4WKH5_AGRPL/22-142                .......................................................t-LREILNVVKHYP.......GL.TPL.NE..T.Y..................M...........F.....N.....DGT..Q.M...DLVN..LGGTIPV..R.......YK............G...NV....Y.N...........IPICIWLMDTHPK...........................NAP..I..C..Y..V.KPTSDM..............AIK...V.SM...FVD.Q..N....GKI....YL..P...........Y.L..H..D.WVP.........HTSD...............LLGL.IQVMIV.......TFGEQPPV................................................................
A0A1X2IB77_9FUNG/21-144                ........................................................TFRDVDAVLQMHI......tSL.KPK.MD..T.Y..................T...........Y.....N.....DGH..T.Q...LLLC..LHGTVPI..T.......YR............S...IP....Y.N...........IPVAFWIPTEYPQ...........................YPP..I..P..Y..V.KPTANM..............LVR...E.GK...HVD.K..S....GLC....YH..P...........Y.R..S..N.WKEd.......vNNHT...............LLEL.IAILQH.......IFGNEPPV................................................................
A0A2I2Z5Z3_GORGO/21-71                 ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...VS....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------dtns............................................................
A0A6P6R9Q6_CARAU/24-145                .......................................................v-LNDVKDVSTNFP.......HL.QLY.VD..Y.Y..................F...........Y.....P.....NND..K.K...KLVY..LGGTVPV..T.......YE............G...TM....Y.N...........IPVCIWIHETHPK...........................NPP..R..C..F..V.CPSPSM..............IIN...A.ES..gNVD.A..N....GRI....LL..H...........C.L..N..N.WKI.........GWSN...............LSIV.LEEMIA.......AFQRETPL................................................................
A0A0D2Y2Y3_FUSO4/25-147                .......................................................a-YNDVAQALDRFP.......SL.SPR.TD..V.H..................T...........F.....S.....NGA..N.A...LLLH..LSGTLPV..N.......FR............G...TT....Y.R...........FPISIWVPHAYPR...........................EPP..M..I..Y..V.VPTETM..............MIR...P.GQ...HID.P..Q....GLV....YH..P...........Y.L..V..G.WAEf.......wDKSN...............LRDF.LNILTD.......IFAKEPPV................................................................
A0A0C7MPA3_9SACH/27-147                ........................................................TFRDVMYTLSEFR.......NV.RPR.TK..V.F..................T...........D.....S.....QGK..T.Q...LLLC..LYGRFSS..D.......QV............-...-P....V.S...........VPVLIWIPREYPI...........................LAP..Y..I..F..V.DFDALQd............eKMV...P.GG...IVD.S..S....GRF....RL..P...........M.L..E..S.WNP.........DSCN...............LRDL.AFLLNS.......TIMENPP-f...............................................................
A0A2K5SC35_CEBIM/36-119                ....................................................kysm-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......TY............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
F6YJ85_CALJA/203-323                   .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A2I3LVX1_PAPAN/21-141                ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A165GVM1_EXIGL/22-144                ........................................................VYADVDAVLAAFA.......TL.RPK.TE..V.Y..................T...........F.....N.....DGR..T.Q...LLIC..VHGLVPI..T.......YR............Q...AT....Y.N...........IPISLWIPSGYPR...........................EPP..L..A..Y..V.VPTSDM..............FVR...A.SK...AVD.P..S....GQC....DI..E...........Y.L..R..N.WQRk.......sEGCD...............LIAL.VRALQD.......QFSREPPV................................................................
A0A3P8Z672_ESOLU/19-139                .......................................................a-VEELQKVHRIYP.......EI.KPV.AD..T.Y..................T...........F.....S.....DGT..Q.T...DLIK..LIGNIPV..K.......YE............G...RS....Y.N...........LPILLWLLYSFPF...........................TPP..I..C..L..L.WPTPSM..............VIR...E.GK...HVD.V..K....GRI....YL..P...........G.L..S..N.WDY.........PKSS...............VVGL.LAEMIS.......KFEEEPPL................................................................
A0A4Y9YBC4_9AGAM/32-154                ...................................................dppta-------------.......--.---.--..-.-..................-...........Y.....D.....DGR..T.Q...LLLL..VHGLLPI..T.......YR............Q...AS....Y.H...........IPIAIWLTRDYPK...........................EPP..I..A..Y..V.VPTADM..............LVK...P.GK...YMD.V..S....GRS....SM..E...........Y.L..Q..N.WAR.........KSE-...............----.------.......--------vrlgchpdlarsdgqspqgcslpalldalqllfsqdppv.........................
A0A512U642_9ASCO/26-165                ........................................................TYRDIYRFLSVYLe.....qGF.KIR.TA..V.Y..................T...........S.....A.....SGG..S.D...LLVN..LYGPLTC..G.......NN............-...--....-.T...........VHINVWVPLNYPYadvsrq..............vshndanGVP..I..V..Y..V.VPPKGH..............IVR...P.GN...NVD.S..Q....GQV....YH..P...........F.L..A..Q.WYNsmal.gkpsEQFD...............LLIL.MECLKS.......TFERTSPV................................................................
A0A1L9TM48_9EURO/33-155                ........................................................TYYDVANVLAKFP.......TL.APE.TA..V.Y..................T...........Y.....E.....TGF..S.A...LLLQ..LSGTLPV..N.......YR............G...TV....F.K...........FPIALWIPNTYPR...........................EPP..I..V..Y..V.RPTEYM..............TVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAGa.......wERSS...............IIDL.LSILQD.......VFAKEPPV................................................................
A0A3N4LJU0_9PEZI/33-154                ........................................................TYGDVVQALRNIP.......SL.SPR.TD..V.Y..................T...........H.....E.....TGH..H.E...LLLL..LHGTLPV..N.......FR............G...AT....Y.N...........IPIHVWIPQRYPH...........................QAP..M..A..F..V.VPHKDM..............LIR...P.GN...HVD.G..N....GRC....YH..P...........Y.L..T..G.WGE........yFDSN...............LVDL.CDVLKG.......VFGREPPV................................................................
A0A0D3AIX6_BRAOL/40-161                .......................................................i-RQHLLTLISSHS.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..S.A...ILLQ..ADGTIPM..P.......FQ............G...VS....Y.N...........IPVVIWLLESYPR...........................DPP..R..V..Y..V.NPTRDM..............IIK...R.PH..sNVS.P..S....GLV....SL..P...........Y.L..H..A.WVY.........PSSN...............LLDL.AAQLSA.......AFSRDPPL................................................................
H0ZF66_TAEGU/21-140                    ........................................................TIEELKDVSKTYP.......NF.TFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..R.......YG............-...NS....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIA...V.GK...HVD.A..R....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............LIGL.IKEMIA.......KFEEELPL................................................................
J6E9W4_SACK1/43-173                    ........................................................TFHDSLALLDRFH.......CL.RPR.TR..V.F..................T...........H.....P.....DGT..P.Q...LLLS..LYGTIGS..G.......GN............A...SS...pN.C...........VPVIMWVPNLYPV...........................KPP..F..I..S..I.DLENFDmnt........issSLP...I.QA...YID.S..N....GWV....AL..P...........I.L..G..R.WDP.........ATMN...............LTMI.VQEFTS.......LL------sepsqdrvp.......................................................
A0A3Q3E8T8_9LABR/21-141                .......................................................v-TQEISIALTHFQ.......FL.VPV.MD..K.H..................V...........Y.....N.....DGT..S.K...DLMS..LTGTIPI..K.......CQ............D...KT....Y.N...........IPVCLWLEESFPQ...........................TAP..I..C..Y..I.RPTQEM..............MLL...K.GK...FVS.S..N....GEV....RL..P...........Y.L..E..E.WKH.........GECD...............LVSL.LQVMCV.......IFGDFPPV................................................................
A0A2T2NLE0_CORCC/26-148                ........................................................TYHDVAETLSHYP.......SL.SPR.TE..V.Y..................T...........Y.....E.....NGQ..C.A...LLLH..LGGTLPV..T.......FR............G...AT....Y.G...........FPVAIWVPLAYPR...........................EPP..I..V..Y..V.TPSHDM..............LVR...P.GQ...HVS.G..D....GRI....YH..P...........Y.L..A..Q.WAKy.......wDKST...............IFDF.LAVLRG.......VFAKEPPV................................................................
A0A6I9Z2H5_9SAUR/21-141                ........................................................TIEELKHINELYP.......NI.KFT.MS..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FTSTVPV..K.......YK............G...NI....Y.N...........IPICIWILDSYPF...........................APP..I..C..F..L.NPTANM..............GIS...V.GK...HVD.V..R....GRI....YL..P...........Y.L..Q..A.WSH.........PQSV...............IIGL.LQEMST.......KFEEELPL................................................................
A0A6P6JSG5_CARAU/24-145                ......................................................vl--DEIKDVSADFP.......HL.QLY.VD..C.Y..................L...........Y.....P.....NKD..K.K...RLVY..LGGTVPV..T.......YE............D...AT....Y.N...........IPVCIWIHETHPK...........................NPP..R..C..F..V.CPSPSM..............IIN...A.KS..sSVD.A..N....GRV....LL..H...........C.L..S..N.WKI.........GWSN...............LSIV.LEEMIA.......AFQRETPL................................................................
A0A6J2RG15_COTGO/24-145                .......................................................t-LCDLQKVCSLFS.......DL.RLY.VD..Y.Y..................C...........F.....P.....HKD..K.K...KLVF..LAGTLPV..H.......YE............G...SE....Y.N...........IPVCIWLHETHPL...........................SRP..R..C..F..V.CPSVSM..............LIN...P.AC..sYVE.A..S....GNI....SL..H...........G.L..T..N.WIH.........GVSN...............LSLL.MSEMRR.......AFRRDTPL................................................................
A0A401PUI3_SCYTO/1-98                  ........................................................-------------.......--.---.--..-.-..................-...........F.....N.....NGS..S.Q...ELMS..LTGTIPV..S.......YR............G...NM....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSTM..............MIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PHSE...............LYGL.IQVMIV.......MFGEEPPV................................................................
A0A6J0AA65_ACIJB/23-143                ........................................................TVEELKNVNRFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YH............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GVS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A673BLL7_9TELE/21-103                .......................................................v-AHEISTALTVFK.......HL.VPI.MD..Q.Y..................V...........Y.....N.....DGT..T.K...KLMC..LTGTISA..V.......YK............D...NT....Y.N...........IPVCLWLEESYPQ...........................TTF..C..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------lcilcvafpvncqvvsi...............................................
A0A5C6P8U7_9TELE/21-141                .......................................................a-IEELQKIHRIFP.......DM.IPS.SG..T.Y..................T...........F.....T.....DST..Q.K...DLLK..LIGNLAV..Q.......YG............G...RT....Y.N...........FPVQLWLLDSFPF...........................TPP..I..C..L..L.RPTANM..............VIR...E.GK...HVD.A..R....GRI....FL..P...........G.L..Q..N.WDY.........PKSS...............VVGL.LREMTA.......KFEEDPPL................................................................
A0A6J2XWS3_SITOR/20-140                ........................................................VIRDITTVVRNYQ.......GL.QPQ.QD..N.Y..................T...........F.....L.....DGT..T.R...ELVN..LTGTIPI..N.......YR............G...VV....Y.N...........IPVSIWLIDTHPN...........................NAP..I..C..Y..V.KPTPDM..............SVK...V.SM...FVD.Q..N....GKI....YL..P...........Y.L..H..D.WVP.........GSSD...............LIGL.IQVMIV.......TFSEQPPV................................................................
A0A6J0V308_9SAUR/1-89                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...--MS..LTGTIPV..S.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSTM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LIGL.IQVMIV.......VFGEEPPV................................................................
A0A2K5DC53_AOTNA/36-119                ....................................................rysm-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......TY............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A3M7M7J6_9PLEO/43-165                ........................................................TYHDAAEALSAHT.......SL.SPK.TE..L.Y..................T...........Y.....E.....NGA..S.T...LLLL..LTGTLPV..T.......FR............G...AT....Y.G...........FPVAIWVPHAYPR...........................EPP..I..V..Y..V.TPAHDM..............VLR...P.GQ...HVS.T..D....GRV....YH..P...........Y.L..A..Q.WAKy.......wDKST...............LFDF.LAVLRG.......VFAKEPPV................................................................
G3I257_CRIGR/21-141                    ........................................................TVEELKNVNMYFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DTS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..K....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A6F9AQC7_9TELE/24-145                .......................................................v-VSDIKNATATNG.......DL.RMY.VD..F.Y..................C...........F.....P.....NKE..K.K...KLVY..LSGTIPV..P.......HD............G...NT....Y.N...........IPVCIWLHETHPQ...........................SRP..Q..C..Y..V.CPSISM..............LIN...P.RC..pYVE.A..S....GQV....LL..D...........C.L..T..N.WKS.........GLAN...............LSLL.VSEMRS.......AFQKETPL................................................................
A0A5J4Z4V1_PORPP/28-151                .......................................................i-AQEVASFLVEAP.......TI.SCM.VD..T.Y..................P...........Qp...aA.....NGV..R.P...ILLV..LHGTVPI..V.......FN............Q...ST....Y.H...........IPIKIWLTEYYPD...........................YKP..L..V..F..V.TPTSTM..............QVK...S.GH..pHVD.P..T....GFV....TM..P...........Y.V..H..G.WSA.........RESS...............LSGM.FKELVE.......QFSRIPPV................................................................
A0A2K6F9E8_PROCO/21-132                ........................................................TVEELKNVNVFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........GI--...............----.------.......--------adrlvlldlse.....................................................
A0A6J3EW34_SAPAP/23-143                ........................................................TVEELKNVNMFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A5A7QDV3_STRAF/117-203               ....................................................vtsa----STHLIETYP.......SL.QPK.TA..V.F..................T...........H.....N.....DGQ..P.P...P---..GHGTVPI..F.......FQ............G...VT....Y.N...........IPVIMWLMDSSPE...........................ER-..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------aihmqaedegcatpvwrlrqvvdama......................................
A0A643C2S6_BALPH/7-127                 ........................................................TMEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...NLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.T..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A437DB86_ORYJA/207-327               ........................................................TVREITYVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTVPV..S.......YR............G...NT....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LIGL.IQVMIV.......VFGEEPPV................................................................
A0A2K6MX15_RHIBE/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A1E7FKX5_9STRA/26-147                ...........................................rdtssllkssvgt-------------.......HL.TPG.IS..P.L..................V...........E.....N.....NGD..S.S...HCLV..LQGTIAI..V.......FR............G...MT....Y.Q...........LLVDIYLPPGYPI...........................RPP..V..S..F..V.RLAENM..............YLK...E.SH..pHVG.S..D....GMV....YM..P...........Y.T..H..E.WNP.........RTHS...............LIEM.VVAMSS.......VFSADPPV................................................................
A0A1E5RZY4_9ASCO/54-197                ........................................................IFHDVVVVLQKYLn.....nPL.KIK.TK..V.F..................I...........H.....N.....TGE..S.E...LLLC..LHGVF--..-.......--............-...--....A.S...........IPLLVYVPKNYPE...........................LPP..F..V..M..I.DHEQWN..............RIX...X.EQ...XQQ.Q..Q....---....--..-...........-.-..-..-.---.........----...............----.------.......--------qxlqeerllwvkqqlshyvdshtgflcvtsvlnwnstaerhllrvvddivdllnilsrrfqdhs
A0A0L8GSG2_OCTBM/36-156                ......................................................tk--PDILRAIGVYT.......DL.QPA.RD..K.F..................V...........F.....N.....NGV..E.K...ELVK..LDGTIPV..T.......YR............D...NR....Y.N...........IPICVWLLDTHPH...........................CAP..I..V..Y..V.KPTPNM..............QIK...P.GR...HVD.P..N....GKI....NL..P...........F.L..L..Q.WKY.........PQSD...............LYGL.LNRLAE.......KFGEEPPV................................................................
A0A4W2EGG4_BOBOX/21-127                .......................................................t-VRETVNVISLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.-...----..-------..-.......-R............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..R..F..V.KPTSSM..............TIK...T.AK...HVD.A..N....GKI....CL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
D8LU49_ECTSI/1-48                      ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.-----M..............KLK...V.GH..rHVD.Q..S....GLV....YL..P...........Y.L..H..E.WAA.........RTHN...............LVEL.IANMSG.......VFGAEPPL................................................................
Q2U820_ASPOR/26-148                    ........................................................TYYDVASVLAQYP.......SL.SPR.TE..V.Y..................T...........Y.....E.....NGF..S.A...LLLQ..LTGTVPV..T.......FR............G...TV....Y.K...........FPISLWVPNTYPR...........................EPP..I..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wERST...............LVDL.VSILRE.......VFAKEPPV................................................................
B4LE79_DROVI/22-142                    ........................................................TRKDVVDVVTTYR.......SL.TYD.LQ..K.F..................V...........F.....N.....DGS..S.K...DLFA..LQGTIPV..V.......YK............N...NT....Y.Y...........IPICIWLMDTHPQ...........................NAP..M..C..F..V.KPTPTM..............QIK...V.SM...YVD.H..N....GKV....YL..P...........Y.L..H..D.WQP.........HSSD...............LLSL.IQVMIV.......TFGDHPPV................................................................
A0A2R6QDY1_ACTCC/33-153                .......................................................i-REHLLSLLQYFP.......SL.NLS.MD..T.F..................F...........H.....N.....DGT..T.V...NILK..ATGDLQV..S.......RS............-...-T....P.K...........VHLTIWLHQNYPH...........................IAP..I..V..F..V.SPTSTC..............PIH...R.DH..pFVD.P..N...sGAT....TS..P...........Y.L..L..S.WLY.........PRSN...............LLDL.VQNLVN.......LFSHNHP-f...............................................................
A0A4W6EGG0_LATCA/3-106                 ....................................................sscv-------------.......--.---.--..-.L..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A0V1C283_TRISP/21-141                .......................................................t-KEEIMEALSQFH.......DL.IVR.KD..F.Y..................V...........G.....N.....DGV..R.E...LAIC..FCGTIPV..N.......YM............G...KT....Y.N...........IPICIYLLKNYPH...........................VPP..I..C..F..V.RPTASM..............IVK...P.SS...NVD.S..N....GKI....NV..P...........Y.L..T..E.WHR.........SKSD...............LLGL.LQVLAI.......VFGESCPV................................................................
A0A401RWI9_CHIPU/49-168                ........................................................VMNELKNVQATYR.......NL.SVG.FD..Y.Y..................H...........C.....E.....NGA..K.S...KLVN..LNGTIPV..L.......CR............G...II....Y.N...........VPISIWLHNEHPQ...........................IPP..K..C..F..V.KKLLIL..............HQN...P.GI...HID.N..T....GLV....SS..S...........Y.L..H..N.WRY.........PASH...............LVGL.IEDMRK.......SL------mncli...........................................................
A0A5J5MTW0_MUNRE/21-141                ......................................................ta--CESVNVITLYK.......DL.KPV.LD..S.Y..................I...........F.....N.....DVS..S.R...ELMN..LTGAIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYLY...........................NPP..I..C..L..V.KSTSSM..............TIK...T.GK...HGD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQPD...............LLGL.FQVMIV.......VFGDEPPV................................................................
A0A1Y2AMN7_9TREE/24-146                .....................................................lvp---EILDILTQRR.......TL.SVK.TD..A.F..................T...........F.....D.....SGN..T.A...LLLL..LHGTLPI..E.......YR............G...AT....Y.H...........IPIHIWVPMEYPR...........................TPP..L..A..F..V.VPTKDM..............GVR...K.SK...EVD.P..G....GKV....RE..E...........V.V..A..E.WWRs.......wSAKS...............IEML.LRQLTS.......IFSAAPPV................................................................
A0A1I7VH73_LOALO/25-145                ......................................................ak--NDILLALSGFP.......DL.TPD.VE..H.F..................V...........Y.....P.....DRT..C.T...LAFR..LKGTIPV..L.......YK............G...NT....Y.N...........IPVALYLWDTHPY...........................YAP..I..C..Y..V.CPTPNM..............MLK...E.SK...TVD.K..Q....GRI....YL..P...........Y.L..S..D.WSF.........PGYD...............LSGL.LQVMAM.......CFQDSCPV................................................................
A0A5E4CD44_MARMO/21-141                ........................................................TVEELKNVNMFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...HT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...I.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A314KNM0_NICAT/44-165                .......................................................i-RQHLVSLTDTCP.......SL.QPK.TA..M.F..................T...........H.....N.....DGH..T.V...DLLQ..SDGTVPM..V.......YQ............D...VT....Y.N...........IPVIIWLMESYPR...........................HAP..L..V..F..V.NPTRDM..............IIK...R.QH..pFVN.S..S....GIV....SI..P...........Y.L..S..N.WVY.........PSSN...............LVDL.AGNLSH.......FFSRDPPL................................................................
A0A672SMC4_SINGR/23-85                 .......................................................t-ARDITSVASLYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..T.K...ELLS..LAGTVPV..S.......YR............G...TE....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------stafkkrlrfstpqty................................................
M5W5L6_PRUPE/35-159                    .......................................................i-FADIIQLLFHIP.......SL.GLT.RG..-.-..................R...........F.....Q.....KGE..P.V...-VLV..IKGTIPI..F.......YK............G...HP....Y.K...........TPIKIWVPLGYPT...........................DSP..K..VrvV..V.EDQAIM..............SIK...L.PH..pYVD.AgaG....GLV....NV..P...........Y.M..Q..A.WIEg.......hSERT...............LTGL.VINMCE.......CFSVDPPV................................................................
A0A673MUI6_9TELE/21-141                .......................................................a-IEELNKVSRVHP.......DM.KVI.SA..T.Y..................T...........S.....S.....DSL..Q.K...DLLK..LVGNIAV..R.......YH............G...RS....Y.N...........LPILLWLLDSFPF...........................APP..I..C..F..L.RPTSSM..............VIR...E.GK...HVD.S..K....GRI....HL..P...........G.L..H..S.WDH.........PKSS...............VNGL.LAEMIA.......KFEEEPPL................................................................
G2QGA6_MYCTT/1-49                      ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.-----M..............VVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..V..G.WATf.......wDKST...............ILDF.LAILQD.......VFAKEPPI................................................................
A6QUU5_AJECN/20-142                    ........................................................TYNDVTNLLAQYP.......GF.VLR.TD..V.Y..................T...........Y.....E.....NGT..P.A...LLLQ..LAGTLPV..T.......FR............G...VL....Y.R...........FPITIWVPKAYPR...........................EPP..F..V..Y..V.TPTQDM..............LVR...P.GQ...HVS.G..E....GRV....YH..H...........Y.L..A..H.WSEa.......sDRST...............IVDL.LYILRD.......VFAKEPPV................................................................
A0A3M0JGI3_HIRRU/21-117                ........................................................TIEELKNVSKTYP.......SF.TFS.MN..T.Y..................Ili.......saF.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....C.N...........KPICLWIMDAHPF...........................APP..I..C..F..L.KPTASM..............GVV...V.GK...HVD.A..Q....GET....--..-...........-.-..-..-.---.........----...............----.------.......--------dvksr...........................................................
A0A545WBH6_9HYPO/25-147                ....................................................cydg----IARVLSRYP.......TL.SPR.TD..V.Y..................T...........S.....P.....DGA..S.A...LLVH..LSGTLPV..N.......FR............G...NT....Y.R...........FPLSIWIPHKYPR...........................EPP..I..I..Y..V.TPTESM..............VIR...P.GQ...HVD.Q..Q....GQV....YH..P...........Y.L..V..G.WQQf.......wDKST...............LQDF.LAILAD.......VFAKEPPV................................................................
S8AWA1_DACHA/50-172                    ........................................................TYSDVAALLHHYR.......SL.SPK.TD..V.Y..................T...........Y.....D.....DGR..S.D...LLLC..LHGTLPV..P.......FR............G...AT....Y.N...........IPLNIWVSHQYPN...........................VPP..T..V..M..V.VPGKNL..............GIR...P.TI...NVD.T..N....GRC....YH..P...........Y.L..A..Y.WSQn.......pDKST...............LFDL.CSELKT.......VFSKEPPL................................................................
A0A2K5X8P6_MACFA/36-119                ....................................................kysm-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......TY............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A166LE95_9PEZI/25-147                ........................................................TYNDVAQVLSHYP.......SL.SPR.TD..V.H..................T...........F.....D.....NGV..S.A...LLVH..LSGTIPV..I.......FR............G...TT....Y.R...........FPISIWVPHAYPR...........................DAP..L..V..Y..V.TPTETM..............MVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..V..G.WAAf.......wDKST...............ILDF.LAILRD.......IFAKEPPV................................................................
A0A2P6PKY3_ROSCH/20-140                ........................................sdlsavenqlsslgly-------------.......HF.QLG.IS..Q.F..................S...........Y.....K.....DGS..S.K...TLIG..FSGLIES..R.......KK............-...--....H.N...........LAIVGWLTPDFPR...........................APP..D..I..Y..L.LAKYDE..............VLE...A.NH..qWVR.P..C....GKV....DI..P...........Y.L..Q..Q.WKN.........-HSI...............LSIL.IVELVG.......AFGSWPP-f...............................................................
A0A674KGJ7_TERCA/21-141                ........................................................TVQETTSVITQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LIGL.IQIMIV.......VFGEEPPV................................................................
A0A0C3CKC9_HEBCY/22-144                ........................................................VYADIDAALARFT.......TL.RPK.SD..V.Y..................T...........F.....D.....DGR..T.Q...LLLC..LHGLLPI..T.......FR............N...VS....Y.N...........IPIALWVTRDYPR...........................QSP..I..V..Y..V.VPTNDM..............IVK...S.GK...YVD.V..S....GRC....NI..E...........Y.I..Q..H.WDRk.......pEGCS...............LSAL.LEALQD.......HFSRAPPL................................................................
A0A091EDA7_CORBR/8-128                 .......................................................t-IQETTSVITQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
A0A6P8U4N1_GYMAC/35-119                ................................................mmpstgty-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............S...RS....Y.N...........IPIQLWLMDSFPF...........................TPP..I..C..L..L.RPTSNM..............VIR...E.GK...HVD.K..E....GRL....HL..P...........G.L..H..N.WDY.........PKST...............VVGL.LTEMIS.......KFEEDPPL................................................................
L5LFX5_MYODS/21-141                    ........................................................TVEELKNVNTFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTVPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............VVGL.IKEMIA.......KFQEELPL................................................................
A0A067L012_JATCU/40-161                .......................................................i-RQHLLALIATHP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......FQ............G...VT....Y.N...........IPIIIWLMESYPR...........................HPP..C..V..Y..V.NPTRDM..............IIK...R.PH..pHVN.P..S....GLV....SV..P...........Y.L..Q..N.WIY.........PSSN...............LVDL.VRELGG.......VFGRDPPL................................................................
M1W510_CLAP2/25-147                    ........................................................TYHDVAQALASTP.......TL.SPR.TD..V.H..................T...........F.....P.....NGS..S.A...LLLH..LSGTIPV..N.......FR............G...NT....Y.R...........FPISIWVPHTYPR...........................EPP..L..V..Y..V.TPTETM..............MVR...P.GQ...HVD.P..Q....GLV....YH..P...........Y.L..V..G.WAQf.......wDRSN...............LHEF.ITILSD.......IFAKEPPV................................................................
A0A4W2BQI5_BOBOX/1-102                 .....................................................mvq-------------.......--.---.--..-.-..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..I.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQDELPL................................................................
D8TEQ5_SELML/38-159                    .......................................................i-RQHLVNVIQHFP.......GL.QAR.TA..G.F..................T...........H.....N.....DGR..Q.A...NLLQ..ADGTIPM..Y.......YQ............D...VK....Y.N...........IPVTIWLTEPYPR...........................KPP..L..V..Y..V.SPTRDM..............IIK...P.RH..rLVD.A..S....GMV....SV..P...........Y.L..Q..Q.WVF.........PRSN...............LVEL.VQNLSL.......HFGHDPPL................................................................
A0A1Z5STF9_HORWE/25-157                ......................................................ty--PSVAQALSAYP.......TL.SPR.TE..V.F..................T...........N.....E.....TGR..S.A...LLLV..LAGTLPT..H.......FR............G...AE....Y.R...........FPVKIWFPHTYPR...........................EAP..M..V..F..V.TPGGAM..............AIR...P.GQ...HVG.T..D....GRV....YH..P...........Y.L..R..D.WRG.........MGGAggwedg...grggssLGEF.LRVLIG.......VFEREPP-v...............................................................
A0A6J0APW9_VICPA/1-80                  .......................................................m-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......HQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............RIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..S.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A5D2ULW5_GOSMU/41-162                .......................................................i-RQQLVSLISNYP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......FQ............G...VT....Y.N...........IPIIIWLMESYPR...........................YAP..A..V..Y..V.NPTRDM..............IIK...R.PH..pHVS.P..S....GLV....SI..P...........Y.L..H..N.WIY.........PSSN...............LVDL.VLHLSS.......AFSRDPPL................................................................
W5K090_ASTMX/24-145                    .......................................................v-LADIKEVETAFP.......DL.QLH.VE..F.Y..................Y...........Y.....P.....NND..R.K...KLVN..LRGTVPI..V.......YE............G...NK....Y.N...........IPVCIWIHETHPQ...........................NPP..R..C..Y..V.CPVSSM..............VIN...S.RS..sSVD.A..R....GHV....RL..D...........C.L..S..N.WKT.........GWSN...............LSIV.LEEMVA.......AFQRETPL................................................................
A0A0A0AZC1_CHAVO/10-129                ........................................................TIEELKNVNKTYP.......NF.TFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIHLWILDSHPF...........................APP..I..C..F..L.KPTVNM..............GIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VIGL.IKEMIA.......KFEEELPL................................................................
A0A2J6LRY8_LACSA/42-163                .......................................................i-RQHLISLSETYP.......SL.QPK.TA..I.F..................T...........H.....N.....DGR..S.V...NLLQ..SEGTVPM..V.......FQ............N...VT....Y.N...........IPVVIWLMETYPR...........................HPP..F..V..F..V.NPTRDM..............IIK...A.QH..sFVN.P..S....GLV....SI..P...........Y.L..Q..N.WVY.........PSSN...............LVEL.TRNLSH.......YFGSDPPL................................................................
A0A6A4WJ51_AMPAM/22-142                ......................................................tn--GDVMNALRHYR.......GL.QAK.LS..P.F..................V...........F.....D.....DGT..R.Q...ELCC..LEGTIPV..Q.......YK............G...ST....Y.N...........IPLCIWLMQQHPL...........................VAP..L..V..F..V.KPTADM..............QIK...V.SK...HVD.Y..N....GKV....YL..P...........Y.L..S..D.WSQ.........ASSD...............LLGL.IQVLVI.......IFSEAPPV................................................................
A0A0L0H7J5_SPIPD/21-143                ........................................................VFRDADTVLVNFN.......GL.APK.TD..T.Y..................T...........H.....E.....DGR..T.V...VLLC..LHGTIPI..K.......FR............G...VT....Y.N...........IPIAAWVPYTYPA...........................QPP..I..C..F..V.TPTSSM..............LVR...A.SK...HVD.L..S....GKI....YH..P...........Y.L..A..Y.WHMn.......sEESN...............ILQF.MRTLQE.......IFALEPPV................................................................
A0A2R6X8B5_MARPO/39-160                .......................................................i-RQHLLTLLQDFP.......GL.QVK.TA..N.F..................T...........H.....N.....DGR..T.V...NLLQ..ADGTIPM..Y.......FQ............D...VK....Y.N...........IPIVLWLLEAYPR...........................NCP..L..V..Y..V.TPTRDM..............IIK...P.RH..tYVD.A..S....GMV....NI..P...........Y.L..Q..Q.WVY.........PRSN...............LVEL.IQSTSL.......LFGQDPPL................................................................
A0A175W5H7_9PEZI/25-147                ........................................................TYNDVAQALSQYP.......SL.SPR.TD..V.H..................T...........F.....P.....TGA..S.A...LLLL..LSGTVPV..V.......FR............G...TT....Y.R...........FPISLWVPHAYPR...........................EAP..L..V..Y..V.TPTENM..............MVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..V..G.WSTf.......wDKST...............ILDF.LAILQG.......IFAKEPPV................................................................
A0A0Q9XLH9_DROMO/1-65                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------MDTHPQ...........................NAP..M..C..F..V.KPTPTM..............QIK...V.SM...YVD.H..N....GKV....YL..P...........Y.L..H..D.WQP.........HSSD...............LLSL.IQVMIV.......TFGDHPPV................................................................
A0A1E3QM46_9ASCO/27-123                .......................................................t-YRQSAQLLAFCA.......TL.RPR.TK..V.F..................T...........A.....E.....NGI..P.Q...LLLN..VFGTVPA..N.......IG............N...QV....Y.H...........IPVDMWFPLQFPV...........................EPP..F..V..Y..V.SPTPEM..............LIK...P.GN...FVD.S..N....GRF....YN..P...........Y.L..T..Y.W--.........----...............----.------.......--------................................................................
A0A3A2Z646_9EURO/33-155                ........................................................TYYDVASALAQYP.......SL.APR.TD..V.Y..................T...........Y.....E.....TGF..S.A...LLLH..LTGTVPV..S.......FR............G...TI....Y.K...........FPIALWIPNTYPR...........................DPP..I..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WVEa.......wDRSS...............IVDL.LSILRE.......VFAKEPPV................................................................
A0A6J2AFT9_ACIJB/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YK............G...NI....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A6J8CI84_MYTCO/21-141                .......................................................a-KKDILGVFSQYK.......DL.RPT.HG..P.F..................I...........F.....N.....DGS..Q.K...DLVN..LDGTIPV..N.......YR............G...NI....Y.N...........IPIGIFILDTHPY...........................NPP..I..C..Y..V.KPTNTM..............QIK...Q.GT...NVD.A..N....GKV....DL..P...........Y.L..R..D.WRY.........PQSD...............LLGL.IQILVI.......VFSEEPPV................................................................
A0A2K5DC41_AOTNA/21-72                 ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...VS....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------dinsk...........................................................
A0A0D3BAX9_BRAOL/247-368               .......................................................i-RQHLLNLISSYP.......SL.EPK.TA..T.F..................I...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......YH............G...VT....Y.N...........IPVIIWLLESYPR...........................HPP..C..V..Y..V.NPTADM..............IIK...R.PH..aHVT.P..S....GLV....SL..P...........Y.L..Q..N.WVY.........PSSN...............LVDL.VSDLGA.......AFANDPPL................................................................
G8YNK5_PICSO/26-166                    .....................................................tyt---HLYHFLEVHFdk...nfRF.RIK.TS..I.F..................T...........S....gL.....TGR..S.N...LLIN..LNGSIPT..G.......AD............-...--....T.E...........VPVVIWIPHNYPYssels.................seddmGVP..I..V..F..V.KNDISKg............lYVK...P.GN...HID.S..Q....GKF....YH..P...........Y.L..N..S.WGR.........DYSTnss.........fynLLKL.VDVMKA.......SFEKECPI................................................................
A0A672NKR1_SINGR/21-141                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
H2SE16_TAKRU/24-145                    .......................................................t-LYDLQRVRSQFP.......DL.RLF.VD..F.Y..................C...........F.....L.....NKE..K.K...RLVH..LAGTLPI..L.......YE............G...SE....Y.N...........IPVCIWLHETHPV...........................SRP..R..C..Y..V.CPSVSM..............VIN...P.SC..tCVD.A..T....GII....NL..D...........G.L..R..N.WTH.........GVSS...............LSLL.VSDMVQ.......MFQKDTPL................................................................
A0A3Q1AXL8_AMPOC/24-145                .......................................................t-LSDLQSVRARFS.......DL.RLY.VD..F.Y..................C...........F.....P.....NKE..K.K...KLVY..LAGTLPV..Y.......YE............G...AE....Y.N...........IPVCIWLHETHPV...........................SRP..R..C..Y..V.CPSVAM..............VIN...P.SC..pYVD.A..S....GNI....SV..D...........A.L..N..K.WSQ.........GMSD...............LSQL.VSEIRR.......AFQKDTPL................................................................
A0A2K6KQH4_RHIBE/36-119                ....................................................kysm-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......TY............G...NT....Y.N...........IPIRFWILDSYPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A091VMV0_NIPNI/8-127                 ........................................................TIEELKNVSKTYP.......NF.TFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIHLWILDSHPF...........................APP..I..C..F..L.KPTVNM..............GIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VIGL.IKEMIA.......KFEEELPL................................................................
G5AKA1_HETGA/21-141                    .......................................................t-VRETVSVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A5N5TGQ3_9CRUS/25-145                .......................................................t-RQEAMVAIKHYP.......CL.SPK.KE..S.F..................V...........F.....N.....DGS..E.K...EFLN..LDGTIPV..R.......YK............G...ST....Y.N...........IPICIWLLDNHPL...........................SAP..M..V..Y..V.KPTVEM..............LIK...P.SR...HVD.Q..N....GKV....YL..P...........Y.L..H..E.WNS.........NSSD...............LLGL.IQIMIM.......TFAEMPPV................................................................
A0A2K5SC93_CEBIM/21-141                ........................................................TVEELKNVNMFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A3L6RRQ4_PANMI/44-166                .......................................................i-RNHLVALAEAFP.......SL.HPK.TA..L.F..................T...........H.....N.....DGR..A.A...HLLQ..ADGTIPI..H.......HA............G...AS....Y.N...........LPAVIWLPEPYPR...........................SPP..L..V..F..L.SPTRDM..............VIK...P.HH..pLVD.R..S....GLV...aNA..P...........Y.L..R..S.WVF.........PSSN...............LVDL.VRSLSH.......LFGLDPPL................................................................
A1CLD9_ASPCL/33-155                    ........................................................TYYDVANVLAQYP.......SL.SPR.TD..V.Y..................T...........Y.....E.....NGF..S.A...LLLH..LTGTLPV..T.......FR............G...TV....Y.K...........FPIALWIPNTYPR...........................EPP..M..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wDRSS...............LVDF.LLILRE.......VFAKEPPV................................................................
A0A6J2I0E4_9PASS/1-102                 ........................................................-------------.......--.---.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIQLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VIGL.IKEMIA.......KFEEELPL................................................................
A0A2I2ZHZ1_GORGO/8-128                 ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIHFWILDSHPF...........................APP..I..C..F..L.KPTANM..............RIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPM................................................................
A8MYV4_HUMAN/21-65                     ........................................................TVEELRNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............-...--....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------a...............................................................
A0A665URI5_ECHNA/21-93                 .......................................................v-AHEIYVAISHFK.......DM.VPK.MD..K.Y..................I...........Y.....N.....DGT..A.K...DLMS..LTGTIPA..L.......FA............D...NT....Y.N...........IPICLWIEESYPE...........................TAP..I..C..Y..V.RPT---..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------r...............................................................
A0A0D0E9M2_9AGAM/24-146                .......................................................v-YLDTDAALSRFA.......TL.RPK.SD..V.Y..................T...........Y.....D.....DGR..T.Q...LLLC..VHGLLPI..S.......FG............G...SS....Y.N...........IPIAVWVTREYPR...........................HPP..I..T..Y..V.VPTLDM..............LVR...P.SK...YVD.V..S....GRC....NI..Q...........Y.I..Q..E.WQRk.......sEGCN...............ISAL.LEAMQD.......QFSRVPPL................................................................
A0A3S0ZMU0_ELYCH/23-143                ......................................................ar--YDIMKTLAQYK.......DL.RPS.LD..P.F..................V...........F.....N.....DGN..S.K...KLVQ..LEGTIPV..T.......YK............G...NL....Y.N...........IPISLWIQDTHPY...........................NPP..M..V..F..V.KPTSTM..............QIK...P.SQ...HVD.A..N....GKV....DI..P...........V.L..R..E.WRH.........PASD...............LLTV.VQVLIL.......MFGDECPV................................................................
A0A2U3X124_ODORO/21-141                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0BV93_PARTE/28-158                    .......................................................v-ATDAANILYNYP.......KL.FNP.LI..T.Q..................T...........S.....E.....NGV..I.K...QLLE..LKGELPI..K.......YK............G...ST....Y.S...........IITSIQFPFIYSD...........................APA..V..I..R..IyNPDISKfsv........nqyFIQ...G.AS...QDQ.S..V....VNI....HN..T...........E.L..Q..S.WYQ.........HRSIa............rvMVAL.VRELEG.......--------hfpffnra........................................................
I1LIR0_SOYBN/34-155                    .......................................................i-RQHLVALTTAFP.......SL.EPK.TA..S.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..T.......FQ............G...VT....Y.N...........IPVVIWLMESYPR...........................HPP..C..V..Y..V.NPTRDM..............IIK...R.PH..pHVN.P..S....GLV....SV..P...........Y.L..Q..N.WTY.........PSSN...............LVDL.ILNLSL.......HFGRDPPL................................................................
A0A662WUZ5_9STRA/30-143                .........................................erwlsvslcmppaci-------------.......--.---.--..-.-..................A...........H.....N.....DGT..T.S...TLLN..LEGTIPI..F.......YR............G...NQ....Y.N...........IPVEFWVVETYPM...........................APP..V..C..F..V.RPTADM..............MVK...P.GH..pHVT.S..D....GYV....KI..P...........Y.T..T..D.WRP.........-DFT...............LLEL.VAHMCS.......IFGNMPPV................................................................
A0A670XNN4_PSETE/26-136                ........................................................TIEELKHINELYP.......NI.RFT.MS..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FTGTVPV..K.......YK............G...NI....Y.N...........IPICIWILDSYPF...........................APP..I..C..F..L.NPTPNM..............GIS...V.GK...HVD.V..H....GRI....YL..P...........Y.L..Q..A.WSH.........SKA-...............----.------.......--------flklsenng.......................................................
A0A1V6PK54_PENDC/32-154                .......................................................a-YHDVVNALAQYS.......SL.SPR.TD..V.Y..................T...........F.....E.....NGF..S.A...LLLH..LVGTLPV..V.......FR............G...TT....Y.R...........FPVALWIPNTYPR...........................DPP..I..V..Y..V.TPTHDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wERSN...............ITDL.LLILQE.......VFAKEPPV................................................................
A0A4Q4Y203_9PEZI/68-190                ........................................................TYNDVAQALSQYP.......SL.SPR.TD..V.H..................T...........F.....D.....NGI..S.A...LLLH..LSGTIPV..V.......FR............G...TT....Y.R...........FPISIWVPHAYPR...........................EAP..L..A..Y..V.TPTENM..............MVR...P.GQ...HVD.P..Q....GRL....YH..P...........Y.L..A..A.WPEf.......wDKSS...............LLDF.LAILRD.......IFAKEPPV................................................................
A0A1V4JPY5_PATFA/21-140                ........................................................TIEELKNVNKTYP.......NF.TFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...ELLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VIGL.IKEMIA.......KFEEELPL................................................................
A0A672RY56_SINGR/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A3Q1FPW1_9TELE/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A6Q2XY51_ESOLU/19-139                .......................................................a-VEELQKVHRIYP.......EI.KPV.AD..T.Y..................T...........F.....S.....DGT..Q.T...DLIK..LIGNIPV..K.......YE............G...RS....Y.N...........LPILLWLLYSFPF...........................TPP..I..C..L..L.WPTPSM..............VIR...E.GK...HVD.V..K....GRI....YL..P...........G.L..S..N.WDY.........PKSS...............VVGL.LAEMIS.......KFEEEPPL................................................................
A0A2P7YRW5_9ASCO/26-163                .......................................................a-YSHLYHFLAAYLt.....qGF.KIR.TA..V.Y..................T...........S.....V.....LGH..S.Q...LLIN..LYGKLDC..G.......--............-...-T....C.L...........VPLNIWIPLNYPFqdeni................palepnGVP..V..V..F..V.VPEHGL..............MIR...P.NN...NVD.S..Q....GRF....YH..P...........F.M..A..L.WHQn......ytP--Taqt........rdfsLLLL.MSCLKI.......TFEQNPPL................................................................
A0A6G1FCG2_9ORYZ/41-160                .......................................................i-RNHLVALADAFP.......SL.HPK.AA..L.F..................T...........H.....N.....DGR..A.A...HLLQ..ADGTIPI..H.......HA............G...AS....Y.N...........LPAVLWLPEPYPR...........................SPP..L..V..F..L.SPTRDM..............VIK...P.HH..pLVD.R..S....GLV...aNA..P...........Y.L..R..S.WVF.........PSSN...............LVDL.LA----.......--------arppptedp.......................................................
A0A2U1NWE0_ARTAN/33-152                .......................................................i-RQHLHSLHKEYP.......SL.CPV.ID..P.F..................I...........Y.....N.....DGT..M.V...TLLK..VEGNLHV..S.......HS............-...-L....P.F...........VHINIWIHEHYPN...........................MAP..I..V..Q..V.TLDPTN..............PIR...P.NH..pFVD.L..S....GVT....TS..S...........Y.L..Q..T.WDP.........FGYD...............LLGL.VYNLVK.......IFTLDHP-f...............................................................
A0A2T3A417_9PEZI/25-147                ........................................................TYNDVAQALSHYT.......TL.SPR.TD..V.H..................T...........F.....A.....NGS..S.A...LLVH..LQGTIPV..L.......FR............G...TT....Y.R...........FPISLWIPHAYPR...........................EPP..L..V..Y..I.TPTETM..............MVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..V..G.WAGf.......wDKSN...............ILDF.LAILQD.......VFAKEPPV................................................................
A0A124SDK1_CYNCS/41-162                .......................................................i-RQHLLSLSESYP.......SL.QPK.TA..T.F..................T...........H.....N.....DGR..S.V...HLLQ..SDGTVPM..V.......FQ............N...VT....Y.N...........IPVVIWLMETYPR...........................HAP..F..V..F..V.NPTRDM..............VIK...R.QH..rFVN.P..S....GLV....SI..P...........Y.L..Q..N.WLY.........PSSN...............LVDL.ARDLSN.......YFGSDPPL................................................................
A0A3R7JHA5_9STRA/25-145                ......................................................vr--GDMYNLLGQIP.......SL.QPN.CG..T.F..................A...........H.....N.....DGT..T.S...TLLN..LEGTIPI..F.......YR............S...NQ....Y.N...........IPVEFWVVETYPM...........................APP..V..C..F..V.RPTADM..............MVK...P.GH..pHVT.S..D....GYI....KI..P...........Y.T..S..D.WRP.........-DFT...............LLEL.VAHMCS.......IFGNMPPV................................................................
A0A484D275_PERFV/21-141                .......................................................v-AHEIYVALHHFK.......SL.VPM.MD..K.Y..................V...........Y.....N.....DGT..T.K...NLMS..LTGTIPV..M.......FA............D...QT....Y.N...........IPVCLWFEESYPQ...........................TAP..I..C..Y..V.RPTREM..............MFL...S.GK...YIS.S..N....GEV....TL..P...........Y.L..E..E.WKN.........SECD...............LMTL.LRVMVV.......MFGEIPPV................................................................
A0A2C9UXE2_MANES/36-157                .......................................................i-RQHLLSLIGTYP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......FQ............G...VT....Y.N...........IPIIIWLMESYPR...........................HPP..Y..V..Y..V.NPTRDM..............IIK...R.PH..pHVN.P..S....GLV....SI..P...........Y.L..H..N.WIY.........PSSN...............LVDL.VRELST.......IFGRDPPL................................................................
A0A0J8RW72_COCIT/33-155                ........................................................TYNDVAHLLAQYP.......HF.SPR.TD..V.Y..................T...........H.....E.....NGA..S.A...LLLN..LFGTLPV..S.......FR............G...VL....Y.R...........FPITVWVPTTYPR...........................DPP..I..V..Y..V.TPTKDM..............FVR...P.GQ...HVS.G..E....GRI....YH..H...........Y.L..A..H.WAEa.......sNRST...............IVDF.LYILRE.......VFAKEPPV................................................................
A0A4Y8CP53_9HELO/26-148                ........................................................TYNDVAQTLSQYN.......SL.SPR.TD..V.Y..................T...........Y.....E.....NGA..S.S...LLLH..LSGTLPV..N.......FR............G...TT....Y.R...........FPIALWIPHAYPY...........................EAP..L..V..Y..V.TPVEGM..............VVR...A.GQ...HVD.P..Q....GKV....YH..P...........Y.L..M..R.WPDy.......wDKSN...............VLDF.LAILRD.......IFAKEPPV................................................................
A0A2K6UNI7_SAIBB/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A2K6RHR6_RHIRO/21-141                ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSYPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A7D8YWX3_9HELO/26-143                ........................................................TYNDVAQTLSHYS.......SL.SPR.TE..V.Y..................T...........Y.....E.....NGA..S.A...LLLQ..LSGTLPV..N.......FR............G...TT....Y.R...........FPIALWVQHGYPQ...........................EAP..L..V..Y..V.TPTEGM..............AVR...P.GQ...HVD.P..Q....GKI....YH..P...........Y.L..V..G.WAE.........----...............----.------.......--------fwdvssrrpvgiflretlt.............................................
A0A1B0GS09_MOUSE/1-56                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..D.WKH.........PRSE...............LLEL.IQIMIV.......IFGEEPPV................................................................
A0A4S8J076_MUSBA/49-169                .......................................................i-HQHLAALSHAFP.......TL.RPT.AG..H.F..................T...........H.....N.....DGR..G.A...TLLR..SEGTVPL..A.......TS............-...SS....A.C...........LSISIWLLEAYPN...........................LPP..A..V..F..L.SFPPGT..............AVK...P.RH..pLVD.P..S....GSV....SI..P...........Y.L..R..S.WIF.........PYYN...............LVDL.VRSLAH.......LFSQDPP-f...............................................................
A0A044T413_ONCVO/25-145                ......................................................ak--NDILLALSGFP.......DL.TPD.VE..H.F..................V...........Y.....P.....DRT..Y.T...LAFR..LKGTIPV..L.......YK............G...NT....Y.N...........IPVALYLWDTHPY...........................YAP..I..C..Y..V.CPTPNM..............MLK...E.SK...TVD.K..Q....GRI....YL..P...........Y.L..S..D.WSF.........PGYD...............LSGL.LQVMAM.......CFQDSCPV................................................................
A0A671RE94_9TELE/48-106                ..................................................ssylel-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..L.IPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
W5N311_LEPOC/26-147                    .......................................................v-ISDVSSVQAAYR.......DL.HLY.ID..F.Y..................C...........Y.....A.....NGE..K.K...QLVN..LSGTVPI..L.......YE............G...KS....Y.N...........IPVCIWLHNTHPQ...........................NPP..K..C..F..V.NPSACM..............VIN...A.NS..sYVD.K..N....GHV....RL..H...........Y.L..C..N.WKH.........GTSN...............LLGV.VEEMRT.......AFQSETPL................................................................
W6U800_ECHGR/21-141                    .....................................................ari---DIEKASQAYH.......SL.QVK.LQ..D.F..................T...........F.....E.....NGQ..T.S...KLLC..MEGTIPV..K.......YM............G...NV....Y.N...........IPLAVYFVRQHPY...........................HPP..I..A..Y..V.RPTSSM..............QIK...A.GP...NVD.T..N....GKI....FL..P...........Y.L..S..E.WNF.........PDSS...............TQGL.LEILQN.......VFGQRTPV................................................................
A0A4Q4ZM51_9PEZI/25-147                ........................................................TYNDVAQALSQHP.......SL.SPR.TD..V.H..................T...........F.....D.....NGI..S.A...LLLH..LSGTIPV..V.......FR............G...TT....Y.R...........FPISIWVPHAYPR...........................EAP..L..A..Y..V.TPTENM..............MVR...P.GQ...HVD.P..Q....GRI....YH..P...........Y.L..A..A.WPEf.......wDKSS...............LLDF.LAILRD.......IFAKEPPV................................................................
A0A6I9RFR8_ELAGV/33-151                .......................................................i-RHHLASLSETFP.......SL.RPS.TA..A.F..................T...........Y.....N.....DGR..T.A...TLLH..AEGIIPA..T.......PG............-...--....R.H...........LPASIWLLEAYPH...........................VPP..A..V..F..L.RPARGT..............LIK...P.GH..pHVD.L..S....GAV....DA..P...........Y.L..R..S.WRF.........PKSN...............LADL.VHSLSP.......LFSLESPL................................................................
A0A6P8P3S8_GEOSA/57-177                ........................................................TVEELKNVHKRYP.......NF.MFA.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FVGTIPI..T.......YQ............G...NS....Y.N...........IPVQLWILDSHPF...........................APP..L..C..F..L.KPTATM..............GIH...V.GK...HVD.S..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VLGL.IAEMIL.......KFEEEHPL................................................................
A0A1S3HXZ7_LINUN/30-150                .......................................................a-QRDILQAFSHFK.......DL.RPN.VD..S.F..................V...........F.....N.....DGN..R.K...ELLC..LAGTIPV..T.......YK............G...TI....Y.N...........IPVCVWLLETHPY...........................NPP..V..V..N..V.KPTATM..............QIK...P.GQ...YVD.A..N....GRV....YL..P...........F.L..F..E.WRH.........PQSD...............LLGL.IQIMCI.......IFGETPPV................................................................
A0A6J0V0Z3_9SAUR/18-138                ........................................................TIEELKSVHELYP.......NI.RFT.MS..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YQ............G...NS....Y.N...........IPVCLWILDSHPF...........................TPP..I..C..F..L.KPTANM..............GVS...I.GK...HVD.A..R....GRI....YL..P...........Y.L..Q..H.WSH.........PRST...............IIGL.TEEMIA.......KFEEELPL................................................................
A0A0L7QSC2_9HYME/54-174                ........................................................TKKHIIKVLNVYN.......GL.QYK.VE..P.F..................V...........F.....N.....DGS..R.K...ELFN..LQGTIPV..P.......FK............G...TY....Y.N...........IPICIWLMDTHPN...........................NAP..M..C..Y..V.KPTSDM..............DIK...A.SM...FVD.H..N....GKI....YL..P...........Y.L..H..D.WLP.........HSSD...............LLSL.IQIMIV.......TFGEQPPV................................................................
F1PQX2_CANLF/62-182                    ........................................................TVEELKNVNRFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A383ZIC7_BALAS/21-141                .......................................................t-VRETVSVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...TT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGEEPPV................................................................
A0A6J2RIC8_COTGO/24-145                .......................................................t-LCDLQKVCSLFS.......DL.RLY.VD..Y.Y..................C...........F.....P.....HKD..K.K...KLVF..LAGTLPV..H.......YE............G...SE....Y.N...........IPVCIWLHETHPL...........................SRP..R..C..F..V.CPSVSM..............LIN...P.AC..sYVE.A..S....GNI....SL..H...........G.L..T..N.WIH.........GVSN...............LSLL.MSEMRR.......AFRRDTPL................................................................
A0A4W2BQJ4_BOBOX/21-71                 ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..I.......YQ............G...VS....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------dins............................................................
A0A118JT26_CYNCS/39-160                .......................................................i-RQHLVSLSETYP.......SL.QPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..SDGTIPM..V.......FQ............N...VT....Y.N...........IPVVIWLMETYPR...........................HPP..L..V..F..V.NPTRDM..............IIK...R.QH..aFVN.P..S....GLV....SI..P...........Y.L..Q..N.WVY.........PSSN...............LVDL.ARNLSH.......YFGLDPPL................................................................
A0A384BRC4_URSMA/8-128                 .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YK............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A178ETN9_TRIRU/808-893               ...............................................qllaqfpsf-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...-S....P.R...........TDVYIWVPNTYPD...........................ACP..M..V..Y..V.TPTSEM..............LVR...P.GQ...HVS.S..D....GRI....YH..H...........Y.L..A..H.WAEa.......rDRST...............LVDF.LLILKE.......VFAKEPPV................................................................
A0A6P8YHW8_DROAB/22-142                ........................................................TRKDVVDVITTYR.......SL.TYD.LQ..K.F..................V...........F.....N.....DGS..S.K...DLFQ..LQGTIPV..V.......YK............N...NT....Y.Y...........IPICIWLMDTHPQ...........................NAP..M..C..F..V.RPTPTM..............QIK...V.SM...YVD.H..N....GKV....YL..P...........Y.L..H..E.WQP.........HRSD...............LLSL.IQVMIV.......TFGDHPPV................................................................
M4DKR6_BRARP/36-156                    .......................................................i-RKHLTSFLQDFS.......NF.DLS.TD..T.F..................N...........H.....N.....NGT..T.V...QLFR..LDGSLRT..P.......QQ............-...-S....T.A...........VQLTIWVHENYPL...........................TPP..L..V..F..V.IPPDSM.............tPVR...T.NH..pFVS.S..S....GFT....NS..N...........Y.I..E..T.WEY.........PPCN...............LLNF.VRNLRR.......VLANDHP-f...............................................................
A0A4U5UVK6_COLLU/26-127                ....................................................ltgf-------------.......--.---.--..-.-..................-...........-.....P.....NKQ..K.K...KLVY..LAGTLPV..H.......YE............G...SE....Y.N...........IPVCIWLHETHPV...........................TRP..R..C..Y..V.CPSVSM..............VIN...P.SC..pCVD.A..S....GNI....SL..D...........G.L..K..T.WTH.........GVSN...............LSLL.VSEMRQ.......AFQKDTPL................................................................
A0A068RV50_9FUNG/17-139                ........................................................TFRDVDAVLEMYS.......SL.KPK.MD..T.Y..................T...........Y.....N.....DGH..T.Q...LLLC..VHGTVPI..T.......YR............S...IP....Y.Y...........IPVAFWIPSEYPR...........................SPP..M..P..Y..V.KPTSNM..............LVR...E.GK...HVD.K..S....GLC....YH..P...........Y.R..S..S.WKEn.......pNKHN...............LLEL.VAILQQ.......VFAQEPPV................................................................
A0A2G2YLT3_CAPAN/35-156                .......................................................i-RQHLLSLIEIHP.......SL.QPK.TA..S.F..................T...........H.....N.....DGR..T.V...NLLQ..VIGTVPM..V.......YH............Q...VT....Y.N...........IPVIIWLMESYPR...........................HPP..L..V..F..V.NPTRDM..............VIK...R.AH..pFVN.P..S....GVV....SI..P...........Y.L..Q..N.WVY.........PSSN...............LVEL.ARNLSH.......FFGRDPPL................................................................
A0A1E4TN65_PACTA/34-158                .......................................................s-YQDICSILVRFK.......SI.RPR.TK..V.Y..................T...........N.....E.....LGR..S.Q...LLFN..FYGTVSS..L.......QN............-...-N....Y.Q...........IPVEVWLPFEYPL...........................NPP..I..A..Y..V.VLPAHSn............lVLR...P.NS...YVD.A..N....GQF....QH..P...........F.L..N.yE.WTRm......dhNHDK...............LLKL.FNIMCE.......CFDHECPV................................................................
A0A6J0M848_RAPSA/38-143                ........................................................VYRHVTEALAAYP.......EL.RPK.VE..-.-..................-...........-.....-.....---..-.T...NLLK..LAGAVNG..R.......DF............-...--....-.-...........--VNIYLPSSYPK...........................DPP..H..V..W..I.VCQYGS..............AIN...P.DL..tNVA.P..N....GLV....AI..P...........Y.M..S..N.WDE.........DKSS...............LVSL.ISHLQV.......EFTREPP-t...............................................................
X6MI49_RETFI/24-145                    .....................................................aes---QVLQAIHQVP.......SL.RPE.TC..Q.F..................V...........A.....N.....DGT..S.Q...ILFK..LEGTIPI..T.......YQ............M...KT....Y.H...........IPVVFWLPLDYPA...........................SAP..R..C..F..V.TPVAGM..............KVK...P.RH..pLVD.S..N....GVI....YH..M...........L.L..T..Q.WHY.........SRSS...............LVQL.IGTLCS.......EFGTNPPV................................................................
V4N6T8_EUTSA/40-161                    .......................................................i-RQHLLNLISSYS.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..S.V...ILLQ..ADGTIPM..P.......FQ............G...VT....Y.N...........IPVVIWLLESYPR...........................HPP..C..V..Y..V.NPTRDM..............IIK...R.PH..sNVS.P..S....GLV....SL..P...........F.L..H..N.WVY.........PSSN...............LLDL.ASQLTA.......AFSRDPPL................................................................
A0A4U6WHU0_SETVI/43-165                .......................................................i-RNHLVALAEAYP.......SL.HPK.AA..L.F..................T...........H.....N.....DGR..A.A...HLLQ..ADGTIPI..H.......HA............G...AS....Y.N...........LPAVIWLPEPYPR...........................SPP..L..V..F..L.SPTRDM..............VIK...P.HH..pLVD.R..S....GLV...aNA..P...........Y.L..R..S.WVF.........PSSN...............LVDL.VRSLSH.......LFGLDPPL................................................................
R0JDQ0_ANAPL/1-77                      ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............G...NS....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............IVGL.IKEMIA.......KFEEELPL................................................................
A0A2A4JPS1_HELVI/21-141                .......................................................t-AREVANLIQVYR.......SL.TYR.LE..A.F..................V...........F.....N.....NGT..R.K...DLLN..LEGTIPV..N.......YK............G...AY....Y.N...........IPVCIWLMDTHPQ...........................NAP..L..C..F..V.KPTSDM..............SIK...V.SK...YVD.S..N....GKV....YL..P...........F.L..H..E.WSQ.........NGST...............LQKL.IQCMVA.......AFGELPPV................................................................
A0A0S4JX55_BODSA/24-142                ............................................krirddlldimq-------------.......TL.RLS.IR..G.T..................V...........W.....G.....-DT..S.Q...HKLC..IYGGIPI..G.......SK............-...AD....Y.L...........IPVQIWMTSMYPI...........................DPP..M..I..Y..V.VPSSTE..............KVL...S.NS..rVVD.G..T....GLC....YC..S...........H.L..S..M.WKP.........SSSS...............LRSV.VIQIAK.......AFQSSPPL................................................................
A0A210QTE9_MIZYE/22-142                .......................................................a-KRDVLNVFQQFK.......DL.RPA.YN..P.Y..................I...........F.....N.....DGS..K.K...ELLN..LDGTIPV..S.......YR............S...VT....Y.N...........IPVCIWILDTHPY...........................NPP..M..V..F..V.KPTTSM..............QIK...Q.GR...NVD.A..N....GKV....DL..P...........Y.L..R..D.WRY.........PQSD...............LLGL.IQILVI.......VFSDDPPV................................................................
A0A0D2NUI9_HYPSF/24-146                ........................................................VYADVDAALAAVP.......TL.RPK.SD..V.Y..................T...........F.....D.....DGR..T.L...LLLC..VHGLLPI..T.......FR............N...AS....Y.N...........IPVAVWVTRDYPR...........................QPP..I..A..Y..V.VPTADM..............LVR...A.GR...HVD.V..S....GRC....SV..E...........Y.A..E..Q.WARk.......hEGCH...............LSGL.VAALQD.......QFAREPPV................................................................
S9UWE0_9TRYP/23-161                    ....vvtdidnvtrafsftrkvstwgateqkkmcmyggltisvrqgehgdkqsggs-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...KK....Y.I...........VPVQIWLSSQYPI...........................EPP..I..I..Y..L.IAAAVAadgnn...kdstevKIV...S.NH..pNVD.L..N....GLC....YC..K...........Y.L..S..E.WKP.........RTSS...............LQKA.MRELVR.......EFE-----acgv............................................................
A0A7E6E0J9_9CHIR/21-141                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DDS..Q.K...DLLN..FTGTIPV..I.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTENM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIT.......KFQEELPL................................................................
A0A0E0K7E5_ORYPU/43-165                .......................................................i-RNHLVALADAFP.......SL.HPK.AA..L.F..................T...........H.....N.....DGR..A.A...HLLQ..ADGTIPI..H.......HA............G...AS....Y.N...........LPAVLWLPEPYPR...........................SPP..L..V..F..L.SPTRDM..............VIK...P.HH..pLVD.R..S....GLV...aNA..P...........Y.L..R..S.WVF.........PSSN...............LVDL.VRSLSH.......LFGLDPP-p...............................................................
A0A673UWP2_SURSU/14-134                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GVS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A7M7R5A3_APIME/25-145                ........................................................TKKHVMKVLNLYK.......GL.KCN.VE..P.F..................V...........F.....N.....DGS..R.K...ELFN..LQGTIPV..S.......YK............G...NY....Y.N...........IPICIWLMDTHPN...........................NAP..M..C..Y..V.KPTADM..............SIK...V.SM...FVD.H..N....GKI....YL..P...........Y.L..H..D.WLP.........HSSD...............LLSL.IQIMIV.......TFGEQPPV................................................................
A0A3Q0GE12_ALLSI/8-128                 ........................................................TIEELKNVNKIYP.......NF.LFS.MD..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPI..T.......YH............G...HS....Y.N...........IPVRLWILDSHPF...........................APP..I..C..F..L.KPTVNM..............GIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VIGL.IKEMTA.......KFDEELPL................................................................
A0A5N6JP57_9HELO/26-148                ........................................................TYNDVAQTLSQYT.......SL.SPR.TD..V.Y..................T...........Y.....E.....NGS..S.S...LLLH..LSGTIPV..N.......FR............G...TT....Y.R...........FPIALWIPHAYPQ...........................EAP..L..V..Y..V.TPVEGM..............VVR...A.GQ...HVD.P..Q....GKV....YH..P...........Y.L..M..R.WPDy.......wDKSN...............VLDF.LAILKD.......VFAKEPPV................................................................
A0A074ZQB9_AURSE/26-149                .......................................................a-YSDSVAALSAYP.......SL.SPR.TE..V.Y..................T...........Y.....N.....TGR..P.A...LLLR..LSGTLPV..K.......FR............G...TV....Y.R...........FPVTIWLPHAYPAd.........................pEGI..I..V..F..V.LPGDGM..............AIR...P.GQ...HVG.V..D....GRV....YH..P...........Y.L..R..D.WAV........nQRPN...............LVDF.LRILQD.......VFAREPPV................................................................
A0A2U4CDT3_TURTR/34-154                ........................................................TMEELKNVNTFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...NLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A137P3G2_CONC2/61-185                .....................................................lqh----STAQVTLYN.......KV.DFQ.GN..H.F..................D...........Mr...nQ.....LPL..P.S...LMLN..IYGTLPI..T.......YL............Q...QQ....Y.Q...........IPVSIHLPPNYPL...........................QSP..I..A..K..V.TPTEYM..............LIK...P.TR...CVN.Y..A....GRF....FH..P...........L.L..N..G.WVAd......nqEYYN...............LAQL.IHFMIV.......SFNQEPPV................................................................
A0A317XNA9_9BASI/23-145                ........................................................VYADVDRALIAVS.......SL.SPK.TE..V.F..................T...........F.....N.....DGR..T.Q...LLLT..VNGTIPI..Q.......FR............N...ST....Y.N...........IPVAYWIPREYPR...........................APP..M..A..F..V.VPTPEM..............AIR...K.GP...NVD.P..S....GEI....GG..D...........Y.L..A..R.WSAk.......pEACN...............LLDL.IHQCQH.......MFGREPPV................................................................
A0A7R5KPM3_9PASS/21-140                ........................................................TIEELKNVSKTYP.......NF.TFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIQLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VIGL.IKEMIA.......KFEEELPL................................................................
C3ZUX5_BRAFL/44-143                    .......................................................v-KEETVHVIRSYT.......GL.RPY.RA..P.F..................A...........M.....Q.....NGK..T.K...YFLC..IKGKVPI..M.......KE............G...VM...aF.T...........LHIRMYIHKRHPL...........................SPP..E..V..F..I.RPSRNM..............DIK...A.GQ...NVD.S..E....GRV....YL..P...........Y.L..S..S.W--.........----...............----.------.......--------iy..............................................................
A0A565B0X4_9BRAS/43-154                ..........................................rhlvdlvstglvlq-------------.......--.---.--..-.Y..................K...........I.....D.....NVA..S.V...NLLQ..AYGSIPY..Q.......NK............-...-K....H.S...........VPVTICFPQYYPH...........................LCP..E..V..F..V.NCADDT..............TIQ...E.SN...CVD.S..S....GAV....SH..A...........Y.L..D..S.WKY.........HESN...............VVSL.FKELTK.......EFTDHPPL................................................................
A0A4W3IEG7_CALMI/20-140                ........................................................TIEELKNVHKKYP.......EF.RFS.MD..K.Y..................T...........F.....N.....DGS..Q.R...DLLN..LLGTVPV..T.......YQ............G...FS....Y.N...........IPVRLWILDSHPF...........................GPP..L..C..F..L.RPTPDM..............VIR...E.GK...HVD.V..Q....GRV....YL..P...........G.L..Q..H.WSH.........PKSD...............VVSL.LNEMSL.......TFGNEPPL................................................................
A0A0M3JVD0_ANISI/22-142                ......................................................ak--SDIVTALNIFP.......DL.SPD.AE..T.F..................T...........F.....P.....DGT..R.N...LTFR..LKGTIPV..L.......YK............G...NT....Y.N...........IPVALYLWDTHPY...........................YAP..I..C..Y..V.CPTSNM..............MVK...E.SQ...TVD.K..Q....GRI....YL..P...........Y.L..T..D.WRF.........PGYD...............LSGL.LQVMSL.......CFRETCPV................................................................
A0A498LBS7_LABRO/24-145                .......................................................v-LDDIKDVSTALP.......HL.QLY.VD..Y.Y..................L...........Y.....P.....NND..K.K...KLVY..LGGTVPV..T.......YE............G...AT....Y.N...........IPVCVWIHETHPK...........................NPP..R..C..F..V.CPSPSM..............IIN...A.KS..sNVD.A..N....GRV....LL..H...........C.L..N..N.WKI.........GWSN...............LSIV.LEEMIA.......AFQRETPL................................................................
A0A3M0JH24_HIRRU/21-141                .......................................................t-IQETTSVITQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
A0A6A6NEZ1_HEVBR/36-157                .......................................................i-RQHLLSLIAAYP.......SL.ESK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......FQ............G...VT....Y.N...........IPIIIWLMESYPR...........................HPP..C..V..Y..V.NPTRDM..............IIK...R.PH..pYVN.P..S....GLV....SV..P...........Y.L..H..N.WIY.........PSSN...............LVDL.VRELSP.......IFGRDPPL................................................................
A0A4Z1JTC7_9HELO/26-148                ........................................................TYNDVAQTLSQYT.......SL.SPR.TD..V.Y..................T...........Y.....E.....NGA..S.S...LLLH..LSGTLPV..N.......FR............G...TT....Y.R...........FPIALWIPHAYPH...........................EAP..L..V..Y..V.TPVEGM..............VVR...A.GQ...HVD.P..Q....GKV....YH..P...........Y.L..M..R.WPDy.......wDKSN...............VLDF.LAILRD.......VFAKEPPV................................................................
A0A2Z7D404_9LAMI/7-127                 .......................................................i-REHFISMFQDFP.......SF.KPS.IG..T.F..................T...........H.....N.....DGT..E.V...TLLN..ANGELCV..S.......KD............-...-V....P.V...........VPLTIWLHELYPQ...........................TAP..M..V..Y..V.DSTGSM.............yPIY...Q.DH..pFID.S..S....GAT....TS..S...........Y.L..E..N.WVF.........SKCD...............LSGL.VRDLVK.......LFSYNNP-f...............................................................
A0A6A3JBL9_9STRA/25-145                ......................................................vr--GDVYNLLGQIP.......SL.QPN.CG..T.F..................A...........H.....N.....DGT..T.S...TLLN..LEGTIPI..F.......YR............S...NQ....Y.N...........IPVEFWVVETYPL...........................SPP..V..C..F..V.RPTADM..............MVK...P.GH..pHVT.S..D....GYV....KI..P...........Y.T..S..D.WRP.........-DFT...............LLEL.VAHMCS.......IFGNMPPV................................................................
V8P4X0_OPHHA/1-47                      ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.-----M..............GIS...V.GK...HVD.V..R....GRI....YL..P...........Y.L..Q..A.WSH.........PQSV...............IIGL.LQEMSI.......KFEEELPL................................................................
Q4DP81_TRYCC/124-207                   ..................................................qapphr-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....Y.V...........LPLQIWLTHLYPI...........................EPP..L..V..F.fL.SAERGC..............RIA...S.NH..kYVD.A..T....GRC....HT..P...........E.L..A..A.WHP.........VSSS...............LYDV.VKKLGQ.......LLS-----aeglipl.........................................................
A0A0N4TJU7_BRUPA/25-145                ......................................................ak--IDILSALSGFP.......DL.TPN.VE..D.F..................I...........Y.....P.....NKT..C.T...LAFC..LKGTIPV..F.......YK............G...KT....Y.N...........IPVALYLWDTHPY...........................YAP..I..C..Y..V.CPTPNM..............VLK...E.SR...TVD.D..L....GRI....SL..P...........Y.L..S..D.WTF.........PGYD...............LSGL.LQVMAM.......CFQDSCPV................................................................
A0A093Q5B8_9PASS/8-127                 ........................................................TIEELKNVSKTYP.......NF.TFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIQLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VIGL.IKEMIA.......KFEEELPL................................................................
A0A395SZZ0_9HYPO/1-49                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.-----M..............MIR...P.GQ...HID.P..Q....GLV....YH..P...........Y.L..V..G.WAEf.......wDKSN...............LRDF.LNILTD.......VFAKEPPV................................................................
A0A6A5F794_PERFL/21-141                .......................................................v-AHEIYVALHHFK.......SL.VPM.MD..K.Y..................V...........Y.....N.....DGT..T.K...NLMS..LTGTIPV..M.......FA............D...QT....Y.N...........IPVCLWFEESYPQ...........................TAP..I..C..Y..V.RPTREM..............MVL...S.GK...YIS.S..N....GEV....TL..P...........Y.L..E..E.WKN.........SKCD...............LMTL.LRVMVV.......MFGEFPPV................................................................
A0A0H1BAN3_9EURO/33-155                .......................................................s-YSDVVNLLAQYP.......GF.APR.TD..V.F..................T...........Y.....E.....SGA..P.A...LLLH..VAGTLPV..T.......FR............G...AV....Y.R...........FPITIWVPKAYPR...........................EPP..M..V..Y..V.TPTQDM..............LVR...P.GQ...HVS.G..E....GRV....YH..H...........Y.L..A..H.WSEa.......wDRST...............IVDF.LYILRD.......IFAKEPPV................................................................
A0A0F7TR85_PENBI/32-154                ........................................................TYHDVAHALAQYP.......SL.SPR.TD..V.Y..................T...........Y.....E.....NGF..S.A...LLLH..VVGTLPV..T.......FR............G...TT....Y.R...........FPIALWIPNTYPR...........................EPP..I..I..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wDRST...............ISDM.LSILRD.......VFAKEPPV................................................................
A0A3Q0GEN4_ALLSI/21-141                ........................................................TIEELKNVNKIYP.......NF.LFS.MD..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPI..T.......YH............G...HS....Y.N...........IPVRLWILDSHPF...........................APP..I..C..F..L.KPTVNM..............GIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VIGL.IKEMTA.......KFDEELPL................................................................
S3CWW8_GLAL2/36-176                    .......................................................t-YNDVAQTLSHYS.......SL.SPR.TD..V.YstklsvkpdwicanasstA...........Y.....E.....TGS..S.A...LLLH..LSGTIPV..D.......FR............G...TT....Y.R...........FPIALWVPHGYPH...........................EPP..L..V..Y..V.SPTEGM..............MVR...P.GQ...HVD.P..Q....GKI....YH..P...........Y.L..V..G.WAEy.......wDKSN...............ILDF.LAILRD.......IFAKEPPV................................................................
A0A5J5C6L5_9ASTE/33-152                ......................................................ir--GHLISLLQDFP.......SL.NPS.ID..T.F..................I...........H.....N.....DGT..T.V...NLLK..ANGDLHV..S.......QS............-...-S....I.A...........VPLTIWLHENYPH...........................MAP..L..V..Y..V.SSKSIY..............PIR...R.DH..pFVD.P..S....GAT....AS..P...........Y.L..Q..T.WLY.........PRCN...............LSVL.VHNLAK.......LFSHNHPL................................................................
A0A195FF75_9HYME/25-145                ........................................................TKKHVINVLNTYK.......GL.VYK.IE..P.F..................V...........F.....N.....DGS..R.K...ELLN..LQGTIPV..V.......YK............G...SC....Y.N...........IPICIWLMDTHPN...........................NAP..M..C..Y..V.KPTADM..............HIK...V.SM...FVD.H..N....GKI....YL..P...........Y.L..H..D.WVP.........HNSD...............LLAL.IQVMIV.......TFGEQPPV................................................................
R7V940_CAPTE/21-141                    .......................................................t-KRDILNALRSYT.......DL.RPM.KD..T.F..................I...........F.....N.....DGK..R.Q...ELLC..LTGTIPV..S.......FK............G...ST....Y.N...........IPICLWLMTTHPY...........................NPP..M..V..Y..V.RPTATM..............QIK...P.GK...HVD.T..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQILSI.......VFGEEPPV................................................................
A0A6F9AJN2_9TELE/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..T.R...TLMS..LTGTVPV..S.......YR............G...NI....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A0P7UY60_SCLFO/23-143                ........................................................TVREIVNVISHYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSTM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LFGL.IQVMIV.......VFGEEPPV................................................................
A0A7N6FL93_ANATE/25-145                .......................................................a-IEELQKVHRIYS.......EI.KPF.AG..T.Y..................T...........F.....S.....DST..Q.K...DLLK..LIGNIPV..K.......YE............G...RS....Y.N...........FPIQLWLMDSFPF...........................TPP..I..C..L..L.RPTPNM..............VIR...E.GK...HVD.A..K....GRI....YL..P...........G.L..H..N.WDY.........PKSS...............VVGL.LSEMIA.......KFEDDPPL................................................................
A0A091SQ72_PELCR/8-128                 ........................................................TVQETTSVITQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PKSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
G1PUG0_MYOLU/21-141                    ........................................................TVEELKHVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTVPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............VVGL.IKEMIA.......KFQEELPL................................................................
I1BUF2_RHIO9/20-141                    ........................................................TFRDVDTVLQTYL.......SL.KPK.MD..T.Y..................T...........S.....N.....DGH..T.Q...LLLC..LHGTIPI..T.......YR............S...IP....Y.N...........IPVAFWVPREYPN...........................SSP..I..P..Y..V.KPTASM..............LIR...E.GR...HVD.K..S....GLC....YH..Q...........Y.R..S..S.WSN........dQKHN...............LLEL.VAILQQ.......VFAQEPPV................................................................
A0A314YG75_PRUYE/41-162                .......................................................i-RNHLVSLTTAYP.......SL.DPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..AEGTVPM..L.......FH............G...VT....Y.N...........IPVIIWLMESYPR...........................QPP..V..V..Y..V.NPTRDM..............IIK...R.PH..eHVN.P..S....GLV....SI..P...........Y.L..H..N.WVY.........PSSN...............LVEL.AKNLSA.......VFGQDPPL................................................................
A0A5C7GXG8_9ROSI/40-161                .......................................................i-RQHLISLFTTYP.......SL.DPK.TA..S.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTVPM..P.......FQ............G...VT....Y.N...........IPVIIWLMETYPR...........................HPP..L..V..Y..V.NPTRDM..............IIK...R.PH..pYVT.P..S....GLV....SV..P...........Y.L..Q..D.WVF.........PSSN...............LVDL.VRELSA.......YFAREPPL................................................................
A0A2R8ZX68_PANPA/21-141                ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPM................................................................
K1Q805_CRAGI/56-176                    ......................................................sr--RDVTNAMTHFK.......DL.RPD.HD..L.F..................I...........F.....N.....DGN..R.K...ELLH..LDGTIPV..T.......YK............G...SI....Y.N...........IPICVWIMDTHPY...........................KPP..M..V..F..V.KPTSTM..............QIK...T.GR...HVD.S..N....GKV....DL..P...........Y.L..H..D.WRF.........PQSD...............LLGL.IQILAI.......VFGEEPPV................................................................
C5E3B8_LACTC/82-196                    ........................................................TFRDVVFTLSENT.......AL.RPK.TR..V.F..................T...........D.....F.....QGR..S.Q...LLLC..LYGRL--..-.......--............-...--....E.S...........VPVLVWVPLEYPI...........................AAP..Y..P..F..V.DLEALRg............aRLR...A.NS...YVD.A..N....GAF....SV..P...........A.L..D..R.WDP.........QVST...............VGGL.VSEMAR.......AITEEPPV................................................................
A0A251VU42_HELAN/42-163                .......................................................i-RQHLLSLSESFP.......SL.HPK.TA..T.F..................T...........H.....N.....DGR..T.V...NLLQ..SDGTVPM..L.......FH............N...VT....Y.N...........IPVVIWLMETYPR...........................HPP..L..V..F..V.NPTRDM..............VIK...R.QH..sFVN.P..S....GLV....SI..P...........Y.L..Q..N.WVY.........PSSN...............LVDL.ARNLSH.......YFGVDPPL................................................................
A0A0V1P080_9BILA/21-141                .......................................................t-KEEIMEALSQFH.......DL.IVR.KD..F.Y..................V...........G.....N.....DGV..R.E...LAIC..FCGTIPV..N.......YM............G...KT....Y.N...........IPICIYLLKNYPH...........................VPP..I..C..F..V.RPTASM..............IVK...P.SS...NVD.S..N....GKI....NV..P...........Y.L..T..E.WHQ.........SKSD...............LLGL.LQVLAI.......VFGESCPV................................................................
A0A5A9PRI5_9TELE/39-120                ....................................................vmda-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......-Y............G...NV....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSTM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.M..H..E.WKP.........PQSD...............LYGL.IQVMIT.......VFGEEPPV................................................................
A0A178DZC5_9PLEO/26-148                ........................................................TYHDAAEALSHYP.......SL.STR.TE..I.Y..................T...........Y.....E.....NGA..S.A...LLLL..ISGTLPV..T.......FR............G...AT....Y.G...........FPVAIWVPHSYPR...........................EPP..I..V..Y..V.TPSQDM..............VVR...P.GQ...HVS.G..D....GRV....YH..P...........Y.L..A..Q.WAQy.......wDKST...............LFDF.LAVLRG.......VFTKEPPV................................................................
A0A436ZS07_9PEZI/26-148                .......................................................a-YTDTATLLHHHR.......SL.SPK.TE..V.Y..................T...........Y.....D.....DGR..S.D...LLLC..IHGTLPV..A.......FR............G...AT....Y.N...........IPLNIWVPHQYPD...........................TPP..T..V..M..V.VPGKNM..............GIR...P.TN...HVD.T..N....GRC....YH..P...........Y.L..A..Y.WSQn.......pDKST...............LVDL.CGQLKD.......VFGKEPPL................................................................
A0A6P7TMX3_OCTVU/36-156                ......................................................tk--PDILRAIGVYT.......DL.QPA.RD..K.F..................V...........F.....N.....NGV..E.K...ELVK..LDGTIPV..T.......YR............D...NR....Y.N...........IPICVWLLDTHPH...........................CAP..I..V..Y..V.KPTPNM..............QIK...P.GR...HVD.P..N....GKI....NL..P...........F.L..L..Q.WKY.........PQSD...............LYGL.LNRLAE.......KFGEEPPV................................................................
Q4E191_TRYCC/77-161                    .................................................eqapphr-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....Y.V...........LPLQIWLTRLYPI...........................EPP..L..V..F..L.LSAEQG.............cRIA...S.NH..kYVD.A..T....GRC....HT..P...........E.L..A..A.WHP.........VSSS...............LCDV.VKKLCQ.......LLS-----aeglipl.........................................................
Q4N7T6_THEPA/34-148                    .......................................................l-MIDLDGLFLKYH.......NF.KCS.M-..-.-..................-...........-.....S.....TSF..D.G...HRLN..IVGLVPY..T.......FS............G...FT....V.N...........APLVIQVLSDYPF...........................STP..L..F..W..I.RGHNIK..............IVK...N.HP...NVD.L..R....GNV....TL..K...........Y.L..D..E.WNH.........-TSK...............LVQA.VDCLHY.......AFNKMSPI................................................................
A0A3P7NMR2_DIBLA/29-149                ......................................................ar--SDIEAATRAYP.......SL.PVK.YQ..S.F..................T...........F.....D.....DGT..T.S...DLLS..LDGTLPV..T.......YD............G...HT....Y.N...........IPVAVFFLAAHPH...........................LPP..M..V..Y..V.RPTSSM..............EIK...K.GK...NVD.N..S....GRV....YL..P...........Y.I..S..S.WKH.........PQSN...............TVQL.LHLLRQ.......VFSQNPPV................................................................
A0A4W2BTM9_BOBOX/21-141                .......................................................t-VRETVNVISLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A6P5ANF4_BRABE/39-168                ......................................................tr--EETAHAISRFP.......TL.EAA.VG..E.G..................L...........A.....E.....AGHigS.T...VRLC..LEGAVPI..R.......HN............G...KH....Y.G...........IPMVFVLPRKFPH...........................DPP..T..C..L..V.RPACTDtg..........taPIR...E.SQvclCVE.T..S....GKI....TF..P...........Y.L..E..D.WNY.........RTSN...............LTTL.IEIITA.......HFGERPPV................................................................
A7TQ78_VANPO/37-155                    ........................................................VFHDSLVILSQFK.......EI.RPR.TR..V.Y..................T...........S.....S.....KGI..P.Q...LLLC..LYGKFDI..Y.......NN............-...--....-.K...........IPILLWIPKNYPY...........................EHP..L..L..Y..I.DLELLSe............yKVS...M.GR...YVD.S..N....GAV....HL..P...........I.F..D..R.WDS.........QQCN...............IFRV.IKEFLS.......ESSEHIPI................................................................
A0A0D2RDW6_GOSRA/41-162                .......................................................i-RQHLLSLTSRYP.......SL.QPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......YQ............G...VT....Y.N...........IPIIIWLIESYPR...........................YPP..V..V..Y..V.NPTRDM..............IIK...R.PH..pHVS.P..S....GLV....SI..P...........Y.L..Q..N.WIY.........PSSN...............LVDL.VVNLGS.......AFSHDPPL................................................................
A0A2K5ZMK0_MANLE/21-141                ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A6I9NDS3_9TELE/22-142                ........................................................TVREITNVISQYK.......DL.KPL.MD..A.Y..................V...........F.....N.....DGS..T.R...DLLS..LTGTVPV..T.......YR............G...NT....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A093GJ43_DRYPU/11-131                ........................................................TVQETTSVITQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFAEEPPV................................................................
F2SC78_TRIRC/28-150                    ........................................................TYSDTAQLLAQFP.......SF.SPR.TD..V.Y..................T...........Y.....E.....NGA..S.A...LLLH..LTGTLPV..H.......FR............G...AL....Y.W...........FPIAVWVPNTYPD...........................ACP..M..V..Y..V.TPTSEM..............LVR...P.GQ...HVS.S..D....GRI....YH..H...........Y.L..A..H.WAEa.......rDRST...............LVDF.LLILKE.......VFAKEPPV................................................................
A0A368UHC3_SOYBN/40-151                ................................................hhclpfpr-------------.......--.-AQ.TA..S.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..T.......FQ............G...VT....Y.N...........VPVVIWLAESYPR...........................LPP..C..V..Y..V.NPTRDM..............IIK...R.PH..pHVN.P..S....GLV....SV..P...........Y.L..L..N.WTY.........PSSN...............LSSI.------.......--------sfsisastsaat....................................................
A0A2I4AZT6_9TELE/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSTM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A4Z1K801_9HELO/26-148                ........................................................TYNDVAQTLSQYT.......SL.SPR.TD..V.H..................T...........Y.....E.....NGA..S.S...LLLH..LSGTLPV..N.......FR............G...TT....Y.R...........FPIALWIPHAYPH...........................EAP..L..V..Y..V.TPVEGM..............VVR...A.GQ...HVD.P..Q....GKV....YH..P...........Y.L..M..R.WPDy.......wDKSN...............VLDF.LAILRD.......IFAKEPPV................................................................
A0A6P8ES53_CLUHA/24-145                .......................................................v-LADVRSATATYT.......DL.NLH.VD..F.Y..................C...........Y.....P.....NNE..K.K...KLVY..LGGTIPV..V.......YE............G...NV....Y.N...........IPIRIWIHETHPK...........................SPP..K..C..S..V.CPSVFM..............VIN...A.KS..sFVD.A..S....GHV....HL..H...........C.L..N..N.WKI.........GWSS...............LSIV.LEEMRA.......AFQRETPL................................................................
A0A452J4W8_9SAUR/21-141                ........................................................TVQETTSVITQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LIGL.IQIMIV.......VFGEEPPV................................................................
A0A165T739_9AGAM/25-147                ........................................................VYADVNAVLSRFP.......TI.RPK.TD..V.Y..................T...........F.....D.....DGR..T.Q...LLLC..VHGLLPI..T.......FR............Q...AS....Y.H...........IPIAIWVAHDYPR...........................QPP..L..V..Y..V.VPTSDM..............LVK...A.GK...YMD.V..S....GRC....NI..P...........Y.V..Q..N.WERk.......sEACN...............LLSL.MEDMQE.......QFSREPPV................................................................
A0A1S3FES6_DIPOR/21-149                ........................................................TVEELKNVNTFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WNH.........F---...............----.------.......--------lvviftvnslgnsesyldvvqsnvdmfrt...................................
F6ZA94_HORSE/21-141                    .......................................................t-VRETVNVITLYK.......DL.KPV.VD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NI....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A673BR49_9TELE/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
M3WN71_FELCA/21-141                    ........................................................TVEELKNVNRFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YH............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GVS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A1Y2E4C4_9FUNG/24-144                .......................................................i-YDEFDEVLSQYN.......GL.NPK.FD..K.H..................V...........F.....R.....-GC..F.Y...NLLG..MIGVIPV..T.......YR............N...VT....Y.N...........IPIGIWVMYDYPL...........................TPP..E..F..V..V.MPTENM..............KIV...V.GK...HVK.P..D....GVI....TH..P...........Y.L..D..T.YAS........rPQNR...............MIEF.ISILRK.......IFSTETPV................................................................
M0XLK7_HORVV/43-165                    .......................................................i-RNHLVALADAFP.......SL.HPK.AA..L.F..................T...........H.....N.....DGR..A.A...HLLQ..ADGTVPI..H.......HA............G...AT....Y.N...........LPAVIWLPETYPR...........................SPP..L..V..F..L.SPTRDM..............LIK...P.HH..pLVD.R..S....GLV...aNA..P...........Y.L..R..S.WVF.........PSSN...............LLDL.VRSLSH.......LFGLDPPL................................................................
A0A1Q8RA01_9PEZI/25-147                ........................................................TYNDVAQALSQYP.......SL.APR.TD..V.H..................T...........F.....D.....SGA..S.A...LLLH..LSGTIPV..I.......FR............G...TT....Y.R...........FPISVWVPHAYPR...........................EAP..L..V..Y..V.TPTESM..............MVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..V..G.WGAf.......wDKST...............ILDF.LAILRD.......IFAKEPPV................................................................
W5M1C4_LEPOC/21-141                    .......................................................a-IEELQKVHRVNP.......GF.KPL.VD..T.Y..................T...........F.....S.....DSS..Q.K...DLLK..LVGNIPV..S.......YQ............G...RS....Y.N...........LPILLWLLDSFPF...........................TPP..I..C..L..L.RPTPSM..............MIR...V.GK...HVD.A..R....GRI....YL..P...........Y.L..H..N.WDH.........PASS...............VNGL.LSEMIA.......KFEEEPPL................................................................
A0A6J3RVF1_TURTR/1-120                 ........................................................-MEELKNVNTFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...NLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A2G8KR74_STIJA/22-142                .....................................................tks---AILSTLSAFN.......DL.RPK.YD..K.F..................V...........F.....S.....DNT..R.K...DLLC..LDGTIPV..S.......FK............G...AT....Y.N...........IPICIWLFETHPY...........................NPP..M..C..Y..V.RPTQVM..............MIK...P.SK...HVD.A..N....GRV....YL..P...........Y.L..H..E.WKH.........PNSD...............LIGL.IQVMTI.......IFGENSPV................................................................
A0A3Q1CK35_AMPOC/21-141                .......................................................a-VEELQKIHRIYP.......GM.RPS.TG..T.Y..................T...........F.....S.....DST..Q.K...DLLK..LTGNIPV..K.......YE............G...RS....Y.N...........FPIQLWLMDSFPF...........................TPP..I..C..L..L.KPTPNM..............VIR...E.GK...HVD.A..R....GRI....YL..P...........G.L..H..N.WDH.........PKSS...............VVGL.LTEMIA.......KFEEDPPL................................................................
A0A2U3ZWE0_ODORO/8-128                 .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YK............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A5A7PKZ1_STRAF/83-183                ....................................................vtsa----TTHLIETYP.......SL.QPK.TA..V.F..................T...........H.....N.....DGQ..P.P...P---..GHGTVPI..F.......FQ............G...VT....Y.N...........IPVIMWLMDSSPE...........................ER-..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------aihmqaedegcatpvwwrtrqvvemhaglasegrsklkml........................
G3SSV7_LOXAF/21-141                    .......................................................t-VRETINVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A3Q3L896_9TELE/14-134                .......................................................a-VEELQKIHRLYS.......EM.KPS.TG..T.Y..................T...........F.....S.....DSS..Q.K...DLLK..IIGNIPV..K.......YE............G...RS....Y.N...........FPIQLWLMDSFPF...........................TPP..I..C..L..L.RPTPNM..............VIR...E.GK...HVD.G..R....GRI....YL..P...........G.L..H..N.WDY.........PKSS...............VVGL.LTEMIA.......KFEEDPPL................................................................
A0A0N4U421_DRAME/22-142                ......................................................ak--SDIIIALNSFP.......DL.SPE.AE..N.F..................V...........F.....P.....DGH..R.R...LSFR..LKGTIPV..F.......YK............G...NT....Y.N...........IPVALYLWDTHPY...........................YAP..I..C..F..V.CPTSTM..............MIK...E.SK...TVD.K..Q....GRI....YL..P...........Y.L..T..D.WRF.........PGYD...............LSGL.LQVMAC.......YFQESCPV................................................................
A0A4W2E7Y4_BOBOX/21-141                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..I.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQDELPL................................................................
N4V0F1_FUSC1/34-156                    .......................................................a-YNDVAQALDRFP.......SL.SPR.TD..V.H..................T...........F.....S.....NGA..N.A...LLLH..LSGTLPV..N.......FR............G...TT....Y.R...........FPISIWVPHAYPR...........................EPP..M..I..Y..V.VPTETM..............MIR...P.GQ...HID.P..Q....GLV....YH..P...........Y.L..V..G.WAEf.......wDKSN...............LRDF.LNILTD.......IFAKEPPV................................................................
A0A2N6NZM9_BEABA/55-156                .................................................fqsnsaa-------------.......--.---.--..-.-..................-...........S.....P.....DGT..S.A...LLVH..LSGTLPV..N.......FR............G...NT....Y.R...........FPLSIWIPHRYPR...........................EPP..I..I..Y..V.TPTESM..............VIR...P.GQ...HVD.Q..Q....GQV....YH..P...........Y.L..V..G.WQQ.........---F...............WDDF.LAILAD.......VFAKEPPV................................................................
A0A058ZEX7_FONAL/101-223               .....................................................ils---NLERLLARFP.......HL.GIQ.FK..-.-..................-...........-.....P.....NHQ..N.E...ECCV..IQGYILY..R.......FR............D...RN....Y.Q...........APVYVWLPKDFPK...........................QRP..A..F..Y..V.VKNTEHwr.........apvSFN...P.AA..kFIE.R..Q....GNL....VI..P...........H.L..Q..S.WHE.........SSPD...............LANL.FVAFQN.......QINQTPPL................................................................
A0A0V0R635_PSEPJ/20-144                ..................................................vnkacy------SITNLYP.......GL.KPN.L-..I.Q..................Q...........R.....D.....GNF..T.R...NLLE..LQGDIDV..L.......YK............Q...QK....Y.G...........IQTKVFFPYMYPT...........................APA..V..I..K..IvNIDQNKf...........rvSDR...Y.KQ...GLQ.S..D....GTVi..vYL..S...........E.L..Q..N.WAY.........-HRD...............PIKL.LKQLQK.......QLGEHFP-f...............................................................
A0A6A3BH57_HIBSY/41-162                .......................................................i-RQHLLSLVSNYP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......FQ............G...VT....Y.N...........IPIIIWLMESYPR...........................YAP..A..V..Y..V.NPTRDM..............IIK...R.PH..pHVS.P..S....GLV....SI..P...........Y.L..H..N.WIY.........PSSN...............LVDL.VVNLSS.......AFSRDPPL................................................................
A0A5N6FIE0_PETAA/33-155                ........................................................TYYDVALVLAQYP.......SL.SPR.TE..V.Y..................T...........Y.....E.....NGY..S.A...LLLQ..LTGTIPV..T.......FR............G...TV....Y.K...........FPISLWVPNTYPR...........................EPP..I..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wERST...............LVDL.VSILRE.......VFAKEPPV................................................................
A0A4T0TTF8_9BASI/23-145                ........................................................VFNDVSNLLASYQ.......TL.SPR.TE..V.Y..................I...........H.....D.....NGV..S.E...LLLN..LHGVLPI..H.......YR............G...VQ....Y.N...........IPISFWIPHNYPE...........................IAP..W..V..Y..V.VPTSSM..............LVK...S.GN...GVD.A..S....GLI....NL..D...........Y.V..K..N.WHKk.......pEAFN...............LVDL.SLVLRN.......SFEINPPL................................................................
A0A124SCN5_CYNCS/33-152                .......................................................i-RKHLLSLHQEFS.......SL.YPK.VG..T.F..................I...........H.....N.....DGT..M.V...HLLK..AEGYLNV..S.......HL............-...-L....P.L...........VHVTIWVHEYYPH...........................VAP..M..V..Q..V.TSDPTI..............PIR...S.NH..pFVD.P..S....GVT....TS..S...........Y.L..Y..M.WGP.........SGYD...............LLGL.AYNLVK.......LFSLDHP-f...............................................................
A0A3Q3E906_9LABR/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWMLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A2R8ZYC6_PANPA/36-119                ....................................................kysm-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......TY............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPM................................................................
A0A2P6N4E4_9EUKA/57-161                .......................................lslplssdynfdvykgt-------------.......--.---.--..-.-..................-...........-.....-.....---..-.D...DTVS..LYGPLTV..R.......--............-...-Q....Y.T...........VPVQITLDRHFPN...........................SRP..R..S..R..I.VKQNNL..............IIK...P.NH...AVN.L..D....GTI....QL..A...........Y.L..D..G.WRS.........STHT...............LKGF.IREIQE.......LFGKSP--vv..............................................................
A0A2R6WVC7_MARPO/111-232               .......................................................i-RQNLLAVIKDYA.......GL.QVK.TG..S.F..................T...........H.....N.....DGR..T.T...NLLQ..VYGTIPM..F.......FK............E...VK....Y.N...........IPVTMWLLEAFPR...........................VAP..M..V..F..V.TPTQDM..............VIK...H.QH..rFVD.A..S....GTV....TI..P...........Y.L..S..Q.WIY.........PRSN...............LFEL.VQNLSE.......VFGLDPPL................................................................
A0A6P8FNI6_CLUHA/1-89                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...--MS..LAGTVPV..N.......YR............G...NT....Y.N...........IPICVWLLDTYPY...........................NPP..I..C..F..V.RPTSTM..............MIK...T.GK...HVD.A..N....GKV....YL..P...........Y.L..H..K.WKP.........PQSD...............LLNL.IQVMVL.......VFGEEPPV................................................................
A0A2U4CDS8_TURTR/34-154                ........................................................TMEELKNVNTFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...NLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A2K5KNP6_CERAT/12-132                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
C4LZT6_ENTHI/21-137                    ........................................................VTKDIKRLQIKYP.......KL.KIG.I-..-.-..................T...........L.....S.....KYS..S.H...QYIS..LEGFLPI..V.......YE............R...KV....F.G...........VPMLIAFTYNYPL...........................SPP..E..L..S..C.FISQGM..............EIV...K.NH..pLVK.E..D....GFI....-Q..N...........I.Q..Q..Q.WNS.........-STD...............LLLL.LERLLA.......FFGSIPPV................................................................
A0A093F1Y4_TYTAL/8-128                 ........................................................TVQETTSVITQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
A0A6P5BKD0_BOSIN/21-71                 ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..I.......YQ............G...VS....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------dins............................................................
A0A3Q1F040_9TELE/21-141                .......................................................a-IEELEKIHRIYP.......GM.RPS.TG..T.Y..................T...........F.....S.....DST..Q.K...DLLK..LTGNIPV..K.......YE............G...RS....Y.N...........FPVQLWLMDSFPF...........................TPP..I..C..L..L.KPTPNM..............AIR...E.GK...HVD.A..R....GRI....YL..P...........G.L..H..N.WDH.........PKSS...............VVGL.LTEMIA.......KFEEDPPL................................................................
A0A6A5F7A2_PERFL/21-141                .......................................................a-VEELQKIHRGYP.......GM.QPS.TG..T.Y..................T...........F.....S.....DGT..Q.K...DLLK..LIGNIPV..K.......YE............G...RS....Y.N...........FPIQLWLMDSFPF...........................TPP..I..C..L..L.RPTPDM..............VIR...E.GK...HVD.G..G....GRI....HL..P...........G.L..H..N.WDY.........PKSS...............VVGL.LTEMIA.......KFEEDPPL................................................................
A0A218UU21_9PASE/25-144                ........................................................TIEELKDVSKTYP.......NF.TFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIA...V.GK...HVD.A..R....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............LIGL.IKEMIA.......KFEEELPL................................................................
A0A369RVX1_9METZ/1-97                  ..........................................mdgtipvvykvkct-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..----YVI..F.......AS............G...TT....Y.N...........IPICIYLEKNYPH...........................QSP..I..C..F..V.RPTNYM..............ILK...Q.TK...IVN.A..D....GKV....SI..S...........Y.L..L..D.WRY.........PQSD...............LTTF.LQVLCL.......QFADEMPV................................................................
A0A6J3RVF2_TURTR/34-154                ........................................................TMEELKNVNTFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...NLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A151RAX6_CAJCA/32-141                .......................................................i-RQQLVSLTTAFP.......SL.EPK.TA..S.F..................T...........H.....N.....DGR..S.V...NLLQ..AEGTIPM..T.......FQ............G...VT....Y.N...........IPVIIWLMESYPR...........................HPP..C..V..Y..V.NPTRDM..............IIK...R.PH..pHES.L..N....GG-....--..-...........-.-..-..-.---.........----...............----.------.......--------lkemqaemealeqqlqmvlmn...........................................
A0A2P6PKY3_ROSCH/170-285               ..................................lknlisdfpelgvhlrstpipl-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..IKGYIPI..T.......YH............G...KN....Y.K...........VQIQIRLA-GYPH...........................RAP..Q..V..Y..I.LWDRTK.............sCIR...E.DS..qYVSsT..T....GLV....HI..P...........L.L..Q..N.WSFrl....gleDYCT...............LVGL.VWNMVG.......LFSLHPPV................................................................
A0A3Q3XDA2_MOLML/21-70                 .......................................................a-VEELQKIHRIFP.......GM.IPS.TG..T.Y..................T...........F.....T.....DGT..Q.K...DLLK..LIGNLPV..Q.......YE............G...K-....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------pllq............................................................
G0P334_CAEBE/21-140                    .......................................................a-KKDVLGALAQFK.......DL.SPG.TD..T.F..................L...........F.....P.....DGK..R.R...TAFR..LKGTIPV..Y.......YK............G...AC....Y.N...........IPVTVYLWDTHPY...........................YAP..I..C..Y..V.NPTATM..............VIK...E.SE...HVN.K..E....GKV....FL..P...........Y.L..N..E.WRF.........PGYD...............LSGL.LQI---.......--------kkcpvfarsa......................................................
A0A1S3ZMX8_TOBAC/49-168                .......................................................i-RRHLISLLQNYP.......SL.RPS.ID..T.F..................T...........H.....D.....DGT..T.A...NLLN..ANGELQV..S.......SS............-...-T....P.A...........IPLTIWLHESYPF...........................MAP..I..V..L..V.SLNTSY..............PIY...N.NH..pFVD.S..S....GSI....SS..F...........Y.L..V..N.WKY.........PGCN...............LSDL.VHNLIK.......IFSHNHP-f...............................................................
L8HE30_ACACA/7-86                      ....................................................tlnq-----LKLLARVP.......SL.KPK.ED..T.F..................V...........S.....N.....EGD..S.Y...LLVA..LVGTVPI..R.......FR............T...NQ....Y.N...........IPVEVFVVRDYPE...........................KPP..L..C..F..V.RPTR--..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------gtaygsqh........................................................
A0A671NMH0_9TELE/1-103                 ........................................................-------------.......--.---.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
L8GRT0_ACACA/126-244                   .....................................................vrs---DVLMLLKAGP.......SL.YPH.TA..-.-..................V...........V.....A.....PGI..P.-...PLLL..VSGTLPI..S.......YK............G...AQ....Y.N...........IPIQLTIPEGYPH...........................SPP..I..C..R..V.TPTETM..............VVK...S.NH..kHVD.S..G....GVC....YH..P...........Y.L..S..G.WRP.........DVCS...............LVGA.TNELKA.......IFAADPPV................................................................
A0A1R2B7I1_9CILI/24-139                .....................................................ikq---EAIMLNRIYP.......EL.KPN.RG..-.-..................-...........-.....W.....GKI..D.K...HTIS..LIGRIPL..E.......RN............G...TY....Y.M...........LPFGICFPTKYPN...........................VPP..L..C..N..V.IPGNMD..............ILI...A.SK...RVL.S..T....GAI....TI..K...........L.F..E..N.WNN.........-NYD...............SLEV.VQSCIK.......HFTKHPP-t...............................................................
A0A1E3I7E2_9TREE/24-146                .......................................................i-QQEVLHILSERR.......TL.AVK.TE..A.F..................T...........F.....D.....SGH..T.A...LLLL..IHGTLPI..T.......FR............G...AT....Y.H...........IPIHLWIPHEYPR...........................APP..M..A..L..V.MPTKEM..............GVR...K.SR...EVE.P..S....GRV....SE..V...........V.V..D..G.WWRs.......wESKS...............LDQI.LKQLAS.......VFSAAPPV................................................................
A0A5N5P1U4_9ROSI/37-158                .......................................................i-RQHLLSLTSTFP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..T.V...NLLQ..ADGTVPM..T.......FE............S...VT....Y.N...........IPVIIWLIESYPR...........................HPP..C..V..Y..V.NPTRDM..............VIK...R.SH..sFVN.P..S....GLV....AI..P...........Y.L..Q..N.WIY.........PSSN...............LVDL.ARELSL.......IFGRDPPL................................................................
A0A540MJ30_MALBA/41-162                .......................................................i-RTHLVSITSAYP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..S.......YQ............G...VT....Y.N...........IPVVIWLMDSYPR...........................QPP..C..V..Y..V.NPTRDM..............VIK...R.AH..aHVD.P..S....GLV....AV..P...........Y.L..Q..N.WVY.........PSSN...............LVEL.VKNLSA.......VFGQDPPL................................................................
A0A151MC97_ALLMI/21-141                ........................................................TIEELKNVNKIYP.......NF.LFS.MD..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPI..T.......YH............G...RS....Y.N...........IPVRLWILDSHPF...........................APP..I..C..F..L.KPTVNM..............GIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VIGL.IKEMTA.......KFDEELPL................................................................
A0A671G1Y9_RHIFE/21-141                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.VKEMIA.......KFQEELPL................................................................
A0A6F9AJM6_9TELE/13-95                 .........................................srykfrdvaieelkk-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........------VHQIHPA...........................MKP..VtgT..Y..S.KPTTNM..............VIR...E.GK...HVD.A..R....GRI....YL..P...........S.L..H..N.WDH.........PKSS...............VVGL.LAEMIS.......QFEEEPPL................................................................
A0A1U7R7N7_MESAU/21-141                ........................................................TVEELKNVNTHFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DTS..Q.K...DLLN..FTGTIPV..M.......YQ............G...IT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..K....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A428R491_9HYPO/25-147                .......................................................a-YNDVAQALTRYP.......TL.SPR.TD..V.H..................T...........F.....S.....HGA..N.A...LLLH..LSGTLPV..N.......FR............G...TT....Y.R...........FPVSIWVPHAYPR...........................EPP..M..I..Y..V.VPTETM..............MIR...P.GQ...HVD.P..Q....GLV....YH..P...........Y.L..V..G.WAEf.......wDKSN...............LQDF.LAILTD.......IFAKEPPV................................................................
A0A2S7P9T1_9HELO/33-175                ........................................................TYNDVAQTLSHYS.......SL.APR.TD..V.Y..................T...........Y.....E.....NGA..S.A...LLLH..ISGTLPV..T.......FR............G...TT....Y.R...........FPIALWIPHAYPH...........................EAP..L..V..Y..V.TPVEGM..............MVR...A.GQ...HVD.P..Q....GKV....YH..P...........Y.L..V..G.WAE........yWDHK...............----.------.......--------lpelsnfladilmfmymqksnildflailrdvfakeppv.........................
A0A087XZQ6_POEFO/24-145                .......................................................t-LKDLQSVRARFR.......DL.RLF.VD..F.Y..................C...........F.....P.....NKE..T.R...RLLH..LSGTLPV..F.......YQ............G...SA....Y.N...........IPVCVWLHQTHPL...........................SRP..R..C..V..V.CPSVAM..............VIN...P.SC..pHVD.S..S....GTV....SV..D...........G.L..R..N.WTP.........GVSN...............LTLL.LSEMRL.......AFQKDTPL................................................................
A0A2K1IAG6_PHYPA/42-163                .......................................................i-REHLLKVLQEFP.......GL.QVK.TA..V.F..................N...........H.....N.....DGR..I.L...NLLQ..AEGTIPM..F.......YQ............D...VK....Y.N...........IPVTLWLLETYPR...........................QAP..L..V..F..V.NPTRDM..............IIT...P.RH..pNVD.G..S....GMV....NS..I...........S.L..Q..Q.WIY.........PRSN...............LVEL.VQSLSL.......LFGQKPPL................................................................
U1HUA7_ENDPU/26-148                    .......................................................a-YSDLAQTLERFP.......TI.SPR.TD..V.Y..................T...........F.....E.....NGS..S.A...LLVR..LYGTLPV..S.......FR............N...MT....Y.R...........FPVEIWIPHTYPH...........................EPP..I..A..Y..I.TPTSEM..............LVR...P.GR...HVS.G..E....GRV....YH..P...........Y.L..A..H.WATa.......wDRSN...............VVEL.LSILGD.......VFSKEPPV................................................................
A0A2P5C046_PARAD/33-154                .......................................................i-RDHLISFLQDFP.......SF.TPS.SG..T.F..................V...........H.....D.....DGM..A.T...SLLC..VTGDLHI..S.......AA............-...-T....P.L...........VPLTIWLHENHPL...........................MPP..I..V..F..V.TPNSAPr............pTLR...P.DH..pFVA.P..S....GVT....AC..P...........Y.L..H..T.WAH.........PRCS...............LSNL.VRNLVR.......LFSHDHPL................................................................
A0A4U5QFL0_POPAL/38-159                .......................................................i-RQHLLSLTTTSP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..T.V...NLLQ..ADGTVPI..T.......FI............S...AT....Y.N...........IPVIIWLIESYPR...........................HPP..C..V..Y..V.NPTRDM..............IIK...R.SH..pFVN.P..S....GLV....SI..P...........Y.L..Q..D.WIY.........PSSN...............LVDL.ARELSS.......VFGRDPPL................................................................
A0A6J3EV98_SAPAP/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A2T3ZY33_TRIHA/25-147                ........................................................TYNDIATVLARYP.......TL.APR.TD..V.H..................T...........F.....P.....NGA..S.A...LLVH..LTGTIPV..L.......FR............G...TT....Y.R...........FPVSIWVPHAYPR...........................EAP..L..V..Y..V.TPTETM..............MVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..A..G.WVDf.......wDKSS...............LNDF.LSVLSD.......IFAKEPPV................................................................
A0A6I8PK40_ORNAN/21-141                .......................................................t-LREIVSVITLYK.......DL.KPL.LD..A.Y..................V...........F.....N.....DGN..S.R...ELMS..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDSYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A3N4L0G7_9PEZI/32-154                ........................................................TYHNVAATLYQFP.......TL.SPR.TD..V.Y..................T...........H.....E.....DGR..S.Q...LLLN..LVGTLPV..T.......FR............G...AT....Y.Q...........IPLKIWLLHEYPK...........................QPP..M..V..F..V.NPTRDM..............LIR...P.GN...HVD.P..S....GRC....YH..P...........Y.L..A..N.WVNy.......sDRST...............IVDL.LEVLRQ.......VFGREPPV................................................................
A0A3P9Q507_POERE/21-141                ........................................................TVEELQKINRIFP.......DM.KLY.TG..M.Y..................T...........S.....S.....DNS..Q.M...ELLK..LTGVIPV..K.......YD............G...RS....Y.N...........FPIELWLLYSFPF...........................TPP..I..C..L..L.RPTSNM..............VIR...E.GK...HVD.A..K....GRI....HL..P...........V.L..H..N.WDH.........PRSS...............VVGL.LNEMIS.......KFEEDPPL................................................................
A0A556TRI4_BAGYA/21-141                ......................................................av--VELQKIHHNYP.......DM.KTV.AS..S.Y..................T...........F.....T.....DST..Q.K...ELLK..VVGNIPV..R.......YQ............G...RS....Y.N...........LPIQLWLLDSFPF...........................TPP..I..C..L..L.RPTANM..............VIR...E.GK...HVD.A..K....GRI....HL..P...........A.L..H..N.WDH.........PKST...............VLAL.LEEMIA.......KFEEDPPL................................................................
A0A2K6MX16_RHIBE/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A498P1F5_LABRO/22-142                .......................................................t-ARDITNVTSHYK.......DL.KPV.MD..N.Y..................V...........F.....N.....DGS..T.K...ELLS..LTGTVPV..N.......YR............G...NV....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKP.........PQSE...............LLGL.IQVMVV.......VFGEEPPV................................................................
A0A5E4CA83_MARMO/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A1L8FZB6_XENLA/27-143                .......................................................i-KQELEQIRAKYG.......DI.LIK.VG..-.-..................-...........F.....H.....GGI..K.R...RLLT..FTVPVST..Q.......YN............G...HY....F.Q...........IQVCIWLHPTHPE...........................TPP..Q..C..Y..L.ADKVNI..............DLQ...P.GD...VIS.K..N....WLM....NL..K...........Y.V..Q..E.WNY.........TSSH...............LLGL.LEDVED.......FLK-----keis............................................................
V4NJP7_EUTSA/2-98                      ......................................................re-------------.......--.---.--..-.-..................-...........-.....-.....---..E.D...RLLQ..VHGVIPY..S.......YE............G...VY...yF.D...........VEVIIWLLKSYPG...........................TRP..R..V..F..V.SSSSGS..............CIR...D.DL..lNVT.P..N....GSV....YC..S...........Y.L..R..N.WNA.........SKSN...............LAGL.VSHLSA.......IFSCQPP-r...............................................................
A0A024UD70_9STRA/25-145                .......................................................v-RYDVETLLRQIP.......SI.SPQ.HG..V.Y..................T...........H.....N.....NGS..T.S...TMMS..LTGTIPI..Y.......YG............G...NQ....Y.N...........IPVEIWIPEAYPF...........................AAP..T..C..F..V.RPTTDM..............MIR...P.GH..pHVD.Q..N....GLI....VV..P...........Y.S..T..N.WDC.........-DHS...............LVEL.VGYHCS.......IFGAQPPV................................................................
A0A6J2RHZ1_COTGO/24-145                .......................................................t-LCDLQKVCSLFS.......DL.RLY.VD..Y.Y..................C...........F.....P.....HKD..K.K...KLVF..LAGTLPV..H.......YE............G...SE....Y.N...........IPVCIWLHETHPL...........................SRP..R..C..F..V.CPSVSM..............LIN...P.AC..sYVE.A..S....GNI....SL..H...........G.L..T..N.WIH.........GVSN...............LSLL.MSEMRR.......AFRRDTPL................................................................
A0A0L0DTE2_THETB/20-141                ......................................................tr--GDVQTVMRTYP.......GL.SPE.VA..T.Y..................T...........S.....N.....TGA..E.E...TLLA..LTGTIPI..T.......YA............G...NT....Y.N...........IPVKIWLPSVYPS...........................ERP..I..A..F..V.TPTTTM..............YIK...P.GH..dHVD.L..S....GRC....YL..P...........Y.L..T..S.WTG.........TNSS...............LIGL.VAAMCS.......AFSACPPV................................................................
V2XWJ4_MONRO/23-147                    .....................................................ihd---SIIDILSRHQ.......NL.RIK.SD..V.Y..................T...........Y.....D.....DGR..Q.H...LLLC..IHGLLPViwS.......RD............G...KE....Y.R...........IPINIWLPRDFPQ...........................ERP..L..V..Y..V.VPTGDM..............LVR...A.GR...ELE.V..S....GRW....NG..G...........-.-..-..S.WSA.........QSGEkg..........dkrLQEL.INRMKE.......AFGREMPV................................................................
W5LBD3_ASTMX/21-127                    ..............................aieelqklnrvypdmklktgsysesl-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...--LN..VL-----..-.......--............G...HS....Y.N...........LPIQLWLLDSFPF...........................TPP..I..C..F..L.RPTSNM..............MIR...E.GK...HVD.A..K....GRI....YL..P...........G.L..H..N.WDH.........PKSS...............VSVL.LEEMIA.......KFEEDPPL................................................................
A0A1S3JU80_LINUN/24-144                .......................................................a-KRDILQAFSNFK.......DL.RPN.VD..S.F..................V...........F.....N.....DGN..R.K...ELLC..LEGTIPV..T.......YR............G...TT....Y.N...........IPVCLWLLETHPY...........................NPP..M..V..Y..V.KPTATM..............QIK...P.GQ...HVD.A..N....GRV....YL..P...........Y.L..H..E.WRH.........PQSD...............LFGL.IQIMGI.......IFGENPPV................................................................
A0A654IAL4_9CEST/7-74                  ......................................................ar--TDIEAAARTYP.......SL.PVK.FQ..S.F..................T...........F.....D.....DGT..T.C...DLLS..LDGTLPV..T.......YD............R...RT....Y.N...........IPVAIFFLSAHPH...........................MPP..M..V..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------x...............................................................
A0A2C5XYR9_9HYPO/25-147                ........................................................TYNDVARALNRFP.......SL.SPR.TD..V.H..................T...........F.....P.....NGS..S.A...LLLH..LSGTLPV..V.......FR............G...ST....Y.R...........FPVSIWVPHAYPR...........................EPP..L..I..Y..V.TPTESM..............MVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..A..R.WTDf.......wDKST...............LEDF.IAVLSD.......VFAKEPPV................................................................
Q6ESB7_ORYSJ/45-167                    .......................................................i-RNHLVALADAFP.......SL.HPK.AA..L.F..................T...........H.....N.....DGR..A.A...HLLQ..ADGTIPI..H.......HA............G...AS....Y.N...........LPAVLWLPEPYPR...........................SPP..L..V..F..L.SPTRDM..............VIK...P.HH..pLVD.R..S....GLV...aNA..P...........Y.L..R..S.WVF.........PSSN...............LVDL.VRSLSH.......LFGLDPPL................................................................
A0A151MC87_ALLMI/21-141                ........................................................TVQETISVITQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
A0A5F5XZQ4_FELCA/23-143                ........................................................TVEELKNVNRFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YH............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GVS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A1Y2EQ84_PROLT/26-148                ........................................................IYEDVAEALHHFP.......SL.RPR.TD..I.Y..................T...........F.....A.....DGE..T.R...LLLV..LNGAIPT..Q.......GR............G...SL....L.S...........TPIQLWLPHAYPQ...........................AGP..I..A..L..I.NPGPGM..............VVN...P.SN...YVD.I..N....RIC....YH..P...........Y.L..A..Y.WSAn.......kQKHN...............LRDA.LLHLQQ.......AFDKEPPL................................................................
A0A2J7RDC5_9NEOP/22-142                .......................................................t-RRDVINTIQHYP.......SL.TTH.LE..P.F..................V...........F.....N.....DGS..K.R...ELFN..LEGTIPV..T.......YK............G...NT....Y.N...........IPICIWLMDTHPY...........................NAP..M..C..Y..V.KPTSGM..............QIK...V.SI...FVD.H..N....GKI....YL..P...........Y.L..H..D.WVP.........NSSD...............LLGL.IQVMIV.......TFGEQPPV................................................................
A0A165AMR8_9AGAM/21-143                .......................................................l-YRHVDALLAHYS.......SL.RPK.TD..M.Y..................T...........F.....D.....DGR..T.Q...LLLC..VYGLLPI..T.......FR............N...SQ....Y.N...........IPVSLWMTDEYPS...........................KPP..I..V..Y..V.VPTPSM..............LVK...A.SK...HVD.A..S....GLV....NI..P...........Y.M..D..Q.WLRk.......sEACH...............LSGL.VDAMRD.......LFSRDPPL................................................................
A0A1U7VU23_NICSY/37-158                .......................................................i-RQHLLSLIETYP.......SL.QPK.TA..T.F..................T...........H.....N.....DGR..T.V...NLLQ..ADGTVPM..V.......YQ............D...VT....Y.N...........IPVIIWLMESYPR...........................HSP..L..V..F..V.NPTRDM..............IIK...R.PH..qFVN.P..S....GVV....SI..P...........Y.L..Q..N.WIY.........PSSN...............LVEL.ARNLSH.......FFGRDPPL................................................................
A0A498N006_LABRO/22-127                .......................................................v-LSEISTVLSQHQ.......YL.QPV.LE..K.F..................V...........F.....N.....DGT..A.K...MLIN..LTGTIEV..I.......YN............G...KR....Y.N...........IPVSLWLKENYPR...........................TAP..I..C..Y..L.KPTSEM..............VIV...P.SR...HVN.S..S....GEI....TM..P...........Y.L..D..E.WRH.........Q---...............----.------.......--------ykyrdl..........................................................
A0A0K9RUQ0_SPIOL/42-163                .......................................................i-RQHLVSLTDAYP.......SL.QPK.TA..T.F..................T...........H.....N.....DGR..T.V...NLLQ..ADGTVPM..S.......YG............G...VT....Y.N...........IPVVIWLMELYPR...........................HPP..C..V..F..V.NPTRDM..............IIK...R.PH..pHVT.P..S....GSV....SI..P...........Y.L..Q..K.WIY.........PSSN...............LVDL.ARDLSH.......YFGRDPPL................................................................
A0A2I4GZN3_JUGRE/41-162                .......................................................i-RQHLVSLTSAYP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTVPM..S.......FQ............G...LT....Y.N...........IPVIIWLMDSYPR...........................HPP..C..V..Y..V.NPTRDM..............VIK...R.PH..pYVN.P..S....GLV....SV..P...........Y.L..H..N.WVY.........PSSN...............LVDL.VRNLSL.......HFGRDPPL................................................................
F6ZIZ6_CALJA/21-141                    .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A5F4W9X2_CALJA/161-245               ..................................................lpnvei-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......SK............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A444V841_ACIRT/1223-1343             ........................................................TVREITNVISPYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.K...DLMS..LTGTVPV..S.......YR............G...NT....Y.N...........IPVCLWLLDVYPY...........................SPP..I..C..F..V.KPTSAM..............MIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMVV.......VFGEEPPV................................................................
A0A672LGT6_SINGR/23-143                .......................................................t-SRDITSVASHYK.......DL.KAV.MD..N.Y..................V...........F.....N.....DGS..T.K...ELLS..LTGTVPV..S.......YR............G...NV....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKP.........PQSE...............LLGL.IQVMIV.......VFGEEPPV................................................................
A0A0K3ARP2_BABMR/19-133                .....................................................isk---HVTELLDQH-.......NF.SIN.I-..-.-..................-...........-.....N.....RHG..D.L...NILV..VKGIISY..V.......YR............H...DV....F.R...........VPILIKIYKSYPF...........................VPP..I..V..Y..I.INHIEF..............RIL...P.NH..pNVD.E..N....GLI....TV..R...........Y.L..D..N.WGK.........-KSK...............LVEL.LNILVQ.......NFKKKSPL................................................................
A0A0L0BPB0_LUCCU/23-143                ........................................................TKKEVVDVITSYR.......SL.SYN.LQ..K.F..................V...........F.....N.....DGS..T.K...DLFN..LQGTIPV..V.......YK............N...NT....Y.Y...........IPICIWLMDTHPM...........................NAP..M..C..F..V.KPTPNM..............LIK...V.SM...YVD.Y..N....GRI....YL..P...........Y.L..H..D.WQP.........NSSD...............LLSL.IQVMIV.......TFGDHPPV................................................................
A0A2I3SDN5_PANTR/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A672TR92_STRHB/21-140                ........................................................TIEELKNVNKTYP.......NF.TFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTVNM..............GIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VIGL.IREMIA.......KFEEELPL................................................................
A0A452EGM1_CAPHI/21-141                .......................................................t-VRETVNVISLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A087H8Z4_ARAAL/37-158                .......................................................i-RQHLLNLISSYP.......SL.EPK.TA..T.F..................M...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......FH............G...VT....Y.N...........IPVIIWLLESYPR...........................HPP..C..V..Y..V.NPTADM..............IIK...R.PH..sHVT.P..S....GLV....SL..P...........Y.L..Q..N.WVY.........PSSN...............LVDL.VSELSA.......AFATDPPL................................................................
C0HE93_MAIZE/43-165                    .......................................................i-RNHLVALAEAFP.......SL.HPK.AA..L.F..................T...........H.....N.....DGR..A.A...HLLQ..ADGTIPI..H.......HA............G...AS....Y.N...........LPAVIWLPEPYPR...........................SPP..L..V..F..L.SPTRDM..............VIK...P.HH..rLVD.S..S....GLV...aNA..P...........Y.L..R..S.WVF.........PSSN...............LVDL.VRSLSH.......LFGLDPPL................................................................
A0A6J2I0E8_9PASS/21-141                .......................................................t-IQETTSVITQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
A0A078I9C5_BRANA/55-175                .................................ahahlddvlahiretlycfpwmk-------------.......--.---.--..-.-..................-...........-.....-.....SDP..V.A...NLLN..LTGDVEY..I.......YK............G...NS....F.K...........AFITIYLPESYPK...........................DPP..Q..A..W..V.VCEDGI.............tGIN...H.KQ..mHVA.A..N....GSV....SI..P...........Y.L..W..D.WDG.........KSST...............LLQF.ILHMSV.......EFTSQPP-t...............................................................
A0A340XWU1_LIPVE/21-141                .......................................................t-VRETVSVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...TT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGEEPPV................................................................
B8M558_TALSN/33-155                    ........................................................TYHDVARMLAQYP.......SF.GPR.TD..V.Y..................T...........Y.....E.....NGT..P.S...LLLH..LVGTLPV..S.......FR............G...NS....Y.N...........IPIDTWIPSAYPL...........................EAP..I..V..Y..V.TPTPDM..............VVR...S.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WHEt.......wDRSS...............IVEL.FAVLRD.......IFSKEPPV................................................................
W6MGJ0_9ASCO/29-162                    ........................................................VYQDVSLVLMVFS.......AL.KPR.TR..V.Y..................D...........D.....E.....YGR..S.R...LLLN..LYGSMAY..T.......QN............G...AP....F.S...........APIEVWFPQEYPR...........................EPP..V..V..Y..V.VPNSQT..............LLN...P.NN...WMD.Q..N....GRI....YH..P...........L.L..S..S.WSAtf.....gsQTSNegiq......pnqnrLLVL.FNTIQE.......CFDRQSP-v...............................................................
A0A1J4KNR8_9EUKA/22-137                .....................................................igm---DLNQFLSTYR.......TM.KSD.V-..-.-..................-...........I.....Q.....TPG..V.V...PYIQ..LLGKIAL..T.......HG............R...NP....Y.E...........ITLLIQITNTYPI...........................YPP..T..F..Y..F.QPITGV..............PFN...N.VP...NLQ.A..N....GAI....IV..T...........G.I..F..Q.WSP.........-AQN...............LCNA.VGWIIN.......YFSQYPPI................................................................
A0A158RAI2_TAEAS/1-47                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.-----M..............QIK...S.GP...HVD.T..N....GKI....FL..P...........Y.L..S..E.WKF.........PGSS...............TQGL.LAILQE.......VFGHRTPV................................................................
A0A376B7L3_9ASCO/29-143                ........................................................VFNDVVYALNQYQ......yIL.RPK.TK..V.Y..................T...........D.....V.....NGV..S.Q...LLLC..LYGKIGV..D.......NS............-...--....-.-...........IPIILWIPVNYLS...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------nngrdndpwivldfdilpenyeivnehhgaeaisnkyvkgesgiinipslshnssvd.......
A0A0N4T8L8_BRUPA/25-141                .....................................................akv---DMLSALRHFP.......GF.KPN.VF..N.H..................I...........Y.....P.....DYT..C.S...TAFC..LEGAIPS..K.......ID............-...--....-.N...........LPVAIYLRDTHPY...........................KAP..T..C..Y..V.CPTTNI..............VLR...K.SD...TVD.E..L....GRI....SS..T...........Y.L..R..N.WTF.........PGNH...............LSGL.LQVMMD.......VLPKFL--ps..............................................................
A0A663EYA9_AQUCH/21-141                ........................................................TVQETTSVITQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
I3KAX9_ORENI/21-141                    .......................................................a-VEELEKIHRIYP.......GM.KPS.TG..T.Y..................T...........F.....S.....DST..Q.K...DLLK..LTGTIPV..Q.......YE............G...RS....Y.N...........FPIQLWLLDSFPF...........................TPP..I..C..H..L.KPTSNM..............VIR...E.GK...HVD.A..R....GRI....HL..P...........G.L..H..N.WDY.........PKSS...............VVGL.LNEMVT.......KFQEDPPL................................................................
A0A162SLZ4_9CRUS/19-139                ........................................................TKRDVQNLLQHYR.......GL.QPK.VE..T.F..................V...........F.....N.....DGA..S.K...QLLC..LGGTIPV..H.......YK............G...SD....Y.N...........IPVALWLLETHPI...........................NAP..M..V..F..V.RPTSDM..............RLR...I.SK...HVD.H..N....GKV....YM..P...........Y.L..H..V.WSA.........NESD...............LVAL.VQVMII.......IFGEQPPV................................................................
A0A2K6KQI3_RHIBE/14-134                ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSYPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A3B1K394_ASTMX/23-143                ......................................................ll--SEVMVVMSRYK.......YL.EPV.MD..R.F..................V...........F.....N.....NGT..A.K...DLLS..LVGTVTV..L.......YQ............G...RL....Y.N...........IPLCLWLDESFPR...........................TAP..I..C..F..V.KPTKEM..............MIV...P.ST...HVN.S..D....GQI....ML..P...........Y.L..E..E.WRH.........SQCD...............LHSL.IQVLMS.......IFGEAPPL................................................................
G3R4C1_GORGO/21-141                    ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIHFWILDSHPF...........................APP..I..C..F..L.KPTANM..............RIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPM................................................................
A0A1V4JNP7_PATFA/21-141                ........................................................TVQETTSVITQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGT..A.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
A0A2G7FGY7_9EURO/410-532               ........................................................TYYDVASVLAQYP.......SL.SPR.TE..V.Y..................T...........Y.....E.....NGF..S.A...LLLQ..LTGTVPV..T.......FR............G...TV....Y.K...........FPISLWVPNTYPR...........................EPP..I..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wERST...............LVDL.VSILRE.......VFAKEPPV................................................................
A0A6J3AWS3_VICPA/1-47                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.-----M..............RIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..S.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A2K6CCL6_MACNE/69-189                ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A3P8ANM2_HAEPC/1-106                 .......................................................m-------------.......--.-PD.TE..S.Y..................T...........F.....P.....DGK..R.K...TAFR..LHGTIPV..F.......YK............G...AR....Y.N...........IPISVYLWDTHPY...........................YAP..I..C..Y..V.CPTPTM..............VIR...E.SE...HVT.K..Q....GRV....FL..P...........Y.L..N..E.WRF.........PGYD...............LNGL.LQVMAM.......VFQEKCPV................................................................
A0A0D2CBA0_9EURO/1-58                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..M..L..Y..V.TPTDDM..............IIR...P.GQ...HVG.G..D....GRI....YH..P...........Y.L..A..H.WREh.......wERSN...............VLDF.LSILSE.......IFAKEPPV................................................................
A0A665TLE0_ECHNA/24-145                .......................................................t-LSDLHTVRNLFP.......DL.RLY.VD..F.Y..................C...........F.....P.....SKE..K.K...KLVY..LAGTVPI..H.......YE............G...SD....Y.N...........IPVCIWLHKTHPE...........................SRP..R..C..Y..V.CPSVSM..............VIN...P.TC..sCVD.A..S....GNI....SL..D...........G.L..R..N.WTH.........GVSD...............LSQL.VSEMRR.......AFHLDTPL................................................................
A0A2I3H6A0_NOMLE/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
B0X7U6_CULQU/63-180                    ....................................................ekls-----VDCLKQYK.......AL.AYR.VE..E.Y..................A...........F.....N.....HGT..V.K...QLLN..LKGTIPV..R.......YK............G...NT....Y.H...........IPVAIWLLDTHPR...........................YAP..L..C..Y..N.QPTSDM..............HIK...V.SM...YVD.H..N....GKI....YL..P...........Y.L..H..D.WNP.........AHSD...............LLGL.IQQQQQ.......QF------ppyp............................................................
A0A4Y7IVU0_PAPSO/33-147                .......................................................v-REHIICLLCEYE.......HL.VPS.VD..I.F..................T...........Y.....N.....DGR..T.V...NLLN..VNGFLQV..S.......EC............-...-A....S.R...........IPLTIWIHQNYPN...........................SPP..S..V..V..L.PQTHG-..............---...L.HP...FVD.C..T....GVV....TS..E...........Y.L..T..T.WTY.........PRSN...............LLDL.VRNLVY.......LIA-----hheaf...........................................................
A0A2K3Q6N2_9HYPO/79-201                ........................................................TYNDVARALSRSP.......TL.APR.TD..V.H..................T...........F.....P.....DGT..S.A...LLLH..ISGTLPV..V.......FR............G...ST....Y.R...........FPLSIWVPHAYPR...........................EPP..L..V..Y..V.TPTETM..............VVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..V..R.WSEf.......wDKST...............LEDF.LNVLSD.......VFAKEPPV................................................................
A0A5C3MCH8_9AGAR/25-147                .......................................................v-YVDIDAALARFS.......TL.RPK.SD..V.Y..................T...........F.....D.....DGR..T.Q...LLLC..LHGLLPI..S.......FR............N...AS....Y.N...........IPVAVWVTREYPR...........................QPP..I..A..Y..V.VPTADM..............LVK...A.GK...YVD.V..S....GRC....NV..E...........Y.I..Q..H.WQRk.......dEGCN...............LSAL.LEAMQD.......QFSREPPV................................................................
A0A6P8V395_GYMAC/21-141                .......................................................a-VEELQKIYRIYP.......EM.MPS.TG..T.Y..................T...........F.....S.....DNT..Q.K...DLLK..LFSNVPV..N.......YG............G...RS....Y.N...........IPIQLWLMDSFPF...........................TPP..I..C..L..L.RPTSNM..............VIR...E.GK...HVD.K..E....GRL....HL..P...........G.L..H..N.WDY.........PKST...............VVGL.LTEMIS.......KFEEDPPL................................................................
A0A1E3PZ47_LIPST/27-149                ........................................................TYSDVASALQSYP.......SL.TPR.TN..V.Y..................T...........Y.....E.....NGK..S.E...LLLN..LHGTVPT..T.......FR............S...AV....Y.N...........IPVSIWISHEYPY...........................VAP..F..A..F..V.TPTAAM..............SLR...P.GN...HVD.T..N....GRV....YH..P...........Y.I..S..Y.WNGt.......dPQTN...............ILGL.CAVLCD.......IFGKEPPV................................................................
A0A2A9NW82_9AGAR/25-147                ........................................................VFTDIDAVLTRYI.......TL.RPK.LD..I.Y..................T...........Y.....D.....DGR..T.Q...LMLC..VHGVLPI..S.......FR............H...AS....Y.N...........IPIALWIPRDYPK...........................LPP..L..A..Y..V.VPTNDM..............LVR...P.GK...FVD.V..S....GKC....EP..E...........Y.I..R..N.WQRk.......sEGCN...............LIAL.LEAMQD.......HFSREPP-f...............................................................
A0A5C3E3C0_9BASI/23-145                ........................................................VFADVDRALIAVS.......SL.SPK.TE..V.F..................T...........F.....N.....DGR..T.Q...LLLT..LDGTIPV..E.......FR............N...TT....Y.N...........IPVAYWIPQDYPR...........................EPP..M..A..F..V.APTPDM..............AIR...K.GP...HVD.P..S....GEI....GG..E...........Y.L..A..R.WRSk.......pEACN...............LLDL.IHDCQQ.......MFGREPPV................................................................
A0A6J3ERK4_SAPAP/23-143                ........................................................TVEELKNVNMFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
G9MQ40_HYPVG/25-147                    ........................................................TYNDVATVLARYP.......TL.APR.TD..V.H..................T...........F.....P.....NGA..S.A...LLVH..LTGTIPV..L.......FR............G...TT....Y.R...........FPISIWVPHAYPR...........................EAP..L..V..Y..V.TPTETM..............MVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..A..G.WGDf.......wDKSS...............LNDF.LSVLSD.......VFAKEPPV................................................................
D5GPY1_TUBMM/31-153                    .......................................................a-YNDIATALFNTP.......SL.SPR.TD..V.Y..................T...........H.....E.....DGR..P.E...LLIQ..LYGTIPV..L.......FR............G...AT....Y.N...........IPLTIWLPHTYPR...........................QPP..M..A..F..V.TPAKDM..............LIR...P.GN...HVD.P..S....GRC....YH..P...........Y.L..A..N.WINy.......sDRSN...............IVDL.CDVLRG.......VFGREPPV................................................................
A0A6J3ERJ9_SAPAP/38-121                ....................................................kysm-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......TY............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A3P9CN59_9CICH/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A671RDN5_9TELE/17-137                .......................................................a-IEELQKVSRLHP.......DM.KLI.SG..T.Y..................T...........S.....S.....DRL..Q.K...DLLK..LVGNIPV..R.......YQ............G...CS....Y.N...........LPILLWLLDSFPF...........................TPP..I..C..F..L.SPTSSM..............VIR...E.GK...HVD.S..K....GRI....HL..P...........G.L..H..N.WDH.........PKSS...............VNGL.LAEMIA.......KFEEEPPL................................................................
A0A0K3CH55_RHOTO/437-560               .....................................................aaa---QALAVLAAYP......gLL.NPE.QS..D.F..................T...........Y.....D.....DGR..V.E...LLLS..LTGVLPV..P.......IG............P...NT....Y.H...........CPIAIWLPLDFPA...........................KPP..T..V..F..V.LPSETL..............AIR...K.GK...NVD.A..S....GKV....GV..P...........Y.L..D..Y.WARk.......aEGCS...............LTGL.IEDLIP.......VFSARYPV................................................................
A0A3N2Q2S8_9PEZI/26-148                ........................................................TYNDVAQALSHYP.......SL.SPR.TD..V.H..................T...........F.....D.....NGT..S.A...LLLH..LSGTLPV..I.......FR............G...AT....Y.R...........FPISICLPYAYPR...........................EAP..L..V..Y..V.TPSESM..............MVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..A..G.WSTf.......wDKST...............ILDF.LAILRD.......VFAKEPPV................................................................
V5E4L8_KALBG/23-145                    ........................................................VFADIDRTLIAVS.......SL.SPK.TE..V.F..................T...........F.....N.....DGR..T.Q...LLLN..LDGTIPV..N.......FR............G...NT....Y.N...........IPVAYWIPRDYPR...........................EPP..M..A..F..V.APTPDM..............AIR...K.GP...NVD.P..S....GEI....GG..E...........Y.L..R..R.WRNk.......pEACN...............LLDL.VHDCQQ.......MFGREPP-p...............................................................
A0A6J2J7Y9_BOMMA/21-141                .......................................................t-SREVINLLQVYR.......SL.TYR.LE..A.F..................I...........F.....N.....NGS..R.K...ELLN..IEGTIPV..N.......YK............G...AF....Y.N...........IPVSIWLMDTHPQ...........................NAP..L..C..F..V.KPTSDM..............SIK...V.SK...YVD.T..N....GKV....YL..P...........Y.L..H..E.WSS.........NSST...............LKNL.VQCMIT.......AFGELPPV................................................................
A0A4S4L2V5_9AGAM/16-98                 ..............................................slsaahrttf-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-PSLYGLPSRTPQ...........................XPP..L..V..Y..V.VPTSDM..............LVR...P.SD...TVE.L..S....GRC....NL..E...........Y.T..T..S.WSHk.......pDACS...............LSSL.LEAMQV.......HFSREPPL................................................................
A0A0L0S486_ALLM3/1-47                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.-----M..............LIN...P.SK...DVD.A..N....GKV....FH..A...........Y.L..H..Y.WDY.........RSSN...............LVNT.VGILQQ.......AFAVDPPV................................................................
A0A5G2Q8L5_PIG/21-141                  ........................................................TVEELKNVNVFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FSGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIT.......KFQEELPL................................................................
A0A4Y7L9R1_PAPSO/33-147                .......................................................v-REHIICLQYEYE.......HL.VPS.VD..I.F..................T...........Y.....N.....DGR..T.V...NLLN..VNGFLQV..S.......EC............-...-A....S.R...........IPLTIWIHQNYPN...........................SPP..S..V..V..L.PQAHG-..............---...L.HP...FVD.C..T....GVV....TS..E...........Y.L..T..T.WTY.........PRSN...............LLDL.VRNLVH.......LIA-----hheaf...........................................................
B1N3Q7_ENTHI/1-67                      ......................................................my-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------PYDYPL...........................SPP..L..F..F..T.DPTPEM..............EVV...P.GH..pYAM.P..N....IVI....CH..P...........I.L..D..R.WSE.........-NVN...............TLSV.LQVFVK.......DFSYMPPL................................................................
A0A6J1A258_9ROSI/33-152                .......................................................i-LRHLLSLLQEYP.......TF.GPS.TG..R.F..................L...........H.....N.....DGN..E.V...NLLF..ASGHVQV..S.......NS............-...-T....P.S...........VPLTIWLHENYPQ...........................KAP..L..V..F..V.SVDPMT..............PIH...R.HH..pFVD.T..S....GAT....SP..P...........Y.I..L..T.WKY.........PPCN...............LSGL.LHNLVR.......LFSRDHP-f...............................................................
A0A6I8RXN5_XENTR/23-106                .....................................................app-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..------A..A.......RQ............G...TT....Y.N...........IPICLWILDSHPF...........................APP..L..C..F..L.KPSGNM..............GIR...V.GR...HID.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VTGL.IREMAV.......KFEEELPL................................................................
S3D415_OPHP1/25-147                    ........................................................TYNDVSQALSHFP.......SL.SPR.TD..V.H..................T...........F.....P.....NGA..S.A...LLLH..LSGTLPA..V.......FR............G...AT....Y.R...........YPISLWVPHNYPR...........................EAP..L..V..Y..V.TPTENM..............MVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..A..G.WPEf.......wDKSS...............IVDF.LTILRE.......VFAKEPPV................................................................
A0A0D9VN56_9ORYZ/38-160                .......................................................i-RNHLVALADAFP.......SL.HPK.TA..L.F..................T...........H.....N.....DGR..A.A...HLLQ..ADGTIPI..H.......HG............G...AS....Y.N...........LPAVLWLPEPYPR...........................SPP..L..V..F..L.SPTRDM..............VIK...P.HH..pLVD.R..S....GLV...aNA..P...........Y.L..R..S.WVF.........PSSN...............LLDL.VRSLSH.......LFGLDPPL................................................................
A0A672G2N2_SALFA/9-129                 ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A4U0W497_9BASI/18-141                ......................................................as--QQALAVLNQFP.......SLvNPE.QS..D.F..................T...........Y.....D.....DGR..V.E...LLLS..LTGVLPV..P.......IG............A...NT....Y.H...........CPVAIWLPLDFPS...........................KPP..I..V..Y..V.LPNETL..............QIR...K.GK...HVD.A..N....GQV....SV..P...........Y.L..D..N.WERk.......sEGCS...............LMSL.VNELIP.......VFSARYPL................................................................
A0A3P9Q3M0_POERE/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSTM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A1V8S9B4_9PEZI/25-147                .......................................................a-YSDIAHTLASFP.......SL.SPR.TE..V.Y..................T...........Y.....E.....TGG..S.A...LLTT..VTGTLPV..N.......FR............G...TL....Y.R...........FPVKLWIPLSYPQ...........................EAP..I..V..Y..V.TPGKEM..............LVR...P.GQ...HVG.V..D....GRV....YH..P...........Y.L..R..D.WSVm.......wDRAS...............VVDF.LGYLQQ.......AFAREPPV................................................................
A0A671RD70_9TELE/21-141                .......................................................a-IEELQKVSRLHP.......DM.KLI.SG..T.Y..................T...........S.....S.....DRL..Q.K...DLLK..LVGNIPV..R.......YQ............G...RL....Y.N...........LPILLWLLDSFPF...........................TPP..I..C..F..L.SPTSSM..............VIR...E.GK...HVD.S..K....GRI....HL..P...........G.L..H..N.WDH.........PKSS...............VNGL.LAEMIA.......KFEEEPPL................................................................
A0A2S4PSS6_9PEZI/26-148                ........................................................TYNHVAQLLSRYS.......SL.SPR.TD..V.Y..................T...........Y.....D.....NGK..S.A...LLLK..VSGTIPV..V.......FR............G...TC....Y.R...........FPIAIWIPHLYPL...........................EAP..L..V..Y..V.IATEGM..............VVR...P.GQ...HVD.L..Q....GKI....YH..P...........Y.L..V..G.WADn.......sDKFN...............LIDF.VEILRD.......VFAKEPPV................................................................
A0A087G6W8_ARAAL/37-158                .......................................................i-RQHLLTLVSSYS.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..S.V...ILLQ..ADGTIPM..P.......FQ............G...VS....Y.N...........IPIVIWLLESYPR...........................HPP..C..V..Y..V.NPTRDM..............IIK...R.PH..sNVS.P..S....GLV....SL..S...........Y.L..H..D.WVY.........PSSN...............LTDL.AAQLSA.......AFSRDPPL................................................................
M2MQX5_BAUPA/25-147                    ........................................................TYSDAARILSAYT.......SI.SPR.TE..V.Y..................T...........Y.....D.....NGT..S.A...LLLT..LSGTLPV..D.......FR............G...TT....Y.R...........FPIKLWIPQAYPQ...........................EAP..I..A..Y..V.NPGIDM..............LIR...P.GQ...HVG.V..D....GRV....YH..P...........Y.L..R..D.WERm.......wDRAS...............VAEF.LGFLQQ.......VFAKEPPV................................................................
A0A437CGJ9_ORYJA/24-145                ......................................................tl--VDLQEARSRFP.......DL.CLY.AD..Y.Y..................C...........F.....P.....NKD..T.K...KLVF..LAGTLPV..L.......YE............G...ST....Y.N...........IPVCVWLHVTHPA...........................SRP..R..C..Y..V.CPSASM..............VIN...P.SC..pCID.A..S....GNI....SL..D...........G.L..T..K.WTR.........GVSR...............LSEL.LAEMVQ.......VFQRDTPL................................................................
A0A803J6F4_XENTR/22-142                .................................................vreilnv-------TVPLYR.......DL.KPI.QR..P.Y..................V...........F.....N.....DGS..S.R...ELLS..LSGTIPV..P.......YK............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSTM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PPSD...............LLGL.IQILIV.......VFGEEPPV................................................................
A0A061D9X4_BABBI/33-148                .......................................................v-EADLRNTLGKYS.......GL.TPS.L-..-.-..................-...........-.....H.....YGS..A.G...VLIN..LRGTIPF..R.......FQ............N...VV....Y.N...........CPIRIALNPEYPL...........................SPP..Y..I..T..V.QPTEQI..............KIV...Q.KH..pCVL.K..N....GDV....VI..R...........Y.L..R..E.WNP.........-RAT...............LVEA.LRYVQD.......EFDRAPPI................................................................
A0A2H5PTS3_CITUN/33-153                .......................................................i-RKQLLSLLQNYP.......SF.NLS.ND..I.F..................T...........H.....N.....DGT..A.V...NLFK..VSGCFHV..S.......QS............-...-T....P.P...........IHFTLWLHENYPS...........................MAP..M..A..F..I.VSSNSM.............yPIR...Q.NH..pFVS.P..C....GTI....TT..P...........Y.L..Q..T.WSY.........PGYN...............LNDL.VHNLVQ.......IFSHDHPL................................................................
A3GFP8_PICST/25-189                    ....................................................aynh----ILVFLQNQSq....nyNF.AIR.TK..V.Y..................T...........S....sE.....TGQ..P.S...LLLN..LYGSISL..G.......DS............-...--....I.Q...........APVEIWIPYNYPSgfsspsnsynstgnvngqsdplfdangSVP..I..V..Y..I.IPDHSKn............yYLR...A.GN...YVD.T..S....GRF....YH..P...........Y.L..A..S.WYQ.........ESSShpsnpna.pisaryeLLQL.IKVVAE.......ALRAEPPI................................................................
A0A1V6QL86_9EURO/32-154                ........................................................TYHDVANALTQYP.......SL.SPR.TD..V.Y..................T...........Y.....E.....TGF..S.A...LLLH..LVGTLPV..T.......FR............G...TT....Y.R...........FPIALWIPNTYPR...........................EPP..I..A..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GQV....YH..H...........Y.L..A..H.WAEa.......wDRSS...............IADL.LSILQD.......VFAKEPPV................................................................
A0A1S3JV13_LINUN/24-144                .......................................................a-KRDILQAFSNFK.......DL.RPN.VD..S.F..................V...........F.....N.....DGN..R.K...ELLC..LEGTIPV..T.......YR............G...TT....Y.N...........IPVCLWLLETHPY...........................NPP..M..V..Y..V.KPTATM..............QIK...P.GQ...HVD.A..N....GRV....YL..P...........Y.L..H..E.WRH.........PQSD...............LFGL.IQIMGI.......IFGENPPV................................................................
A0A671FWC6_RHIFE/21-71                 ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...VS....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------dins............................................................
R0G9I8_9BRAS/37-158                    .......................................................i-RQHLLNLISSYP.......SL.EPK.TA..S.F..................M...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......FH............G...VT....Y.N...........IPVIIWLLESYPR...........................HPP..C..V..Y..V.NPTADM..............IIK...R.PH..aHVT.P..S....GLV....SL..P...........Y.L..Q..N.WIH.........PSSN...............LVDL.VSELSA.......AFARDPPL................................................................
A0A498JJ43_MALDO/41-162                .......................................................i-RTHLVSLTSAYP.......SL.DPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ANGTIPM..S.......FQ............G...VT....Y.N...........IPVIIWLMESYPR...........................HPP..C..V..Y..V.NPTRDM..............VIK...R.PH..aHVN.P..S....GSV....SL..P...........Y.L..Q..N.WVY.........PSSN...............LVEL.VKNLSA.......VFGQDPPL................................................................
A0A0U1LSI4_TALIS/33-155                ........................................................TYHDVARALAQCP.......SL.GPR.TD..V.Y..................T...........Y.....E.....NGT..S.S...LLLH..LVGTLPV..A.......FR............G...AT....Y.N...........IPVDVWIPNTYPL...........................DPP..I..V..Y..V.TPAADM..............VVR...S.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wDRVS...............IVDL.FGVLRD.......IFAREPPV................................................................
A0A109NDP8_SORBI/31-159                .......................................................v-RKHVLAVLQEFP.......TL.SPS.VD..T.Y..................T...........S.....D.....SGA..S.T...VLLN..ARGLLTV..S.......SA............-...-L....P.P...........VLLTLWLPREYPY...........................LPP..L..A..Y..V.FPAAAPssa........aplSLA...R.DH..pFVD.H..R...tGRVr..rTV..P...........Y.L..E..D.WAV.........PRSS...............LAGL.VRSLVA.......ALRMCHP-l...............................................................
A0A0D9Z0P1_9ORYZ/45-167                .......................................................i-RNHLVALADAFP.......SL.HPK.AA..L.F..................T...........H.....N.....DGR..A.A...HLLQ..ADGTIPI..H.......HA............G...AS....Y.N...........LPAVLWLPEPYPR...........................SPP..L..V..F..L.SPTRDM..............VIK...P.HH..pLVD.R..S....GLV...aNA..P...........Y.L..R..S.WVF.........PSSN...............LVDL.VRSLSH.......LFGLDPPL................................................................
A0A3Q4GPC8_NEOBR/1-118                 ......................................................ei-----NVALTYFR.......NL.VPV.MD..K.Y..................V...........Y.....N.....DGT..T.K...NLMS..LTGTIPA..T.......IN............S...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A663EY38_AQUCH/21-140                ........................................................TIEELKNVNKTYP.......NF.TFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIHLWILDSHPF...........................APP..I..C..F..L.KPTVNM..............GIL...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VIGL.IKEMIA.......KFEEELPL................................................................
U3K9N3_FICAL/22-143                    ........................................................TIEELKNVSMTYP.......NF.TFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YV............G..gNS....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIA...V.GK...HVD.A..R....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............LIGL.IKEMIA.......KFEEELPL................................................................
A0A2K5ZMJ6_MANLE/21-72                 ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...VS....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------ginsk...........................................................
A0A7C8IPX5_9PEZI/25-147                ........................................................TYNDVAQALSQYP.......SL.SPR.TD..V.H..................T...........F.....D.....NGI..S.A...LLLH..LSGTIPV..V.......FR............G...TT....Y.R...........FPISIWIPHAYPR...........................EPP..L..G..Y..V.TPTDTM..............MVR...P.GQ...HVD.P..Q....GRI....YH..P...........Y.L..V..R.WTEf.......wDKSS...............LIDF.LAILRD.......IFAKEPPV................................................................
C5FBT1_ARTOC/33-155                    ........................................................TYSDTAQLLAQFP.......SF.SPR.TD..V.Y..................T...........Y.....E.....NGV..S.A...LLLH..LTGTLPV..N.......FR............G...AV....Y.R...........FPIAIWIPNLYPD...........................ACP..M..V..Y..V.TPTPDM..............LVR...P.GQ...HVS.S..D....GRI....YH..H...........Y.L..A..H.WAEa.......rDRST...............LVDF.LLILKD.......VFTKEPPV................................................................
H3C023_TETNG/22-142                    ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTIPI..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPF...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A0L0DVC5_THETB/45-170                .......................................................v-VDEVGHAVEVYP.......SL.LAR.AG..Q.Y..................V...........D.....G.....STV..S.EvavPMVC..LTGTVPI..V.......YQ............G...QR....Y.N...........LPITLWLRHDYPY...........................SPP..E..T..Y..I.TPAPNM..............TFK...V.GH..pHVD.L..A....GRC....RL..E...........Y.L..D..Q.WNG........dNGSS...............LVAL.LVHMSD.......VYSIDPPL................................................................
A0A5N5EVR1_9ROSA/68-147                .......................................................r-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......-S............G...VT....Y.N...........IPVIIWLMESYPR...........................HPP..C..V..Y..V.NPTRDM..............VIK...R.PH..aHVN.P..S....GSV....SI..P...........Y.L..Q..N.WVY.........PSSN...............LVEL.VKNLSA.......VFGQDPPL................................................................
A0A314UXX6_PRUYE/40-161                .......................................................i-RTHLVSLTTKYP.......CL.DPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..S.......FH............G...VT....Y.N...........IPVIIWLTESYPH...........................HPP..C..V..Y..V.NPIRDM..............VIK...C.PH..aHVN.P..S....GLV....SI..P...........Y.L..H..N.WVY.........PSSN...............LVEL.GESLSA.......VFGQDPPL................................................................
A0A4V5N367_9PEZI/157-279               .......................................................a-YADAARTLSTHP.......TL.GPR.TE..V.Y..................T...........H.....E.....NGS..S.A...LLLT..LSGTLPV..S.......FR............G...SE....Y.R...........FPVKIWFPQFYPQ...........................EAP..M..V..Y..V.TPGRDM..............LIR...P.GQ...HVG.V..D....GRV....YH..P...........Y.L..R..D.WSSm.......wDRAS...............IVEF.LSYLQQ.......VFSKEPPV................................................................
A0A4W2BQK9_BOBOX/74-194                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..I.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQDELPL................................................................
G8YL75_PICSO/26-166                    .......................................................t-YTHLYQFLEVHFnk...nlRF.RIK.TS..I.F..................T...........S....gL.....TGR..S.S...LLIN..LNGSIPI..G.......ND............-...--....T.E...........VPLVIWIPHNYPYsselt.................seddmGVP..I..V..F..V.KNDISKg............lYVK...P.GN...HID.S..Q....GKF....YH..P...........Y.L..T..S.WGRd......ylTNSSf............ynLLKL.VDIMKA.......SFQKECPI................................................................
A0A194R3P8_PAPMA/21-141                .......................................................t-AREVISLIQVYR.......SL.VYR.LE..A.F..................V...........F.....N.....NGT..R.K...DLLN..LEGTIPV..N.......YK............G...AF....Y.N...........IPVSIWLMDTHPQ...........................NAP..L..C..F..V.KPTPEM..............TIK...T.SK...WVD.S..N....GKI....YL..P...........Y.L..H..E.WSP.........SGST...............LQRL.VQWMIT.......AFGELPPV................................................................
A0A1S2Z9G0_ERIEU/21-141                ........................................................TVEELKNVNMIFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YH............G...TT....Y.N...........IPIHLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A2K5JZY1_COLAP/29-136                ..................................................gfffll-------------.......--.---.--..-.-..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........VRSI...............----.------.......--------wifyrkilkkllilnsqdnpl...........................................
A0A6P5BKC6_BOSIN/30-150                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..I.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQDELPL................................................................
V4TA73_CITCL/33-153                    .......................................................i-RKQLLSLLQNYP.......SF.NLS.ND..T.F..................T...........H.....N.....DGT..A.V...NLFK..VSGCFHV..S.......QS............-...-T....P.P...........IHFTLWLHENYPS...........................MAP..M..A..F..I.VSSNSM.............yPIR...Q.NH..pFVS.P..C....GTI....TT..P...........Y.L..Q..T.WSY.........PGYN...............LNDL.VHNLVQ.......IFSHDHPL................................................................
A0A7C8HYN3_9PLEO/26-148                ........................................................TYHDAAEALSHYP.......SL.SPR.TE..V.Y..................T...........Y.....E.....NGS..S.A...LLLL..LGGTIPV..T.......FR............G...AT....Y.G...........FPVAIWIPHAYPR...........................ESP..I..V..Y..V.TPSQDM..............LVR...P.GQ...HVS.G..D....GKI....YH..P...........Y.L..A..Q.WAKy.......wDKST...............LFDF.LAVLRG.......VFAKEPPV................................................................
A0A1Y2DB56_9PEZI/25-147                ........................................................TYNDVAQVLSAYP.......SL.SPR.TD..V.H..................T...........F.....D.....NGV..S.A...LLVH..VSGTIPV..V.......FR............G...TT....Y.R...........FPISLWVPHSYPR...........................EAP..I..A..Y..V.TPTENM..............VVR...P.GQ...HID.P..Q....GRI....YH..P...........Y.L..V..G.WVEf.......wDKSS...............ILDF.LAILRD.......VFAKEPPV................................................................
A0A212DH07_CEREH/25-103                .....................................................lds-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......-Y............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........--SD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A507D1S6_9FUNG/21-143                ........................................................VYRDTVSALLAYN.......GL.SPK.TD..T.F..................T...........N.....E.....HGV..T.A...VLLC..LHGTIPI..L.......FK............N...VS....Y.N...........IPIAAWVPYVYPL...........................APP..I..P..F..V.QPTSSM..............LIR...N.GK...HVD.L..E....GKI....YH..P...........Y.L..A..Y.WHTa.......pDQRT...............IKEL.LSILQG.......VFQQEPPV................................................................
A0A7E4RCI6_CIMLE/20-140                ........................................................TKKDVVKALEGYK.......AL.SFK.ID..Q.Y..................V...........A.....N.....DGT..C.K...NLLS..LEGTIPI..K.......YR............G...NR....Y.N...........IPICIWLHETHPK...........................FPP..I..C..F..V.KPTPDM..............QIK...V.ST...CID.Y..S....GRI....YL..P...........Y.L..S..D.WNA.........KKSD...............LLNL.IRIMTE.......VFGDNPPL................................................................
A0A1X2GUR8_9FUNG/21-144                ........................................................TFRDVDAALQMHS......nSL.KPQ.VN..T.Y..................T...........Y.....N.....DGH..S.Q...LLLC..LHGTLPI..T.......YR............N...SP....Y.N...........IPVAFWIPTEYPQ...........................CAP..I..P..Y..V.QPTANM..............LVR...A.SQ...YVD.Q..S....GLC....YH..P...........Y.R..S..Q.WKDd.......vNGHN...............LLEL.ITIFQH.......VFSLEPPV................................................................
F6W3G3_CALJA/23-143                    .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A337SU32_FELCA/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YK............G...NI....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A139AR98_GONPJ/22-127                .......................................................v-SADIEGAMRIFP.......HL.QPS.LE..K.P..................L...........P....pP.....DPN..AgF...EMIK..LEGTIPV..F.......WR............V...AS....Y.N...........IPIVLYVPPNYPA...........................SPP..R..I..R..V.RPTQDM..............QIK...I.GQ...AVPyE..S....GEV....VL..P...........Y.L..Q..H.WAS.........QR--...............----.------.......--------ep..............................................................
A0A1J9QWC0_9PEZI/26-148                .......................................................a-YNDAAEALAQYP.......SL.SPR.TD..V.Y..................T...........Y.....E.....NGV..P.A...LLLL..LTGTLPV..Q.......FR............G...AI....Y.R...........FPISLWVPHDYPH...........................EPP..M..V..Y..V.TPTQDM..............LVR...P.GQ...HVS.G..E....GRV....YH..P...........Y.L..S..G.WASy.......wDKSS...............ISDF.LTVLRG.......VFAKEPPV................................................................
A0A1J7JN81_9PEZI/25-147                ........................................................TYNDVAQALSQYP.......SL.SPR.TD..V.H..................T...........F.....P.....NGT..S.A...LLLH..LTGTIPV..L.......FR............G...TT....Y.R...........FPISLWVPHAYPR...........................EAP..L..V..Y..V.TPTETM..............VVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..V..G.WTTf.......wDKST...............ILDF.LAILRD.......VFAKEPPV................................................................
A0A6I8TMN2_AEDAE/1-101                 ......................................................me-------------.......--.---.--..-.-..................V...........F.....N.....DGT..V.K...QLIN..LQGTIPV..R.......YK............G...NT....Y.H...........IPICIWLLDTHPR...........................YAP..I..C..Y..V.KPTSDM..............HIK...V.SM...YVD.H..N....GKI....YL..P...........Y.L..H..D.WTP.........MQSD...............LLGL.IQVMIV.......TFGEYPPV................................................................
K7CF25_PANTR/21-141                    ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPM................................................................
A0A671G224_RHIFE/21-141                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.VKEMIA.......KFQEELPL................................................................
A0A6P6I6Y9_PUMCO/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YK............G...NI....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
H2NDX9_PONAB/21-141                    .......................................................t-VRETVNVMTLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A6P3VL66_CLUHA/22-142                ........................................................TMREIMNVITPYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.K...ELMS..LAGTVPV..N.......YR............G...NT....Y.N...........IPICVWLLDTYPY...........................NPP..I..C..F..V.RPTSTM..............MIK...T.GK...HVD.A..N....GKV....YL..P...........Y.L..H..K.WKP.........PQSD...............LLNL.IQVMVL.......VFGEEPPV................................................................
A0A6A5F1N0_PERFL/22-142                ........................................................TVREITNVISQYK.......DL.KPL.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NI....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
C5E4B5_ZYGRC/35-152                    ........................................................TFHDSVVVLSYYK.......QL.RPR.TR..V.Y..................T...........D.....S.....NGI..S.E...LLLC..IYGKPEI..G.......SP............-...--....-.-...........VPLLIWIPKSYPL...........................EHP..I..V..Y..I.DLESLKd............aKVS...P.GE...HVD.P..N....GLI....TL..P...........I.F..G..K.WNA.........DTCN...............LLHV.VQECIK.......IC------rydhvi..........................................................
A0A5N6DJ33_ASPPA/33-155                ........................................................TYYDVASVLAQYP.......SL.SPR.TE..V.Y..................T...........Y.....E.....NGF..S.A...LLLQ..LTGTVPV..T.......FR............G...TV....Y.K...........FPISLWVPNTYPR...........................EPP..I..V..Y..V.TPTQDM..............EVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wERST...............LVDL.VSILRE.......VFAKEPPV................................................................
A0A5J9UX13_9POAL/31-101                .......................................................i-CNHLVALAEAIP.......SL.HPK.AT..L.F..................T...........N.....N.....DGR..A.A...HLLQ..ADGSIPI..H.......HA............G...VS....Y.N...........LPAVIWLAT----...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------ralpalpasrlpp...................................................
A0A068UAB2_COFCA/37-158                .......................................................i-RQHLLALYDVYP.......SL.NIK.TS..T.F..................T...........H.....N.....DGR..S.V...NLLH..ADGTVPM..L.......YN............G...IT....Y.N...........IPVIIWLMESYPH...........................HAP..L..V..M..V.SPTPDM..............IIK...R.PH..pFVD.P..S....GVV....KI..P...........Y.L..Q..S.WIY.........PSSN...............LVEL.ARSLSA.......HFGRDPPL................................................................
A0A1Q3E8N7_LENED/20-158                ................................................vynevnta--------LETFGlygrsngWL.KVK.SD..V.Y..................T...........Y.....D.....DGR..T.H...LLLC..LHGLLPI..N.......YR............D...ST....Y.H...........IPVDMWIPFNYPR...........................GPP..I..V..Y..V.VPAQGM..............MVK...N.SK...FVE.L..S....GRCdvanYE..G...........T.K..G..S.WLDr.......gE--Krte........trpgLVGL.IDALIA.......WFGKDPPV................................................................
A0A1V2L5H0_CYBFA/28-150                ........................................................TYHDAAVALQAYP.......TL.KPR.TR..V.Y..................T...........S.....E.....IGE..S.R...LLLN..LHGSLPA..N.......IQ............G...RT....Y.K...........IPVDLWIPHEYPL...........................AAP..I..A..Y..V.VPTEKM..............VLQ...P.GN...HVD.S..S....GRC....YL..P...........Y.L..A..S.WGQs.......eQQST...............VITL.CSSLST.......VFSREPPV................................................................
A0A452J4Y8_9SAUR/21-141                ........................................................TIEELKNVVKIYP.......NF.RFS.MD..T.Y..................T...........F.....K.....DGS..L.K...DLLN..FSGTIPV..K.......YQ............G...NS....Y.N...........IPICLWILDSHPF...........................APP..I..C..L..L.KPTINM..............EIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKSI...............IIGL.IKEMIE.......KFEEELPL................................................................
A0A6D2IWA1_9BRAS/40-161                .......................................................i-RQHLLSLISSYA.......SL.EPK.TA..A.F..................T...........H.....N.....DGR..S.V...ILLQ..ADGTVPM..P.......FQ............G...VS....Y.N...........IPVVIWLLESYPS...........................HPP..C..V..Y..V.NPTRDM..............IIK...R.PH..sNVS.P..S....GLV....SL..P...........Y.L..H..N.WVY.........PSSN...............LLDL.AAQLSA.......AFSRDPPL................................................................
A0A673BLC9_9TELE/21-141                .......................................................a-IEELQKIHRIFP.......GM.TPV.PG..T.Y..................T...........F.....S.....DST..Q.K...DLLK..LIGNIPV..Q.......YE............G...HT....Y.N...........FPVQLWLMDSFPF...........................TPP..I..C..L..L.RPTSNM..............VIR...E.GK...HVD.T..K....GRI....HL..P...........A.L..H..N.WDY.........PKSS...............VVGL.LKEMIA.......KFEEDPPL................................................................
A0A2K5S826_CEBIM/26-146                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A6P7Y6D3_9AMPH/21-89                 ........................................................TVHEITSVITTYK.......DL.KPV.MD..G.Y..................V...........F.....N.....DGT..S.R...ELMS..LTGTIPV..T.......YK............G...L-....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------wclgrtsslfssllfqhpthhtr.........................................
A0A1J8R6Y9_9AGAM/24-146                ........................................................VFADFHTALSRFS.......SL.RPK.SD..V.Y..................T...........Y.....D.....DGR..T.Q...LLLC..LHGVLPI..S.......FR............A...AS....Y.N...........IPIAVWLTKEYPR...........................QPP..I..V..Y..V.VPTQDM..............LVR...P.SK...HLD.V..S....GRC....SI..E...........Y.I..Q..H.WEKk.......sEACN...............LSAL.LEAMQQ.......EFSRGPPV................................................................
A0A1A6GDL4_NEOLE/21-141                ........................................................TVEELKNVNVFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DTS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSYPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..K....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A565BM01_9BRAS/41-159                .......................................................i-RKHLTSFLQELP.......NF.KLS.TD..T.F..................N...........H.....N.....NGT..T.V...QLFR..LEGSLRT..Q.......QQ............-...-L....P.S...........VELTIWVHENYPL...........................TPP..L..V..F..V.NPNSI-..............PIR...T.NH..tFIN.S..S....GHT....NS..N...........Y.I..E..T.WEY.........PRCN...............LLDF.IRNLKK.......VLSNDHP-f...............................................................
A0A6I8PDA4_ORNAN/21-141                .......................................................t-LEELKNVNMAYP.......NF.RFS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..K.......YQ............G...NT....Y.Y...........MPIRFWILDSHPF...........................APP..I..C..F..L.KPTPNM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............LLGL.ISEMIA.......KFQEELPL................................................................
A0A6J8CT55_MYTCO/21-141                ......................................................ak--RDILGVFLRYT.......DL.RPM.HG..P.F..................I...........F.....N.....DGS..Q.K...DLVH..IDGCLPV..Q.......FR............G...NI....Y.N...........IPIDIVILDTHPY...........................NPP..I..V..Y..V.KPADGM..............NIK...P.GT...YVN.L..S....GKV....DL..P...........Y.L..R..D.WRY.........PHSD...............LLGL.IEILVI.......VFGEEPPV................................................................
A0A6P6UY88_COFAR/38-159                .......................................................i-RQHLLALYDVYP.......SL.NIK.TS..T.F..................T...........H.....N.....DGR..S.V...NLLH..ADGTVPM..L.......YN............G...IT....Y.N...........IPVIIWLMESYPH...........................HAP..L..V..M..V.SPTPDM..............IIK...R.PH..pFVD.P..S....GVV....KI..P...........Y.L..Q..S.WIY.........PSSN...............LVEL.ARSLSA.......HFGRDPPL................................................................
A0A1V6R6S0_9EURO/32-154                ........................................................TYHDVANALSQYP.......SL.SPR.TD..V.Y..................T...........Y.....E.....TGF..S.A...LLLH..LVGTLPV..T.......FR............G...TT....Y.R...........FPISLWIPNTYPR...........................EPP..I..T..Y..V.TPTQEM..............VVR...V.GQ...HVT.L..E....GQV....YH..H...........Y.L..A..H.WAEa.......wDRSN...............IADL.LSILQD.......VFAKEPPV................................................................
A0A2K6SIW6_SAIBB/21-73                 ........................................................TVEELKNVNKFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...VS....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------dinsks..........................................................
W6QFD5_PENRF/32-154                    ........................................................TYHDVANALSQYP.......SL.SPR.TD..V.Y..................T...........Y.....E.....TGF..S.A...LLLH..LVGTLPV..T.......FR............G...TT....Y.R...........FPIALWIPNTYPR...........................DPP..I..A..Y..V.TPTQEM..............AVR...V.GQ...HVT.L..E....GQV....YH..H...........Y.L..A..H.WAEa.......wERSN...............IADL.LSILQD.......VFAKEPPV................................................................
A0A091KSK6_9GRUI/8-128                 ........................................................TIKETTSVITQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
H2LW02_ORYLA/24-145                    .....................................................tll---DLQEARSRFP.......DL.SLY.AD..Y.Y..................C...........F.....P.....NKE..T.K...KLVF..LAGTLPV..L.......YE............G...ST....Y.N...........IPVCVWLHVTHPE...........................SCP..R..C..Y..V.CPSASM..............VIN...P.SC..pCIN.A..S....GNI....SL..D...........G.L..T..K.WTR.........GVSS...............LSEL.LAEMIQ.......VFQRDTPI................................................................
A0A6J2WRN2_CHACN/23-143                .......................................................t-LAEIIAVMSQNK.......HL.EPV.MD..R.F..................V...........Y.....N.....DGT..G.K...NLMS..LQGTIAV..L.......YK............G...KH....Y.N...........FPVCLWLEESYPR...........................SPP..I..C..F..V.KPTREM..............VIV...P.CK...YVD.N..D....GKI....LL..P...........Y.L..D..E.WRH.........TQCD...............LHGL.IQVMMA.......VFGEIPPL................................................................
A0A2R8MAN8_CALJA/471-591               .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A446USX8_TRITD/30-155                ......................................................vp--DHLATLAEAFP.......SL.RPR.TA..L.F..................T...........H.....D.....DGR..A.A...RLLQ..AAGTIPI..V.......HA............G...GS....Y.D...........LPAVVWLPERYPR...........................CPP..L..V..F..L.SPARGT..............VLR...T.DH..pLVD.R..S....GLVaaaaAA..P...........Y.L..R..S.WAF.........PSSN...............LRDL.VRSLSH.......AFGIDPPL................................................................
A0A1X1BH87_9APIC/33-148                ......................................................me--ADVRAVLTKYH.......GL.TMG.LN..-.-..................-...........-.....-.....YRG..E.D...VVLN..LRGTLPF..T.......FQ............N...NT....Y.H...........CPLVISMTKYYPM...........................TPP..L..F..K..V.VTSGNI..............RIV...S.NH..nCVA.K..N....GNI....KI..P...........Y.V..E..S.WNS.........-RST...............LMEA.IRSIQE.......IFDSSAPI................................................................
A0A1B7NNK9_9EURO/33-155                ........................................................TYSDVINLLVQYP.......GF.APR.TD..V.Y..................T...........Y.....E.....NGT..P.A...LLLH..VAGTLPV..T.......FR............G...SV....Y.R...........FPITIWVPKAYPR...........................EPP..M..V..Y..V.TPTRDM..............LVR...P.GQ...HVS.G..E....GRV....YH..H...........Y.L..A..H.WSEa.......wDRST...............IVDF.LYILRD.......VFAKEPPV................................................................
A0A177CQ08_9PLEO/2-106                 ...................................................lttsa-------------.......--.---.--..-.-..................-...........Y.....E.....NGA..S.A...LLLQ..LSGTIAV..Q.......FR............G...QT....F.G...........FPVAIWVPHAYPR...........................EPP..I..V..Y..V.TPSPDM..............IVR...P.GQ...HVS.G..D....GRV....YH..P...........Y.L..A..Q.WAKy.......wDKST...............LYDF.LAVLKG.......VFAKEPPV................................................................
A0A2R8ZX78_PANPA/18-138                ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPM................................................................
G7JPJ7_MEDTR/36-157                    .......................................................i-RQHLLSLLTTFP.......SL.EPK.TA..T.Y..................T...........H.....N.....DGR..A.V...NLLQ..ADGTIPM..T.......YQ............S...VT....Y.N...........IPIVIWLMESYPR...........................HPP..R..V..Y..V.NPTRDM..............IIK...H.AH..pHVN.P..S....GLV....SV..P...........H.L..H..N.WIY.........PSSN...............LVDL.VLALSL.......IFGRDPPL................................................................
A0A2K1QMN6_9PEZI/25-154                .......................................................a-YNDIAAAIANYP.......SL.QPR.TD..T.Y..................H...........F.....E.....NGR..P.A...LLVC..LAGTIAV..D.......FR............G...RQ....Y.R...........YPVEIWIPQEYGQp.........................gVGI..I..A..Y..V.RPSTTRess........vgmMVR...P.GQ...HVA.V..D....GRI....YH..P...........Y.L..R..D.WGL........qSRCT...............IVDF.LRILQG.......VFAKEPPI................................................................
A0A0D9QYD9_CHLSB/12-132                ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NK....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A0A2JSJ6_PENEN/32-154                ........................................................TYHDVANALAQYP.......SL.SPR.TD..V.Y..................T...........Y.....E.....TGF..S.S...LLLH..LVGTLPV..T.......FR............G...TT....Y.R...........FPISLWIPNTYPR...........................EPP..I..A..Y..V.TPTQEM..............TVR...V.GQ...HVT.L..E....GQV....YH..H...........Y.L..A..H.WAEa.......wDRST...............IADL.LSILQD.......IFAKEPPV................................................................
A0A1L8GE79_XENLA/21-141                ......................................................sv--REILNVTSLYR.......DL.KPI.MD..S.Y..................V...........F.....N.....DGS..S.R...ELLS..LSGTIPV..P.......YK............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSTM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PPSD...............LLGL.IQILIV.......VFGEEPPV................................................................
A0A0M4F1U6_DROBS/22-142                ........................................................TRKDVIDVVTTYR.......SL.SYD.LQ..T.F..................V...........F.....N.....DGS..K.K...DLFQ..LQGTIPV..V.......YK............N...NT....Y.Y...........IPICIWLMDTHPQ...........................NAP..M..C..F..V.RPTPTM..............QIK...V.SM...YVD.H..N....GKI....YL..P...........Y.L..H..D.WQP.........QSSD...............LLSL.IQVMIV.......TFGDHPPV................................................................
A0A7N5JJ48_AILME/1-112                 ......................................................mf-----------FP.......HF.RYS.VD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTVPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..H..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A663EZF7_AQUCH/1-102                 ........................................................-------------.......--.---.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIHLWILDSHPF...........................APP..I..C..F..L.KPTVNM..............GIL...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VIGL.IKEMIA.......KFEEELPL................................................................
A0A2Z7DFB4_9LAMI/31-152                .......................................................i-RQHLLHLTEAYP.......SL.QPK.TA..V.F..................N...........H.....N.....DGR..T.V...NLLQ..ADGTVPM..S.......FQ............G...VT....Y.N...........IPVLIWLMEAYPR...........................QVP..F..V..L..V.NPTRDM..............IIK...R.PH..pFVS.P..N....GVV....SI..P...........Y.L..Q..T.WVF.........PGSN...............LVEL.VRNLSH.......FFARDPPL................................................................
A0A3Q3L9R4_9TELE/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A319EMD5_ASPSB/33-155                ........................................................TYYDVANVLGQYP.......SL.GPR.TE..V.Y..................T...........F.....E.....NGF..S.A...LLLQ..LTGTLPV..T.......FR............G...TV....Y.K...........FPITLWIPNTYPR...........................EPP..L..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wERSS...............LHDF.LLILRE.......VFAKEPPV................................................................
A0A1U7YBL0_NICSY/49-168                .......................................................i-RRHLISLLQNYP.......SL.RPS.ID..T.F..................T...........H.....D.....DGT..T.A...NLLN..ANGELQV..S.......SS............-...-T....P.A...........IPLTIWLHESYPF...........................MAP..I..V..L..V.SLNTSY..............PIY...N.NH..pFVD.S..S....GSI....SS..F...........Y.L..V..N.WKY.........PGCN...............LSDL.VHNLIK.......IFSHNHP-f...............................................................
A0A3Q0GHP4_ALLSI/21-141                ........................................................TIEELKNVNKIYP.......NF.LFS.MD..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPI..T.......YH............G...HS....Y.N...........IPVRLWILDSHPF...........................APP..I..C..F..L.KPTVNM..............GIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VIGL.IKEMTA.......KFDEELPL................................................................
L5KY97_PTEAL/69-189                    ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTVPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WTH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A096LPP7_POEFO/1-89                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...--MS..LTGTIPV..V.......FS............G...KT....Y.N...........IPICVWFEPNYPN...........................SPP..M..C..Y..V.KPTREM..............IIV...K.GK...YIS.S..D....GEV....TI..P...........Y.L..K..D.WKK.........GQCD...............LSSL.LQVMAI.......LFGEVPPL................................................................
H0WEZ6_DANRE/23-143                    ......................................................vl--SEISLVLSHYQ.......HL.EPV.LE..K.F..................V...........F.....N.....DGT..A.K...NLIN..LTGTIQV..F.......YE............R...KQ....Y.N...........IPVTLWLRESYPR...........................TAP..I..C..Y..L.KPTCEM..............VVV...T.SK...YVN.S..N....GEI....MM..P...........Y.L..D..E.WKH.........TKCD...............LHSL.IQVMMA.......TFSEVPPL................................................................
A0A1M8A9M6_MALS4/22-144                ........................................................IMRDMEHVLTEYH.......TL.RPR.TD..M.F..................T...........Y.....D.....DGR..C.V...LLLL..LDGTLPV..P.......FR............G...QV....Y.Q...........IPVHVWIPRAYPA...........................EPP..I..V..Y..V.APTQNM..............VVC...R.GS...CVG.P..D....GRV....RL..P...........Y.M..D..A.WERk.......pEGTS...............LTEL.LRECQT.......VFHLEPPV................................................................
A0A078FYV7_BRANA/36-156                .......................................................i-RKHLTSFLQDFS.......NF.DLS.TD..T.F..................N...........H.....N.....NGT..T.V...QLFR..LDGSLRT..P.......QQ............-...-S....K.A...........VQLTIWVNENYPL...........................TPP..L..V..F..V.IPPDSM.............tPVR...T.NH..pFVS.S..S....GFT....NS..N...........Y.I..E..T.WEY.........PPCN...............LLNF.VRNLRR.......VLANDHP-f...............................................................
A0A2K6RHQ7_RHIRO/36-119                ....................................................kysm-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......TY............G...NT....Y.N...........IPIRFWILDSYPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A673UWJ6_SURSU/38-121                ....................................................rysm-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......TY............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GVS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A3Q0GHP4_ALLSI/433-553               ........................................................TVQETISVITQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
N1RXI4_FUSC4/34-156                    .......................................................a-YNDVAQALDRFP.......SL.SPR.TD..V.H..................T...........F.....S.....NGA..N.A...LLLH..LSGTLPV..N.......FR............G...TT....Y.R...........FPISIWVPHAYPR...........................EPP..M..I..Y..V.VPTETM..............MIR...P.GQ...HID.P..Q....GLV....YH..P...........Y.L..V..G.WAEf.......wDKSN...............LRDF.LNILTD.......IFAKEPPV................................................................
G7XMN5_ASPKW/68-176                    ................................................ttsfprll-------------.......--.---.--..-.-..................A...........Y.....E.....NGF..S.A...LLLQ..LTGTLPV..T.......FR............G...TV....Y.K...........FPITLWIPNTYPR...........................EPP..L..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wERSS...............LVDF.LMILRE.......VFAKEPPV................................................................
W9XRL9_9EURO/26-148                    ........................................................TYSDLAHVLARHP.......GL.TPR.TD..V.Y..................T...........Y.....E.....DGA..S.A...LLVH..FKGTIPV..N.......FR............G...NT....Y.R...........FPISLWIPHAHPY...........................EPP..I..C..Y..V.TPTEDM..............MIR...P.GQ...HVG.G..D....GKI....YH..P...........Y.L..A..H.WREt.......wERSN...............VVDF.LSILSD.......VFAKEPPV................................................................
W9VRM5_9EURO/26-148                    ........................................................TYSDLAHVLARYP.......GF.APR.TD..V.Y..................T...........F.....E.....TGA..P.A...LLVV..FTGTIPV..N.......FR............G...NT....Y.R...........FPVTLWVPHAYPY...........................EPP..M..C..Y..V.TPTDDM..............VIR...P.GQ...HVG.G..D....GRI....YH..P...........Y.L..A..H.WREh.......wERSN...............ALDF.LSILSE.......IFAKEPPV................................................................
F7G233_MONDO/7-105                     .......................................tveeltkvnmlypnfrf-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-----SM..D.......TY............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSI...............ITGL.ISEMII.......KFQEELPL................................................................
A0A6P5RFZ1_PRUAV/41-162                .......................................................i-RNHLVSLTTAYP.......SL.DPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..AEGTVPM..L.......FH............G...VT....Y.N...........IPVIIWLMESYPR...........................QPP..V..V..Y..V.NPTRDM..............IIK...R.PH..eHVN.P..S....GLV....SI..P...........Y.L..H..N.WVY.........PSSN...............LVEL.AKNLSA.......VFGQDPPL................................................................
M4CVK1_BRARP/73-198                    ............................rswglahahlddvlahiretlycfpwmk-------------.......--.---.--..-.-..................-...........-.....-.....SDP..V.A...NLLN..LTGDVEY..I.......YK............G...NS....F.K...........AFITIYLPESYPK...........................DPP..Q..A..W..V.VCEDGI.............tGIN...H.KQ..mHVA.A..N....GSV....SI..P...........Y.L..W..D.WDG.........KSST...............LLQF.ILHMSV.......EFTSQPP-t...............................................................
A0A6A2ZF55_HIBSY/41-162                .......................................................i-RQHLLSLVSNYP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..S.I...NLLQ..ADGTIPM..P.......FQ............G...VT....Y.N...........IPIIIWLMESYPR...........................YAP..A..I..Y..V.NPTRDM..............IIK...R.PH..pNVS.P..S....GLV....SI..P...........Y.L..H..N.WIY.........PSSN...............LVDL.VGNLSS.......AFSRDPPL................................................................
A0A452FK29_CAPHI/17-137                .......................................................t-VCETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGN..S.R...ELMN..LTGTIPV..P.......YR............N...ST....Y.S...........IPICLWLLDTNPY...........................NPP..I..C..F..I.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDESPV................................................................
V5B2G1_TRYCR/125-209                   .................................................eqapphr-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....Y.V...........LPLQIWLTHLYPI...........................EPP..L..V..F..L.LSAEKG.............cRIA...S.NH..eYVD.A..T....GRC....HT..P...........E.L..A..A.WHP.........VSSS...............LCDV.VKKLGQ.......RLST----edlipl..........................................................
A0A094BHG4_9PEZI/26-148                ........................................................TYHDVAQALSHYS.......SL.SPK.TE..V.Y..................T...........Y.....E.....NGV..S.E...LLLQ..LSGTLPV..A.......FR............G...TT....Y.R...........FPVTVWIPHQYPR...........................AEP..V..V..Y..V.SPADGM..............MVR...A.GQ...HVD.P..Q....GRV....YH..P...........Y.L..A..G.WAEf.......hDKSN...............ILDF.LAILRD.......VFAKEPPV................................................................
A0A2A9P705_9HYPO/25-147                ........................................................TYNDVARVLNRQP.......SL.APR.TD..V.H..................T...........F.....P.....DGT..S.A...LLLH..LSGTIPV..V.......FR............G...ST....Y.R...........FPLSIWVPHAYPR...........................EPP..L..V..Y..V.TPTQSM..............VVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..V..R.WSDf.......wDKST...............LEDF.LAVLTD.......VFAKEPPV................................................................
A0A4Z2CSL4_SCHJA/1-78                  .......................................................m-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............G...ST....Y.N...........IPIAIFLFESYPH...........................KSP..M..V..Y..V.RPTNTM..............QIK...P.SD...FVD.S..A....GLV....QL..P...........Y.M..T..D.WKH.........PDAD...............LIGL.ISVLQI.......VFGETSPV................................................................
A0A087X9H1_POEFO/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSTM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A6A3ABS2_HIBSY/33-156                .......................................................i-LRHLLSLLQEFP.......GF.EPS.TG..W.Y..................M...........Q.....N.....DGT..E.V...NLLR..ATGFIHV..S.......DD............S...SS...tP.P...........VPLVIWLHENYPQ...........................RAP..L..V..F..V.SIDPET..............PIH...R.HH..pFVDnT..S....GEA....SS..P...........Y.L..I..T.WKH.........PSCD...............LTGL.LRNLVH.......LFSIDHP-f...............................................................
A0A5F5XBW6_FELCA/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YK............G...NI....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A061FR54_THECC/41-162                .......................................................i-RQHLLSVTSHYP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......FQ............G...IT....Y.N...........IPIIIWLMESYPR...........................HPP..V..V..Y..V.NPTRDM..............IIK...R.PH..pHVT.P..S....GLV....SI..P...........Y.L..Q..N.WIY.........PSSN...............LVDL.VLNLSS.......AFARDPPL................................................................
A0A2U3X195_ODORO/36-119                ....................................................rysm-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......TY............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A507F210_9FUNG/11-130                ........................................................VVQHCDAALTAFP.......SL.RPK.TD..-.-..................-...........-.....R.....DSD..G.T...VVLV..IAGTVPV..L.......FR............G...AV....Y.N...........IPLAMFLPLSYPS...........................HPP..S..V..L..V.TPTANM..............LVR...A.GR...NVD.A..N....GRV....YH..S...........M.L..A..Q.WHAm......kaEDRS...............LVAL.ISVLQN.......VFAMDPPV................................................................
A0A084WA88_ANOSI/22-141                ........................................................TKKDVLNVLRIYH.......GL.QHR.VE..E.Y..................V...........F.....N.....DGS..T.K...HLLN..LNGTIPV..K.......FK............G...NT....Y.N...........IPICVWLMDTHPR...........................NAP..M..C..Y..V.KPTPEM..............RIK...V.SA...YVD.F..N....GKI....YL..P...........Y.L..H..E.WNP.........-KSD...............LLDL.IQIMSV.......TFGETPPV................................................................
A0A444TM76_ARMVU/35-155                .......................................................t-RQEAMIAIKHYP.......CL.SPK.KE..S.F..................V...........F.....N.....DGS..E.K...EFLN..LDGTIPV..R.......YK............G...ST....Y.N...........IPICIWLLDNHPL...........................SAP..M..V..Y..V.KPTVEM..............LIK...P.SR...HVD.Q..N....GKV....YL..P...........Y.L..H..E.WNS.........NSSD...............LLGL.IQIMIM.......TFAEMPPV................................................................
A0A5B7DGN9_PORTR/10-69                 .....................................................wgl-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............G...SL....Y.N...........IPVCIWVLDNHPI...........................SPP..M..V..Y..V.KPTPDM..............LIK...A.SR...HVD.Q..N....GKV....FL..P...........Y.L..H..E.WN-.........----...............----.------.......--------lfk.............................................................
A0A6G0UGH6_9BILA/22-142                .......................................................a-KNDIKGALSNFS.......DL.SPK.AQ..L.H..................V...........F.....P.....DNT..R.R...NALT..LAGTIPI..S.......YR............G...AR....Y.H...........IPIALYLMENHPY...........................SPP..Y..C..Y..V.CPTSNM..............KIR...V.SG...RVD.E..A....GRI....YL..P...........Y.L..N..E.WRF.........PGSD...............TYGL.LQVLTF.......AFEENCPV................................................................
A0A5D2XP94_GOSMU/41-162                .......................................................i-RQHLLSLTSRYP.......SL.QPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......YQ............G...VT....Y.N...........IPIIIWLIESYPR...........................YPS..V..V..Y..V.NPTRDM..............IIK...R.PH..pHVS.P..S....GLV....SI..P...........Y.L..Q..N.WIY.........PSSN...............LVDL.VINLGS.......AFSHDPPL................................................................
G1T6F8_RABIT/21-141                    ........................................................TVEELKNVNTFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..S.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A4W4HKU5_ELEEL/22-142                ........................................................TVREITNVILQYK.......DL.KPL.MD..A.Y..................V...........F.....N.....DGS..S.R...ELMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A2U9BZ30_SCOMX/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
X0DBJ4_FUSOX/25-147                    .......................................................a-YNDVAQALDRFP.......SL.SPR.TD..V.H..................T...........F.....S.....NGA..N.A...LLLH..LSGTLPV..N.......FR............G...TT....Y.R...........FPISIWVPHAYPR...........................EPP..M..I..Y..V.VPTETM..............MIR...P.GQ...HID.P..Q....GLV....YH..P...........Y.L..V..G.WAEf.......wDKSN...............LRDF.LNILTD.......IFAKEPPV................................................................
A0A2K5X8M5_MACFA/21-72                 ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...VS....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------ginsk...........................................................
A0A2I2Z4S2_GORGO/21-141                ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIHFWILDSHPF...........................APP..I..C..F..L.KPTANM..............RIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPM................................................................
A0A0D2RBF7_GOSRA/41-162                .......................................................i-RQQLVSLISNYP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......FQ............G...VT....Y.N...........IPIVIWLMESYPR...........................YAP..A..V..Y..V.NPTRDM..............IIK...R.PH..pHVS.P..S....GLV....SI..P...........Y.L..H..N.WIY.........PSSN...............LVDL.VLHLSS.......AFSRDPPL................................................................
A0A3P8B3J0_9TREM/1-116                 .......................................................m---DVTCALKAFK.......EL.RPK.FE..D.F..................I...........Q.....N.....DGT..S.R...RLVS..LDGTIPV..R.......YM............G...ST....Y.N...........IPIAIFLFEAYPH...........................KSP..M..V..Y..V.RPTNTM..............QIK...P.SD...FVD.S..A....GLV....QL..P...........Y.M..T..D.WKH........vS---...............L---.------.......--------ykqfqltsnlflacel................................................
A0A1R2CYD1_9CILI/25-145                ......................................................lh--QEVVKVIQANQ.......YL.QIE.M-..I.Q..................S...........Q.....V.....QNS..Y.L...VVLQ..LRGVLPI..F.......FK............K...IQ....Y.R...........IPVRIIYPPTYPN...........................SPP..D..L..Y..V.DPSPEM..............IIN...Q.NN..eNIK.P..D....GKV....NI..S...........L.I..K..N.WKK.........KKNT...............SYEL.IEEAKK.......SFSNKIPV................................................................
A0A4W4HBB4_ELEEL/26-147                .......................................................v-LSDVWEARAAFP.......DL.HLH.EG..Y.Y..................Y...........Y.....P.....NNE..K.K...KLVN..LRGTVPI..V.......YE............G...NK....Y.N...........IPVCIWIHITHPQ...........................SPP..R..C..L..V.CPSPCM..............MIN...G.NS..sSVD.A..Q....GHV....LL..H...........C.L..S..N.WKP.........GWSG...............LSIV.LEEMVA.......AFQRETPL................................................................
A0A1A0HK27_9ASCO/26-165                .......................................................a-YKDIYQFLQVYId.....qGF.RIR.TA..V.Y..................T...........S.....V.....HGG..S.E...LLVN..LYGPLIC..G.......NN............-...--....-.V...........FQVSIWIPLNYPLadtsgk..............asgydanGVP..I..T..F..A.VPSKGQ..............IIR...P.GN...NVD.S..Q....GKV....YH..P...........F.L..V..S.WYN.........STSTrqmm.......dqfnLLLL.MECLKS.......TFERSSPI................................................................
A0A4X2JSU9_VOMUR/21-141                ........................................................TVEELTKVNMSYP.......NF.RFS.MD..T.Y..................V...........F.....K.....DNS..Q.K...DLLN..FTGTIPV..N.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTPNM..............GIS...L.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............ITGL.IREMII.......KFQEELPL................................................................
A0A165HJP5_XYLHT/26-148                ........................................................TYADVARTLSSYS.......SL.SPR.TD..V.Y..................T...........Y.....E.....NGA..S.A...LLLL..VSGTLPV..T.......FR............G...AV....Y.R...........FPISLWIPHAYPR...........................QSP..I..A..Y..V.TAAPGM..............IIR...P.GQ...YIS.A..E....GRI....YH..P...........Y.L..A..Q.WEGm.......wDRST...............LLDF.LAILRD.......AFAKEPPL................................................................
A0A6P7L2U2_BETSP/24-145                .......................................................t-LSDLQQVQSRFS.......DL.RLY.VN..F.Y..................C...........F.....P.....NKE..K.R...RLVY..LAGTIPV..R.......YE............G...LE....Y.N...........IPVCIWLHETHPV...........................SRP..R..C..C..V.CPSISM..............VIN...P.SC..pCVD.S..A....GNI....SL..S...........G.L..S..N.WTN.........GVST...............LSLL.ISEMRQ.......AFQKDTPL................................................................
A0A4U6V6Y9_SETVI/30-153                .......................................................v-RKHVLAVLQEFP.......TL.SPS.VD..T.Y..................T...........S.....D.....DGA..S.A...VLLN..ARGPLAV..S.......PA............-...-L....P.P...........ILLTVWLPREYPY...........................RPP..L..V..F..A.FPAAPS.............aALV...P.DH..pFVD.H..R...tGRVh..rTL..P...........Y.L..E..G.WSV.........PRSS...............LAGL.VRSLVA.......ALRMCHP-l...............................................................
A0A0B1PEA2_UNCNE/27-149                ........................................................TYNNVAQLLSKYS.......SL.SPR.TD..I.F..................T...........Y.....D.....NGK..S.A...LLLK..ISGTIPV..S.......FR............G...TQ....Y.R...........FPIAIWIPHLYPV...........................EAP..L..V..Y..V.VATEGM..............VIR...P.GQ...HVD.L..Q....GKI....YH..P...........Y.L..V..G.WADn.......sDIFN...............LIDF.VEILRD.......VFAKEPPV................................................................
A0A6P6JGT9_CARAU/22-142                ........................................................TVREITNVISQYK.......DL.KPG.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTVPV..G.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A7E5WT41_TRINI/21-141                .......................................................t-AREVINLIQVYR.......SL.TYR.LE..A.F..................V...........F.....N.....NGA..R.K...DLLN..LEGTIPV..N.......YK............G...AF....Y.N...........IPVCIWLMDTHPQ...........................NAP..L..C..F..V.KPTSDM..............SIK...V.SK...YVD.S..N....GKV....YL..P...........F.L..H..E.WTQ.........NGST...............LQKL.IQCMIT.......AFGELPPV................................................................
A0A2X0LIF7_9BASI/22-159                .....................................................ail---QVLATLDHFR......gSL.YHE.LN..D.F..................T...........Y.....D.....DGR..V.E...LLLS..ITGVIPV..P.......IQ............R...AT....Y.Q...........CPITFWLPLDFPN...........................KPP..M..V..F..V.LPSSTL..............IVR...P.GP...NIE.P..S....GKV...vES..A...........Y.L..D..N.WAR.........KAEVrlrralaiaeggcslVALV.VEELIP.......MFSRRY--pv..............................................................
R0JCV9_ANAPL/7-127                     ........................................................TVQETTSVITQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
A0A341D330_NEOAA/21-141                .......................................................t-VRETVSVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...TT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGEEPPV................................................................
A0A6P4ABF2_ZIZJJ/34-153                .......................................................i-RKHLLSLLQEYP.......AF.SPS.FG..T.F..................T...........H.....N.....DGT..A.V...NLFY..ASGELHI..S.......NG............-...-R....P.P...........IPLIIWLHENYPF...........................MPP..M..V..F..V.SPNSTY..............PIH...P.RH..pFID.P..C....GAT....AS..P...........Y.L..Q..T.WIH.........PGCN...............LSKL.VHNLIR.......LFSQDHP-f...............................................................
A0A6P9A897_THRPL/24-145                ........................................................TSKDVISALNVYR.......GL.TFS.VE..A.F..................V...........F.....S.....NGT..R.K...ELLN..LKGTVPV..P.......YK............G...MN....Y.N...........IPVKIWIMDTHPN...........................NAP..I..C..Y..V.NPTSDM..............IVK...P.SR...TTD.H..S....GKI....YL..P...........F.L..H..F.WDP.........RGAE..............lLPSL.IKNMIS.......AFSAEPPV................................................................
A0A6P6ET77_OCTDE/21-141                ........................................................TVEELKNVNTFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NV....Y.N...........IPVRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIT...V.GK...HVD.V..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A3Q2E6B9_CYPVA/53-174                .......................................................t-LRDLQSVRDRFG.......DL.RLW.VD..F.Y..................C...........F.....P.....NKE..Q.R...KLVH..LSGTIPV..L.......HQ............G...SH....Y.N...........IPVCVWLHETHPL...........................SRP..R..C..F..V.CPTATM..............MIN...P.FC..pYVD.S..S....GTV....SL..D...........G.L..Q..N.WTP.........GVSS...............LSLL.LSEMRA.......AFQKDTPL................................................................
A0A2R8ZX84_PANPA/21-141                ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPM................................................................
A0A498L7R9_LABRO/62-172                ..........................................messwkdqqkeear-------------.......--.---.--..-.-..................-...........-.....S.....DSL..Q.K...ELLK..LIGNIPV..R.......YQ............G...RS....Y.N...........LPILLWLLESFPF...........................TPP..I..C..F..L.RPTSSM..............VIR...E.GK...HVD.S..K....GRI....HL..L...........G.L..H..N.WDH.........PKST...............VNGL.LTEMIA.......KFEEEPPL................................................................
A0A091IWK2_EGRGA/8-128                 ........................................................TVQETTSVITQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..T.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
A0A3Q2CNV0_CYPVA/22-142                ........................................................TVREITNVISQYK.......DL.KPL.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSTM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A077Z353_TRITR/3-114                 .......................................syksvacctvlllfsvm-------------.......--.---.--..-.-..................-...........-.....P.....NGC..R.T...AMFM..LSGTIPI..H.......FK............G...IQn..tY.N...........IPICVFLLDTYPK...........................SAP..I..C..Y..V.RPTERM..............VIK...P.SM...HVD.N..T....GLI....YL..P...........Y.L..T..D.WNR.........E---...............----.------.......--------vghyhisicldsvtenp...............................................
A0A448YMG0_BRENA/26-158                ........................................................TYQDTSLILLCYS.......FF.KVR.TA..V.Y..................T...........N.....E.....SGT..S.K...LLVK..IYGDLNL..H.......SN............G...IT....V.S...........--IDLWIPSEYPQ...........................NPP..I..I..Y..V.RSALTS.............dVLS...P.SN...YID.H..S....GKF....YH..P...........F.L..S..S.WTGny.....gaDTSNdgir......pndnrLLRL.VGILIQ.......CFENHPP-r...............................................................
A0A1U7RI31_MESAU/21-141                .......................................................t-VRQTVNVIAMYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELVN..LTGTIPV..R.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..D.WKH.........PRSE...............LLEL.IQIMIV.......VFGEEPPV................................................................
A0A1U8BPA6_NELNU/33-152                .......................................................i-REHLLSLLHDFP.......TL.SPS.AD..T.F..................F...........H.....D.....DGN..I.V...YILN..ASGHLPI..S.......SA............-...-T....P.P...........VPLTIWLHQDYPF...........................SPP..I..V..F..L.SPTPTT..............PLL...P.LH..pFVH.P..S....GLT....TS..P...........Y.L..N..T.WRY.........PHSN...............LSDL.AHNLVC.......LFSHHHP-f...............................................................
A0A452J4Z3_9SAUR/21-141                ........................................................TVQETTSVITQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LIGL.IQIMIV.......VFGEEPPV................................................................
A0A6P8I4Z5_ACTTE/20-140                ......................................................ck--RQILAAMAVYK.......DL.RPS.TE..K.F..................V...........H.....N.....DGR..Q.T...DLFI..LEGTIPV..N.......FR............S...NI....Y.N...........IPVCIFLQETHPF...........................IPP..M..V..F..V.RPTTGM..............AIK...V.SK...HVD.N..S....GKV....FL..P...........Y.L..A..E.WTH.........PGSD...............LTSL.IQILCC.......IFAEEPPV................................................................
A0A100IM55_ASPNG/66-176                ..............................................lltasfprll-------------.......--.---.--..-.-..................A...........Y.....E.....NGF..S.A...LLLQ..LTGTLPV..T.......FR............G...TV....Y.K...........FPITLWIPNTYPR...........................EPP..L..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wERSS...............LIDF.LMILRE.......VFAKEPPV................................................................
F7W5S4_SORMK/25-147                    ........................................................TYNDVAQVLSHYP.......SL.TPR.TD..V.H..................T...........F.....P.....NGA..S.A...LLVH..LSGTLPV..V.......FR............G...TT....Y.R...........FPISVWVPHAYPR...........................EAP..L..V..Y..V.TPTEHI..............MVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..A..G.WSTy.......wDKST...............ILDF.LAILRD.......VFAKEPPV................................................................
A0A5J5F904_9PEZI/32-154                ........................................................TYTDVATTLATYP.......TL.SPR.TS..V.Y..................T...........Y.....E.....NGK..S.E...LMVH..LFGTLPV..M.......FR............G...AT....Y.N...........IPMSIWVPHTYPR...........................QSP..I..A..F..V.TPAKDM..............VIR...P.GN...HVD.L..A....GKC....YH..P...........Y.L..A..N.WPQh.......wERSN...............IVDL.CEVLRG.......VFGREPPV................................................................
A0A0D7B5Z7_9AGAR/23-145                ........................................................VYADVDASLARFP.......TL.RIK.SD..A.Y..................T...........Y.....D.....DGR..T.Q...LLLC..LHNVIPI..N.......FR............G...AM....Y.N...........IPVAIWIPRDYPA...........................EPP..L..V..Y..V.VPTSDM..............LVK...A.GK...HVE.L..N....GRV....DV..E...........Y.I..Q..H.WRRk.......nEGCN...............TSGL.VEELQA.......QFAREPPV................................................................
M7AXD0_CHEMY/14-134                    ........................................................TVQETTSVITQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LIGL.IQIMIV.......VFGEEPPV................................................................
A0A2K0UTN7_GIBNY/25-147                .......................................................a-YNDVAQALDRFP.......SL.SPR.TG..V.H..................T...........F.....S.....NGA..N.A...LLLH..LSGTLPV..N.......FR............G...TT....Y.R...........FPISIWVPHAYPR...........................EPP..M..I..Y..V.VPTETM..............MIR...P.GQ...HID.P..Q....GLV....YH..P...........Y.L..V..G.WAEf.......wDKSN...............LRDF.VNILTD.......IFAKEPPV................................................................
A0A5N6PFA1_9ASTR/33-152                .......................................................i-RRHLLSLLREFS.......SL.NPA.ID..T.Y..................I...........H.....N.....DGA..M.V...NLLK..VEGYLHI..S.......QS............-...-L....P.L...........VHVIIWVHEHYPY...........................VAP..M..V..Q..V.KMDQTK..............PIR...S.NH..pFVD.P..L....GVT....TS..A...........Y.L..H..T.WGP.........FGYD...............LLGL.AHNLVK.......IFSLDHP-f...............................................................
G8BEB9_CANPC/28-168                    ........................................................VYTHVYQFLQQHLkr...nlNF.RIR.TQ..V.H..................T...........S....eE.....TGQ..S.E...LLIN..LFGTIVV..D.......EH............-...--....I.G...........VPIEIWLPFTYPYsdy.....................drkGAP..L..V..Y..V.VPDHAKe............wYLK...P.TN...NVD.P..Q....GKF....YH..P...........Y.L..S..S.WYR.........DCIEvsgdi.....srtynLIEL.VNVICQ.......SVRLEVPI................................................................
A0A2K5ZMI4_MANLE/21-141                ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A7N5K9X7_AILME/23-143                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YK............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A096N0J0_PAPAN/9-129                 ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A1V8UVP2_9PEZI/25-147                ........................................................VYSDIAHTLASFP.......SL.SPR.TE..V.Y..................T...........Y.....E.....TGG..S.A...LLTT..VSGTLPV..D.......FR............G...TP....Y.R...........FPVKLWIPLSYPQ...........................EAP..I..V..Y..V.TPGKEM..............LVR...P.GQ...HVG.V..D....GRV....YH..P...........Y.L..R..D.WSGm.......wDRAS...............VADF.LGYLQQ.......AFAREPPV................................................................
A0A2V1E3U2_9PLEO/26-148                ........................................................TYHDVAETLSNYP.......SL.SPR.TE..V.Y..................T...........Y.....E.....NGA..S.A...LLLR..IGGTVPV..T.......FR............E...QI....Y.G...........FPIVIWIPHNYPR...........................ESP..I..V..Y..V.TPSQDM..............LVR...P.GQ...HVS.G..D....GRV....YH..P...........Y.L..A..Q.WGKy.......wDKST...............LFDF.LAVLRG.......VFAKEPPV................................................................
A0A0D2WTL7_CAPO3/21-141                .......................................................t-ERDVQRLLASQR.......NL.RPS.ME..R.Y..................T...........F.....M.....DGH..E.E...TMMC..LKGTLPI..S.......YR............G...AS....Y.N...........IPVEIWLCIDHPS...........................SAP..I..C..Y..V.VPTSTM..............RVR...P.SE...RVD.A..N....GMV....ML..P...........T.L..S..Q.WQS.........GTSN...............LTDL.TQDMVR.......AFSIQPPV................................................................
A0A6P5Z1V1_DURZI/41-162                .......................................................i-RQHLLSLISHYP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......FQ............G...VT....Y.N...........IPIIIWLMESYPR...........................HPP..V..V..Y..V.NPTRDM..............IIK...R.PH..pHVS.P..S....GLV....SI..T...........Y.L..Q..N.WIY.........PSSN...............PVDL.VLHLSS.......AFSRDPPL................................................................
H9J3P9_BOMMO/1-47                      ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.-----M..............SIK...V.SK...YVD.T..N....GKV....YL..P...........Y.L..H..E.WSS.........NSST...............LKNL.VQCMIT.......AFGELPPV................................................................
A0A2K5X8J8_MACFA/69-189                ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A1B8B7M5_FUSPO/25-147                .......................................................a-YNDVAQALDRFS.......SL.SPR.TD..V.H..................T...........F.....S.....NGA..N.A...LLLH..LSGTLPV..N.......FR............G...TT....Y.R...........FPLSIWVPHAYPR...........................EPP..M..I..Y..V.VPTETM..............MIR...P.GQ...HID.P..Q....GFV....YH..P...........Y.L..V..G.WAEf.......wDKSN...............LRDF.LNILTD.......VFAKEPPV................................................................
A0A1E5V7Q2_9POAL/30-153                .......................................................v-RNHVLAVLQEFP.......TL.SPS.VD..T.Y..................T...........S.....D.....DGA..S.A...VLLN..ARGFLAV..S.......SD............-...-L....P.P...........ILLTVWLPREYPY...........................CPP..L..V..Y..V.FPAAPS.............aSLV...P.DH..pFVD.H..R...tGRVh..rTL..P...........Y.L..E..D.WGV.........PRSS...............LAGL.VRSLVE.......ALRMCHP-l...............................................................
A0A1E4S5Q6_CYBJN/24-145                ........................................................TYHDVAVLLQRYP.......TL.KPR.TR..V.Y..................T...........Y.....E.....TGE..S.A...LLLD..IYGALPS..R.......IN............G...EV....Y.R...........IPVEVWIPHEYPL...........................ASP..I..A..Y..V.TPTEKM..............VLQ...P.GN...HVD.T..N....GKC....YL..E...........Y.T..A..N.WSA........eRRSN...............VAGL.CDDLCL.......VFAKEPPV................................................................
V5BCE4_TRYCR/91-172                    ...................................................qapph-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...-R....Y.S...........LPLQIWLTHLYPI...........................EPP..L..A..F..L.LSAEQG.............cRIA...S.NH..kYVD.A..T....GRC....HT..P...........E.L..A..A.WHP.........VSSS...............LCDV.VKSLGQ.......WL------sdegli..........................................................
A0A226P419_COLVI/21-135                ........................................................TVEEVTAVSRAHP.......NF.SFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........GVAD...............----.------.......--------kivlldlsegaak...................................................
A0A6P5RHK2_PRUAV/41-162                .......................................................i-RNHLVSLTTAYP.......SL.DPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..AEGTVPM..L.......FH............G...VT....Y.N...........IPVIIWLMESYPR...........................QPP..V..V..Y..V.NPTRDM..............IIK...R.PH..eHVN.P..S....GLV....SI..P...........Y.L..H..N.WVY.........PSSN...............LVEL.AKNLSA.......VFGQDPPL................................................................
A0A200Q4H6_9MAGN/33-147                .......................................................i-REHLISLLQEFE.......SL.VPS.ID..T.F..................T...........Y.....N.....DGT..T.V...NLLN..VNGFLQV..S.......PS............-...-T....P.P...........IPLTIWIHQNYPT...........................SPP..L..V..F..L.SSIHR-..............---...-.DH..pFVD.S..S....GSI....TS..P...........Y.L..E..T.WAY.........PRSN...............LLDL.ARNLVR.......LFAHH---ptf.............................................................
A0A669CEW6_ORENI/22-142                ........................................................TVREITNVISQYK.......DL.KPL.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A6J1SNK7_FRAOC/23-144                .......................................................t-SRDVLNTVTQFR.......GL.SHQ.IE..P.F..................V...........F.....S.....NGS..K.R...SLLN..LKGTVPV..P.......YK............G...QN....Y.N...........IPVCIWIMDTHPN...........................NAP..L..C..Y..V.KPTSDM..............VLK...I.SR...STD.H..S....GKI....YL..P...........Q.L..H..L.WDP.........RQPN..............lLPNL.VQAMIS.......AFSVEPPV................................................................
W7MQE3_GIBM7/1-58                      ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..M..I..Y..V.VPTETM..............MIR...P.GQ...HID.P..Q....GLV....YH..P...........Y.L..V..G.WAEf.......wDKSN...............LRDF.LNILTD.......VFAKEPPV................................................................
A0A1U7TZ23_CARSF/36-119                ....................................................rysm-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......TY............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIC...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A091L8R7_CATAU/8-128                 ........................................................TVQETTSVITQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
A0A0K9RM83_SPIOL/33-152                .......................................................i-RKHFLKLFKDFP.......CF.IPS.TN..K.F..................D...........H.....Y.....DGT..T.T...NLLN..ISGFLHV..S.......D-............-...FS....P.E...........VPLIIWLHENYPS...........................APP..M..I..F..I.PSNPEC..............PVY...E.NH..pYIN.P..S....GVV....TP..P...........Y.I..L..H.WDQ.........KRSN...............LCDL.IHNLEN.......LFQHDHP-s...............................................................
A0A1G4AYQ7_9PEZI/25-147                ........................................................TYNDVAQALSHYP.......SL.APR.TD..V.H..................T...........Y.....D.....NGS..S.A...LLLR..LSGTIPV..I.......FR............G...TT....Y.R...........FPISIWVPHAYPR...........................EAP..L..V..Y..V.TPTESM..............IVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..V..G.WATf.......wDKST...............ILDF.LAILRD.......VFAKEPPV................................................................
A0A182E5D2_ONCOC/25-145                ......................................................ak--NDILLALSGFP.......DL.TPD.VE..H.F..................V...........Y.....P.....DRT..Y.T...LAFR..LKGTIPV..L.......YK............G...NT....Y.N...........IPVALYLWDTHPY...........................YAP..I..C..Y..V.CPTPNM..............MLK...E.SK...TVD.K..Q....GRI....YL..P...........Y.L..S..D.WSF.........PGYD...............LSGL.LQVMAM.......CFQDSCPV................................................................
A0A099ZM13_TINGU/21-140                ........................................................TIEELKNVNKTYP.......NF.VFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTIPV..K.......YG............-...NS....Y.N...........IPICLWIMDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..R....GRI....YL..P...........Y.L..Q..R.WSH.........PQST...............VIGL.IKEMIA.......KFEEELPL................................................................
M4B5Q1_HYAAE/7-113                     ...............................................fyfsscwaa-------------.......--.---.--..-.-..................-...........Y.....N.....DGS..T.S...TLLN..LEGTIPI..F.......YR............D...NQ....Y.N...........IPVELWIVETYPR...........................APP..V..C..F..V.RPTADM..............MVK...P.GH..pHVT.S..D....GFV....KI..P...........Y.T..V..D.WQP.........-DFT...............LLEL.VAHMCS.......IFGNIPPV................................................................
A0A6P5B121_BOSIN/21-141                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..I.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQDELPL................................................................
G1K889_ANOCA/21-141                    ......................................................sv--QETISVIAQYK.......DL.KPV.MD..G.Y..................V...........F.....N.....DGS..S.R...ELMS..LTGTIPV..S.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSTM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LIGL.IQVMIV.......VFGDEPPV................................................................
H3APC2_LATCH/22-142                    .......................................................t-VREIGNVIAQYK.......DL.KPV.TD..A.Y..................V...........F.....N.....DGS..S.R...ELMS..LNGTVPV..A.......YR............G...NT....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSTM..............MIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PHSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A6J2WQ97_CHACN/21-141                .......................................................a-VEELQKVHRIYP.......DM.KPV.VA..T.Y..................V...........F.....N.....DSS..Q.R...DLVK..LVGNIPV..R.......YQ............G...QS....Y.N...........LPIQLWLLDSFPF...........................TPP..I..C..Y..L.RPTPNM..............VIR...E.GK...HVN.P..K....GRI....YL..P...........G.L..H..N.WDH.........PKSS...............VNGL.LAEMIS.......KFEEDPPL................................................................
R9NYU6_PSEHS/23-145                    ........................................................VFADVDRALIAVS.......SL.SPK.TE..V.F..................T...........F.....N.....DGR..T.Q...LLVN..LEGTIPV..D.......FR............N...TT....Y.N...........IPVAYWIPRDYPR...........................EPP..M..A..F..V.APTPDM..............AIR...K.GP...NVD.P..S....GEI....GG..D...........Y.L..K..R.WRSk.......pEACN...............LLDL.IHDCQH.......MFGREPPV................................................................
A0A7N5JVT3_AILME/50-170                ........................................................TVEELKNVNMFFP.......HF.RYS.VD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTVPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..H..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A4X2JLQ6_VOMUR/21-141                ........................................................TVEELTKVNMSYP.......NF.RFS.MD..T.Y..................V...........F.....K.....DNS..Q.K...DLLN..FTGTIPV..N.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTPNM..............GIS...L.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............ITGL.IREMII.......KFQEELPL................................................................
A0A316VRR9_9BASI/23-145                ........................................................IYTDVDALLLHQP.......SL.RPS.TS..E.Y..................I...........S.....D.....VGQ..A.S...LLLN..LKGTIPI..L.......FK............G...QT....Y.H...........IPLIIWIPRAYPR...........................EAP..L..V..F..V.TPTRDM..............LVR...K.GE...HVD.L..S....GKT....SG..E...........W.L..S..M.WEKk.......wEACN...............LVNM.VQSLQQ.......QFGQMPPV................................................................
A0A2I3SWF3_PANTR/36-119                ....................................................kysm-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......TY............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPM................................................................
A0A1R2CWV1_9CILI/25-143                .......................................................v-YNEFLRLPQNHL.......SL.SPK.V-..V.Q..................A...........N.....I.....NGT..L.L...YILE..LGGTIPV..L.......YQ............Q...RT....Y.N...........IPIKLQIPPTYPN...........................VAP..I..L..I..V.TPSPDM..............MIK...V.SE...YVK.E..D....GKT....TL..D...........I.Q..R..K.WNN.........-KCQ...............TIQL.IEEAKK.......AFSVKMPV................................................................
A0A6P8J910_ACTTE/6-127                 ......................................................cs--AHLSTTLNEFK.......NL.SAF.KR..E.C..................V...........-.....V.....EGE..L.Y...DMIN..LEGTISV..V.......YK............G...FT....Y.H...........IPLRVMLMEDYPL...........................SAP..I..I..Y..V.KPTANM..............ILD...K.NV..pYVN.G..R....GKI....ST..P...........Y.L..D..N.WDR........eQHPD...............LFKI.LHDLCI.......RFAQNPPV................................................................
A0A3Q0GHP9_ALLSI/339-459               ........................................................TVQETISVITQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
A0A671MI64_9TELE/23-143                .......................................................t-SRDITNVASHYK.......DL.KPV.MD..N.Y..................V...........F.....N.....DGS..T.K...ELLS..LTGTVPV..S.......YR............G...NV....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKP.........PQSE...............LLGL.IRVMIV.......VFGEEPPV................................................................
A0A078HXS9_BRANA/27-149                .......................................................i-RQHLLDLISCYP.......SL.NPK.TA..T.F..................I...........H.....N.....DGC..P.S..iNLLQ..ADGTIPM..D.......YH............G...VT....Y.N...........IPVIIWLLDSYPF...........................HPP..C..V..Y..L.NPTPGM..............IIK...R.PH..aHVT.P..S....GLV....SF..P...........Y.L..H..N.WAY.........PSSN...............LVDL.VSELTA.......SFARDPPL................................................................
A0A0D2A1N4_9PEZI/1-103                 .....................................................mia-------------.......--.---.--..-.-..................-...........Y.....E.....HGT..S.A...LLLL..LAGTIPV..E.......FR............G...QV....F.H...........FPIHLWIPHAYPR...........................EAP..I..G..F..V.VPNETM..............LVR...P.GQ...HVS.G..E....GKI....YH..P...........Y.L..A..K.WSGf.......wDKSS...............LLDL.VAILRE.......VFAKEPPV................................................................
V4M8S0_EUTSA/37-158                    .......................................................i-RQHLLNLISAYP.......SL.EPK.TA..S.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......FH............G...VT....Y.N...........IPVIIWLLESYPR...........................HPP..C..V..Y..V.NPTADM..............IIK...R.PH..aHVT.P..S....GLV....SL..P...........Y.L..Q..N.WVF.........PSSN...............LVDL.VSDLSA.......AFARDPPL................................................................
A0A0D2F5K4_9EURO/41-163                ........................................................TYSDLAHVLARYP.......GF.SPR.TD..V.Y..................T...........F.....E.....TGA..P.A...LLVV..FTGTIPV..N.......FR............G...NT....Y.R...........FPVALWVPHAYPY...........................EAP..M..L..Y..V.TPTDDM..............IIR...P.GQ...HVG.G..D....GRI....YH..P...........Y.L..A..H.WREh.......wERSN...............VLDF.LSILSE.......IFAKEPPV................................................................
A0A1S3ZGJ7_TOBAC/44-165                .......................................................i-RQHLVSLTDTCP.......SL.QPK.TA..T.F..................T...........H.....N.....DGH..T.V...NLLQ..SDGTVPM..A.......YQ............D...VT....Y.N...........IPVIIWLMESYPR...........................HAP..L..V..F..V.NPTRDM..............IIK...R.QH..pFVN.P..S....GIV....SI..P...........Y.L..S..N.WVY.........PSSN...............LVDL.ARNLSH.......FFSRDPPL................................................................
A0A4W2E7Y9_BOBOX/36-119                ....................................................rysm-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......TY............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQDELPL................................................................
A0A6J3EVA5_SAPAP/64-184                ........................................................TVEELKNVNMFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A0D2IQT3_9EURO/26-148                ........................................................TYSDLAHVLARNP.......GF.APR.TD..V.Y..................T...........F.....E.....NGI..S.A...LLVH..FKGTLPV..N.......FR............G...IT....Y.R...........FPIALWIPHAYPY...........................EAP..L..C..Y..V.TPTEDM..............IIR...P.GQ...HVG.G..D....GKI....YH..P...........Y.L..A..H.WRDa.......wDRSN...............ILDF.LSILSD.......VFAKEPPV................................................................
A0A6P6JTF8_CARAU/24-145                ......................................................vl--DEIKDVSADFP.......HL.QLY.VD..C.Y..................L...........Y.....P.....NKD..K.K...RLVY..LGGTVPV..T.......YE............D...AT....Y.N...........IPVCIWIHETHPK...........................NPP..R..C..F..V.CPSPSM..............IIN...A.KS..sSVD.A..N....GRV....LL..H...........C.L..S..N.WKI.........GWSN...............LSIV.LEEMIA.......AFQRETPL................................................................
A0A067RQG0_ZOONE/1-81                  .....................................................vlc-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......-A............G...SM....Y.N...........IPICIWLMDTHPN...........................NAP..I..C..Y..V.KPTPDM..............QIK...V.SM...YVD.N..N....GKI....YL..P...........Y.L..H..D.WTP.........VSSD...............LLGL.IQVMIV.......TFGEQPPV................................................................
A0A663M505_ATHCN/29-148                ........................................................TIEELKNVNKTYP.......NF.TFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIHLWILDSHPF...........................APP..I..C..F..L.KPTVNM..............GIA...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VTGL.IKEMIA.......KFEEELPL................................................................
A0A287D657_ICTTR/21-72                 ........................................................TVRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..V.......T-............-...--....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------fnchlylsa.......................................................
A0A2I2GKN1_9EURO/33-155                ........................................................TYYDVANVLAQYP.......SL.FPR.TE..V.Y..................T...........Y.....E.....TGF..S.A...LLLQ..LSGTLPV..T.......FR............G...TV....Y.K...........FPVVIWVPNTYPR...........................EPP..I..V..Y..V.SPTKDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAGa.......wERSS...............LADL.VSILRE.......VFAKEPPV................................................................
A0A6J3D6U5_AYTFU/21-140                ........................................................TIEELKTVNKTYP.......NF.TFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTVNM..............GIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............IVGL.IKEMIA.......KFEEELPL................................................................
I2FZR2_USTH4/23-145                    ........................................................VFADVDRALIAVS.......SL.SPK.TE..V.F..................T...........F.....N.....DGR..T.Q...LLLN..LEGTIPV..E.......FR............N...ST....Y.N...........IPVAYWIPRGYPR...........................EPP..M..A..F..V.APTPDM..............AIR...K.GP...NVD.P..S....GEI....GG..D...........Y.L..A..R.WRSk.......pEACN...............LLDL.IHDCQH.......MFGKEPPV................................................................
A0A671NKU4_9TELE/1-103                 ........................................................-------------.......--.---.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A0V1A5P4_9BILA/38-122                ...................................................livrk-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......FY............G...KT....Y.N...........IPICIYLLKNYPH...........................VPP..I..C..F..V.RPTASM..............IVK...P.SS...NVD.S..N....GKI....NV..P...........Y.L..T..E.WHQ.........SKSD...............LLGL.LQVLAI.......VFGESCPV................................................................
A0A6I9XRI9_9SAUR/21-141                .......................................................a-VQETVNVTGQYK.......DL.KPV.MD..N.Y..................V...........F.....N.....DGS..S.R...ELMS..LTGTIPV..N.......YR............G...HI....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GRI....YL..P...........Y.L..H..E.WKH.........PQSD...............LIGL.IQVMIV.......VFGDEPPV................................................................
F6RMC2_HORSE/21-141                    ........................................................TMEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTVPV..M.......YH............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A5G2QLI5_PIG/21-141                  ........................................................TVEELKNVNVFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FSGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIT.......KFQEELPL................................................................
N1JEK7_BLUG1/26-148                    ........................................................TYKDVAQTLSYYY.......SL.SPK.TD..V.Y..................T...........Y.....E.....NGS..A.A...LLLH..IFGTLPV..V.......FR............E...IT....Y.R...........FPIELWIPHSYPK...........................DAP..I..V..Y..V.TSAENL..............MIR...P.GQ...HVD.L..Q....GKI....YH..P...........Y.L..V..R.WAEn.......wDKCN...............ILEF.LEILRN.......IFAKEPPV................................................................
A0A6P6YFG1_DERPT/23-143                ......................................................ak--RQITDVLKMYR.......NL.FAY.PQ..K.C..................T...........L.....P.....NGI..K.R...DLVV..LRGTIPI..T.......YR............K...NV....Y.N...........IPVSIWVLEDHPD...........................SAP..I..C..W..V.NPTKDM..............TIK...V.SE...HVD.Q..D....GRV....YL..P...........Y.L..S..N.WDR.........NASD...............LLGV.IQVMII.......IFGDMPPL................................................................
A0A6P8PIQ3_GEOSA/21-141                ........................................................TVQEITSVITTYK.......DL.KPV.MD..G.Y..................V...........F.....N.....DGT..S.R...ELMS..LTGTIPV..T.......YK............C...NT....Y.N...........IPICLWLLDTHPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKV....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A087VAR1_BALRE/8-128                 ........................................................TVQETTSVITRYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
A0A4W4HJ43_ELEEL/22-142                ........................................................TVREITNVILQYK.......DL.KPL.MD..A.Y..................V...........F.....N.....DGS..S.R...ELMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A2K5DC69_AOTNA/21-141                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A364NDF6_9PLEO/484-606               ........................................................TYHDAAETLSNYT.......SL.SVR.TE..P.Y..................T...........Y.....E.....NGT..S.A...LLLL..LTGTLPV..T.......FR............G...AT....Y.G...........FPVAIWVPHAYPR...........................EPP..M..V..Y..V.TPSHDM..............ALR...P.GQ...HVS.T..D....GRV....YH..P...........Y.L..A..Q.WAQy.......wDKST...............LFDF.LAVLRG.......VFAKEPPV................................................................
A0A168P0G2_MUCCL/20-141                ........................................................TFRDVDAVLQTYL.......SL.KPK.MD..T.Y..................T...........S.....N.....DGH..T.E...LLLC..LHGTVPI..T.......YR............S...IP....Y.N...........IPVAFWIPKEYPK...........................SSP..I..P..Y..V.KPTANM..............LIR...E.GR...HVD.K..S....GMC....YH..H...........Y.R..S..S.WSS........dQKHT...............FLEL.VAILQQ.......VFAQEPPV................................................................
A0A3Q2VG02_HAPBU/21-141                .......................................................a-VEELEKIYRIYP.......GM.TLS.TG..T.Y..................T...........F.....S.....DST..Q.K...DLLK..LTGTIPV..Q.......YE............G...RS....Y.N...........FPIQLWLLDSFPF...........................TPP..I..C..H..L.KPTSNM..............VIR...E.GK...HVD.A..H....GRI....HL..P...........G.L..H..N.WDH.........PKSS...............VVGL.LNEMVT.......KFQEDPPL................................................................
A0A314Z9P7_PRUYE/40-161                .......................................................i-RTHLVSLTSKYP.......CL.DPK.TA..T.F..................T...........H.....N.....DGR..S.V...DLLQ..ADGTIPM..S.......FH............G...VT....Y.N...........IPVIIWLTESYPH...........................HPP..C..V..Y..V.NPMRDM..............VIK...R.PH..aHVN.P..S....GLV....SI..P...........Y.L..Q..N.WVY.........PSSN...............LVEL.AESLSA.......VFGQEPPL................................................................
A0A6P3W9G2_CLUHA/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
E1BUH9_CHICK/21-140                    ........................................................TVEEVTAVSRAHP.......NF.SFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............LIGL.IKEMIA.......KFEEELPL................................................................
E3NT13_CAERE/21-119                    .......................................................a-KKDIVGALSQFK.......DL.APG.TD..T.F..................M...........F.....P.....DGK..R.R...TAFR..LKGTIPV..Y.......YK............G...AC....Y.N...........IPVTVYLWDTHPY...........................YAP..I..C..Y..V.NPTATM..............VIK...A.KI...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------scfpvsggisiswqhesl..............................................
D3Z2V5_MOUSE/7-119                     ......................qlkkmmskykyrdltvrqtvnviamykdlkpvld-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......SY............G...NI....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..D.WKH.........PRSE...............LLEL.IQIMIV.......IFGEEPPV................................................................
A0A5B6W9C7_9ROSI/41-162                .......................................................i-RQQLLSLISNYP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......FQ............G...VT....Y.N...........IPIIIWLMESYPR...........................YAP..A..V..Y..V.NPTRDM..............IIK...R.PH..pHVS.P..S....GLV....SI..P...........Y.L..H..N.WIY.........PSSN...............LVDL.VLHLSS.......AFSRDPPL................................................................
A0A2K5DC56_AOTNA/21-141                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A6J3D7A8_AYTFU/21-141                ........................................................TVQETTSVITQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
T1FN37_HELRO/20-140                    .......................................................t-KNELLKIMKSFN.......DL.RPA.SK..N.F..................V...........F.....N.....DGV..S.K...DLVC..LEGTIPV..S.......YK............G...KM....Y.N...........IPICIYLMETHPY...........................NPP..M..I..Y..V.KPTQSM..............QIR...Q.GK...HVD.A..N....GRV....YL..P...........Y.L..H..E.WKY.........PQSD...............LSGL.IQMMSM.......VFGEEPPV................................................................
S7QBE9_MYOBR/12-132                    .......................................................t-VRETINVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTVPV..L.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
Q4UHS4_THEAN/19-133                    .......................................................l-MCDINGLFGKYH.......NF.SCS.M-..-.-..................-...........-.....S.....TSF..D.C...HRLN..ISGTVPY..T.......FS............G...FT....L.N...........APLLIQVFSDYPF...........................SCP..S..F..F..V.PSRNTK..............IVK...N.HP...NVD.L..R....GNV....TL..K...........Y.L..D..E.WNH.........-TSK...............LVQA.VDHLCY.......AFSKISPI................................................................
A0A4Q1BWH0_TREME/24-146                ......................................................il--PEVMDVLAQWR.......TL.SVK.TE..A.F..................T...........F.....D.....TGH..T.V...LLLL..LHGTLPI..T.......YR............G...AT....Y.Q...........IPIHIWVPTEYPR...........................APP..L..V..F..V.VPTAEM..............GIR...K.SH...EVE.P..G....GRV....RD..I...........V.V..E..E.WWGs.......wEIKT...............IGVL.LRHLTD.......LFSLTPPV................................................................
A0A086SWL9_ACRC1/25-147                ........................................................TYNDVAHVLTRYP.......SL.APR.TD..V.H..................T...........F.....S.....NGT..S.A...LLLH..LTGTIPV..S.......FR............G...ST....Y.R...........FPVSIWVPHAYPR...........................EPP..L..I..Y..V.TPTENM..............MIR...P.GQ...HVD.P..Q....GLV....YH..P...........Y.L..V..G.WAEf.......wDKST...............LHDF.LAILSD.......VFAKEPPV................................................................
A0A3Q7PVY0_CALUR/23-143                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..LTGTIPV..M.......YQ............G...NT....Y.N...........IPICLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A0Q3GQ74_BRADI/62-192                .......................................................i-RNHLLALADAFP.......SL.RLR.AAqpQ.F..................T...........T.....H.....NDA..G.R...LLLQ..AIGTIPI..L.......HA............G...AS....Y.N...........LPAVVWLPERYPR...........................CPP..L..V..F..L.SPTRGM..............VVK...P.HHp.lVVD.H..RrsgsGLIa..vDA..P...........C.L..R..S.WVF.........PSSN...............LLDL.VRSLAR.......LFGLDPPL................................................................
A0A1W0X549_HYPDU/535-615               ......................................................rl-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......FT............G...AS....Y.N...........IPVEIWIMDSHPY...........................DPP..L..C..Y..V.KPTADM..............KIR...H.SR...HID.H..D....GRV....FL..P...........C.L..T..D.WNH.........NLFD...............LLDC.CQIMAR.......MFGEEPPV................................................................
A0A1V6UJS5_9EURO/32-154                ........................................................TYHDVANALSQYP.......SL.SPR.TD..V.Y..................T...........Y.....E.....TGF..S.A...LLLH..LVGTLPV..T.......FR............G...TT....Y.R...........FPIALWIPNTYPR...........................EPP..I..A..Y..V.TPTQDM..............TVR...V.GQ...HVT.L..E....GQV....YH..H...........Y.L..A..H.WAEa.......wDRST...............IADF.LLILQD.......VFAKEPPV................................................................
A0A0D2AE52_EXOME/26-148                ........................................................TYSDLAHALHRHP.......GF.APR.TD..V.Y..................T...........F.....E.....NGA..P.A...LLVH..FQGTIPV..T.......FR............G...NT....Y.R...........FPISLWIPHSYPY...........................DAP..I..V..Y..V.TPTNDM..............MIR...P.GQ...YVG.G..D....GKI....YH..P...........Y.L..A..H.WRDa.......wERSN...............VVDF.LSILSD.......VFAKEPPV................................................................
A0A2I0MHN6_COLLI/36-156                ........................................................TVQETTSVITQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGT..A.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
A0A0L0GGD4_9EUKA/25-144                .......................................................v-SDDVCRTLTEYP.......SL.KPK.TE..L.Y..................T...........T.....N.....DGR..S.R...QLLN..LSGTLPI..D.......YR............G...SR....Y.N...........IPVVVWLLDVHPE...........................IPP..V..V..F..V.VPTANM..............LVK...A.GQ...HVD.N..D....GLV....YH..P...........Y.L..S..S.WAR.........-GST...............LSGL.MYYCRE.......VFSLSPPV................................................................
A0A090LKR2_STRRB/20-140                .......................................................a-FTDIQRALNSFV.......HL.KDS.VE..L.F..................T...........Y.....P.....SGK..T.K...NVLT..LAGTIPV..M.......YK............N...NT....Y.H...........IPVALYLDQKHPY...........................QAP..Y..C..Y..V.KPTSEM..............EIK...E.SK...VVD.S..I....GRI....YL..P...........Y.L..N..E.WKW.........PSHS...............LVEL.LKVMCR.......EFENGCPV................................................................
H3APC3_LATCH/8-128                     .......................................................t-VREIGNVIAQYK.......DL.KPV.TD..A.Y..................V...........F.....N.....DGS..S.R...ELMS..LNGTVPV..A.......YR............G...NT....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSTM..............MIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PHSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
H3C5P9_TETNG/8-129                     ........................................................TQADLRRVRSRFS.......DL.RLH.VD..Y.Y..................R...........F.....P.....NKE..K.K...QLVY..LAGTVPV..L.......YE............G...SC....Y.N...........IPVSIWLHQTHPV...........................SHP..R..C..Y..V.CPSVSM..............VIN...P.AC..sCAD.A..A....GLL....HL..D...........G.L..R..N.WTG.........GASS...............LSLL.VSEMVQ.......VFQKDMPL................................................................
F9F4J5_FUSOF/25-147                    .......................................................a-YNDVAQALDRFP.......SL.SPR.TD..V.H..................T...........F.....S.....NGA..N.A...LLLH..LSGTLPV..N.......FR............G...TT....Y.R...........FPISIWVPHAYPR...........................EPP..M..I..Y..V.VPTETM..............MIR...P.GQ...HID.P..Q....GLV....YH..P...........Y.L..V..G.WAEf.......wDKSN...............LRDF.LNILTD.......IFAKEPPV................................................................
U5H7F6_USTV1/22-147                    .....................................................ail---QVLATLNQFR......gSL.YHE.FN..D.F..................T...........Y.....D.....DGR..V.E...LLLS..ITGVIPV..P.......IQ............G...AT....Y.Q...........CPITFWLPLDFPN...........................KPP..M..V..F..V.LPSSTL..............IVR...P.GP...NIE.P..S....GKV...vES..A...........Y.L..D..N.WARk.......aEGCS...............LVALvVEELIP.......MFSRRYPV................................................................
A0A0V1MP35_9BILA/35-155                .......................................................t-KEEIMEALSQFH.......DL.IVR.KD..F.Y..................V...........G.....N.....DGV..R.E...LAIC..FCGTIPV..N.......YM............G...KT....Y.N...........IPICIYLLKNYPY...........................VPP..I..C..F..V.RPTANM..............IVK...P.SS...NVD.S..N....GKI....NV..P...........Y.L..T..E.WHQ.........SKSD...............LLGL.LQVLAI.......VFGESCPV................................................................
A0A162JBT2_9PEZI/25-147                ........................................................TFNDVSQALAQFP.......SL.SPR.TD..V.H..................T...........F.....P.....NGA..S.A...LLLH..LSGTLPA..V.......FR............G...AT....Y.R...........YPVSLWVPHAYPR...........................EAP..L..V..Y..V.TPTENM..............MVR...P.GQ...HVD.P..Q....GLV....YH..P...........Y.L..A..G.WGEf.......wDKST...............MVDF.LNILRD.......VFAKEPPV................................................................
F0UPK3_AJEC8/33-120                    ........................................................TYNDVTNLLAQYP.......GF.VLR.TD..V.Y..................T...........Y.....E.....NGT..P.A...LLLQ..LTGTLPV..T.......FR............G...AL....Y.R...........FPITIWVPKTYPR...........................EPP..F..V..Y..V.TPTQDM..............LVR...P.GQ...H--.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------rstivd..........................................................
A0A091CLH6_FUKDA/21-141                .......................................................t-VRETVSVITLYK.......DL.KPG.LD..P.Y..................V...........F.....N.....DGS..S.R...ELMN..LNGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A3P8VD17_CYNSE/21-141                .......................................................v-AREVFIAITHFD.......TL.VPI.VD..K.Y..................V...........Y.....S.....DGT..A.K...NLMS..LTGTLPV..I.......YN............D...KT....Y.N...........IPVCTWIEESYPQ...........................TAP..I..C..Y..V.RPTREM..............LIV...K.GK...YVS.S..N....GEV....EL..P...........Y.L..E..E.WNK.........RKCN...............LVTL.LQVMVA.......MFGEFPPL................................................................
A0A026WXG7_OOCBI/25-145                ........................................................TKKHVISVLNLYK.......GL.IYE.IE..P.F..................V...........F.....N.....DGS..R.K...ELLN..LQGTIPV..V.......YK............G...TC....Y.N...........IPICIWLMDTHPN...........................NAP..M..C..Y..V.KPTADM..............HIK...V.SM...FVD.H..N....GKI....YL..P...........Y.L..H..D.WVP.........HNSD...............LLAL.IQVMII.......TFGEQPPV................................................................
A0A6J2AJU8_ACIJB/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YK............G...NI....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A341D0D7_NEOAA/21-141                .......................................................t-VRETVSVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...TT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGEEPPV................................................................
B5RUR2_DEBHA/26-164                    ........................................................TYTHVYQFLQIYLn.....kGF.KIR.TS..V.H..................T...........S....gN.....TGH..S.N...LLIN..LFGSIEV..N.......KD............-...--....L.S...........VPVTIWIPLNYPYniseh.................tsddiGVP..M..V..Y..I.TPDNSRn............wYIK...P.GN...HID.T..Q....GKF....YH..P...........Y.L..S..S.WFHeyn...sqpSKYN...............LLQL.VSTLHN.......SFSKDVPI................................................................
A0A2G2VU54_CAPBA/35-156                .......................................................i-RQHLLSLIEIHP.......SL.QPK.TA..S.F..................T...........H.....N.....DGR..T.V...NLLQ..VIGTVPM..V.......YH............Q...VT....Y.N...........IPVIIWLMESYPR...........................HPP..L..V..F..V.NPTRDM..............VIK...R.AH..pFVN.P..S....GVV....SI..P...........Y.L..Q..N.WVY.........PSSN...............LVEL.ARNLSH.......FFGRDPPL................................................................
A0A6P3Y864_DINQU/25-145                ........................................................TKKHVVSALNVYK.......GL.QYE.IE..P.F..................V...........F.....N.....DGS..R.K...ELVN..LQGTIPV..A.......FK............G...AY....Y.N...........IPVCIWLMDTHPN...........................NAP..M..C..Y..V.KPTADM..............HIK...V.SM...YVD.H..N....GKI....YL..P...........Y.L..H..D.WVP.........HNSD...............LLAL.IQVMIV.......TFGEQPPV................................................................
A0A340Y2F3_LIPVE/37-119                .....................................................ysm-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......TY............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
Q4E474_TRYCC/124-207                   ..................................................qappdr-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....Y.V...........LPLQIWLTHLYPI...........................EPP..L..V..F..L.LSAEQG.............cRIA...S.NH..kYVD.A..T....GRC....HT..P...........E.L..A..A.WHP.........VSSS...............LCDV.VKRLCQ.......LLS-----aeglipl.........................................................
B0CSB9_LACBS/23-145                    ........................................................VYSDIDAALARFQ.......TL.RPK.SD..I.Y..................T...........F.....D.....DGR..T.Q...LLLC..IHGLLPI..S.......FR............Q...AS....Y.N...........IPISVWLPRQYPQ...........................QPP..I..P..Y..V.VPTTDM..............LVK...S.GP...YVD.V..S....GKC....NP..E...........Y.I..Q..H.WERk.......yEGCS...............LSAL.FEAFQD.......QFSREPPV................................................................
A0A3Q4GYV4_NEOBR/21-72                 .......................................................a-VEELEKIYRIYP.......GM.KPS.TG..T.Y..................T...........F.....S.....DST..Q.K...DLLK..LTGTLPV..Q.......YE............G...M-....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------adpnss..........................................................
Q4SDZ6_TETNG/21-141                    .......................................................a-IEELQKFHRIFP.......EM.IPS.TG..T.Y..................T...........F.....T.....DST..Q.K...DLLK..LIGNLPV..Q.......YE............G...RT....Y.N...........FPVQLWLLDSFPF...........................TPP..I..C..L..L.RPTANM..............VIR...E.GK...HVD.A..R....GRI....FL..P...........G.L..Q..N.WDY.........PKSS...............VVSL.LKEMTA.......KFEEDPPL................................................................
A0A6P5BD80_BOSIN/21-141                .......................................................t-VRETVNVISLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A1D2M6F0_ORCCI/1-56                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..M..V..F..V.KPTPDM..............RIK...V.SR...HVD.H..N....GKV....YL..P...........Y.L..H..E.WTG.........ANSD...............LLGL.IQVLIC.......TFSEQPPV................................................................
A0A3Q7RNZ5_VULVU/21-141                ........................................................TVEELKNVNRFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..K....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A6A5ELL9_PERFL/24-145                .......................................................t-LSDLQMVRSLFS.......DL.RLY.VD..Y.Y..................C...........F.....P.....NKE..K.K...KLLY..LAGTLPV..S.......YD............G...SD....Y.N...........IPVCIWLHETHPA...........................SRP..R..C..F..V.CPSVSM..............VIN...P.SC..cCVD.A..A....GNV....SL..D...........A.L..S..T.WTQ.........GVSN...............LLLL.VSEMRL.......VFQKDPPL................................................................
A0A177DVK7_ALTAL/24-146                ........................................................TYHDVAEALSNYP.......SL.APK.TE..P.Y..................T...........Y.....E.....NGS..S.A...LLLL..LSGTLPV..T.......FR............G...AT....Y.G...........FPVAIWVPHSYPR...........................EPP..I..V..Y..V.TPAQDM..............VLR...P.GQ...HVS.T..D....GRI....YH..P...........Y.L..A..Q.WAKy.......wDKST...............LFDF.LAVLRG.......VFAKEPPV................................................................
A0A194UYE6_9PEZI/3-108                 ....................................vqqhvlnwlysvltseyhhv-------------.......--.---.--..-.N..................P...........F.....S.....NGS..S.A...LLLH..ISGTIPV..T.......FR............G...TT....Y.R...........FPVSIWIPHAYPR...........................EPP..L..V..Y..V.TPTETM..............VVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..V..G.WA-.........----...............----.------.......--------dfwdrcsss.......................................................
A0A2U3YST3_LEPWE/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YK............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A1U8P6A7_GOSHI/34-155                .......................................................i-LRHLLSLLQEFP.......GF.KPS.TG..R.F..................M...........H.....N.....DGT..E.V...NLLR..ATGCVHV..A.......NS............-...TT....P.T...........IPLVIWLHENYPQ...........................KAP..L..V..F..V.SLHLMT..............PIH...R.HH..pFVDnT..T....GAT....SP..P...........Y.I..L..T.WKY.........PPCN...............LSEL.LRNLVQ.......IFTIDHP-f...............................................................
A0A6P8FMZ0_CLUHA/22-142                ........................................................TVAEIINVITSYK.......DL.KPI.MG..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LAGTVPV..S.......YR............G...NT....Y.N...........IPICVWLLDTYPY...........................NPP..I..C..F..V.KPTSTM..............MIK...P.GT...HVD.A..D....GKF....YL..P...........Y.L..H..E.WKP.........PQSD...............LLNL.NQVMIL.......VFGEEPPV................................................................
A0A444E5J9_ENSVE/38-162                .......................................................i-RQHLVALAEAYP.......SL.RPR.AA..T.F..................T...........H.....D.....DGR..S.A...HLLQ..AEGTLPI..V.......YR............G...AA....Y.N...........LPAAVWLLEPYPR...........................RPP..A..V..F..L.SPTRDM..............LVK...P.GH..pLVE.P..S....GLVr.aaAV..P...........Y.L..A..T.WVF.........PASN...............LVDL.VRSLSH.......LFGLDPPL................................................................
A0A663EYH6_AQUCH/1-102                 ........................................................-------------.......--.---.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIHLWILDSHPF...........................APP..I..C..F..L.KPTVNM..............GIL...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VIGL.IKEMIA.......KFEEELPL................................................................
A0A4W5JN77_9TELE/13-133                ........................................................TVREITNVISQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..T.R...TLVS..LTGTVPV..S.......YR............G...NI....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
D3Z0S9_MOUSE/1-47                      ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.-----M..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..D.WKH.........PRSE...............LLEL.IQIMIV.......IFGEEPPV................................................................
A0A151Z365_9MYCE/34-146                .....................................................vkv---DTGEVFRYFP.......NL.HPY.Y-..-.-..................-...........-.....Q.....QSD..R.G...TVIY..LKGTIPI..I.......YN............N...FN....Y.Y...........LPIKITLPTLYPE...........................HGP..H..I..A..L.DPTPEM..............FVV...K.NH..pQVD.E..Y....GTC....--..-...........I.L..K..N.WNH.........-LTS...............VSQV.LKYLCD.......TFSYMPPL................................................................
A0A6G0IYX3_LARCR/21-141                .......................................................a-IEELEKINRVYP.......GM.VAS.TG..T.Y..................T...........F.....T.....DST..Q.K...DLLK..LIGNLPV..K.......YE............G...RS....Y.N...........FPIQLWLLDSFPF...........................TPP..I..C..L..L.RPTPNM..............VIR...E.GK...HVD.A..R....GRL....FL..P...........G.L..H..N.WDY.........PKSS...............VAGL.LNEMTA.......KFEEEPPL................................................................
A0A3N0YFL9_ANAGA/1-99                  .....................................................ypn-------------.......--.---.--..-.-..................-...........-.....-.....-ND..K.K...KLVY..LGGTVPV..T.......YE............G...SK....Y.N...........IPVCIWIHETHPK...........................NPP..R..C..Y..V.CPSPSM..............VIN...A.KS..sNVD.A..H....GRV....LL..H...........C.L..N..N.WKI.........GWSN...............LSIV.LEEMIA.......AFQRETPL................................................................
B9S4R4_RICCO/34-157                    .......................................................i-RKHLLSLIIDYP.......TF.KPS.TD..T.F..................F...........H.....N.....DGT..A.V...YLLN..AAGNLHL..A.......GS............K...YT....P.P...........VPLTIWVHENYPY...........................MPP..I..V..V..V.SPNDSM.............sPIH...Q.NH..pFVD.P.yS....GAT....SS..P...........Y.L..Q..T.WIF.........PRCN...............LTEL.VRNLVK.......IFSHDHP-f...............................................................
A0A6I9ZCC7_GEOFO/1-102                 ........................................................-------------.......--.---.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPVRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIA...V.GK...HVD.A..R....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............LTGL.IKEMIA.......KFEEELPL................................................................
W7MEF3_GIBM7/25-147                    .......................................................a-YNDVAQALDRFP.......SL.SPR.TD..V.H..................T...........F.....S.....NGA..N.A...LLLH..LSGTLPV..N.......FR............G...TT....Y.R...........FPVSIWVPHAYPR...........................EPP..M..I..Y..V.VPTETM..............MIR...P.GQ...HID.P..Q....GLV....YH..P...........Y.L..V..G.WAEf.......wDKSN...............LRDF.LNILTD.......VFAKEPPV................................................................
A0A6D2JZX9_9BRAS/298-417               .....................................reliqkhlrelhllypdkv-------------.......--.---.--..-.-..................T...........V.....K.....HDL..S.K...PYIE..IAVKVPY..C.......LE............G...SS...nN.S...........APVNIYLTKLYPA...........................SRP..H..V..G..L.DCPSDQ..............VIK...E.KR..lSVA.P..G....GTV....YF..S...........Y.L..R..T.WNE.........KESD...............LAGL.VSYLSA.......EFTCEEPL................................................................
A0A067PBL2_PLEOS/27-149                .......................................................v-LADIEAVLARFH.......TI.RPK.SD..E.H..................T...........F.....D.....DGR..T.Q...ILLC..LHGLLPI..T.......YR............Q...AS....Y.N...........IQISVWINRDYPR...........................HPP..I..A..Y..V.VPTSDM..............FVK...A.GK...FVD.V..S....GRC....NL..E...........Y.M..Q..Q.WERk.......sEGCS...............ILAL.LEAMQD.......QFSREPPM................................................................
F7BRH9_ORNAN/21-141                    .......................................................t-LREIVSVITLYK.......DL.KPL.LD..A.Y..................V...........F.....N.....DGN..S.R...ELMS..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDSYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A166GSZ7_DAUCS/38-159                .......................................................i-RQHLVSLADSYP.......SL.QPK.TA..T.F..................T...........H.....N.....DGR..T.V...NLLQ..AEGTVPM..I.......YQ............N...VT....Y.N...........IPIVIWLMESYPR...........................HSP..I..V..F..V.NPTRDM..............IIK...R.PH..pFVN.P..S....GMV....SI..P...........Y.L..Q..N.WIY.........PSSN...............LLDL.CRNLSH.......YFGRDPPL................................................................
A0A6P6G072_ZIZJJ/44-165                .......................................................i-RQHLVSLTTAYA.......SL.EPK.TA..T.F..................I...........H.....N.....DGR..S.V...NLLQ..ADGTVPM..S.......FQ............G...VT....Y.N...........IPVVIWLMESYPR...........................HPP..C..V..Y..V.NPTRDM..............IIK...R.PH..pHVN.P..S....GLV....SI..P...........Y.L..Q..N.WVY.........PSSN...............LVEL.ARNLSA.......LFGRDPPL................................................................
A0A4W2BQK4_BOBOX/21-141                .......................................................t-VRETVNVISLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
Q4WYV3_ASPFU/33-155                    ........................................................TYYDVANVLAQYP.......SL.SPR.TD..V.Y..................T...........Y.....E.....TGF..S.A...LLLH..LTGTIPV..S.......FR............G...TV....Y.K...........FPIAVWIPNTYPR...........................EPP..M..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wDRSN...............LVDF.LMILRE.......VFAKEPPV................................................................
I3KB23_ORENI/21-141                    .......................................................v-AHEIKVTLTYFR.......NL.VPV.MD..K.Y..................V...........Y.....N.....DGT..T.K...NLMS..LTGTIPA..T.......IN............N...TT....Y.N...........IPICLWIEETYPQ...........................TAP..I..C..Y..I.RPTQQM..............MIL...S.GK...YIS.S..N....GEV....ML..P...........Y.L..R..E.WKN.........GECD...............LISL.LQVMVA.......VFGEFPPV................................................................
A0A0D0CML2_9AGAR/25-163                ......................................................vy--HQVDQALATFGlyggsngWL.KVK.SD..V.Y..................T...........Y.....D.....DGR..T.H...LLLC..LHGLLPI..N.......FR............N...ST....Y.H...........IPIDIWIPFNYPR...........................SSP..I..V..Y..V.VPAQGM..............LIK...N.SR...YVE.L..S....GKCdvsnYE..G...........T.K..G..S.WLDr.......gE--Kttt........artgLLGL.IDALMN.......WFSRDPPV................................................................
A0A3N6U5S0_BRACR/37-157                .......................................................i-RKHLTSFLQDFS.......NF.DLS.TD..T.F..................N...........H.....N.....NGT..T.V...QLFR..LDGSLRT..P.......QQ............-...-S....T.A...........VQLTIWVHENYPL...........................TPP..L..V..F..V.IPPDSM.............tPVR...T.NH..pFVS.S..S....GYT....NS..N...........Y.I..E..T.WEY.........PPCN...............LLNF.VRNLRR.......VLANDHP-f...............................................................
D0ND31_PHYIT/330-450                   ......................................................vr--GDVYNLLGQIP.......SL.QPN.CG..T.F..................A...........H.....N.....DGT..T.S...TLLN..LEGTIPI..F.......YR............G...NQ....Y.N...........IPVEFWVVETYPM...........................APP..V..C..F..V.RPTADM..............MVK...P.GH..pHVT.S..D....GYV....KI..P...........Y.T..S..D.WRP.........-DFT...............MLEL.VAHMCS.......IFGNMPPV................................................................
A0A0G4P7Z5_PENCA/32-154                ........................................................TYHDVANALTQYP.......SL.SPR.TD..V.Y..................T...........Y.....E.....TGF..S.A...LLLH..LVGTLPV..T.......FR............G...TT....Y.R...........FPIALWIPNTYPR...........................EPP..I..V..Y..V.TPTQEM..............TVR...V.GQ...HVT.L..E....GQV....YH..H...........Y.L..A..H.WAEa.......wDRST...............ITDL.LSILQD.......IFAKEPPV................................................................
A0A0Q3U0B3_AMAAE/23-142                ........................................................TIEELKNVNKTYP.......NF.TFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTVNM..............GIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VIGL.IREMIA.......KFEEELPL................................................................
M5GGL2_DACPD/30-152                    .......................................................a-FAHIETALNAYH.......LL.KPK.RE..S.F..................I...........Y.....D.....DGR..S.H...HLLS..LAGLLQI..S.......YR............G...AS....Y.N...........IPIAVWIPFDYPN...........................EPP..M..A..F..V.VPTKDM..............VVK...A.GK...DLD.P..S....GKW....SG..E...........Y.L..K..S.WGRk.......gETCN...............LRTL.LEAMTD.......VFSREPPL................................................................
G0S9F7_CHATD/9-112                     ....................................................adqp-------------.......--.---.--..-.-..................-...........F.....P.....NGS..S.A...LLVL..LSGTIPV..V.......FR............G...TT....Y.R...........FPISVWVPHAYPS...........................EPP..I..V..Y..V.TPTETM..............VVR...P.GQ...HVD.S..Q....GCV....YH..P...........Y.L..T..A.WSTy.......wDKSN...............IVDF.LNILRE.......VFAKEPPV................................................................
A0A6P7XWR9_9AMPH/1-103                 ........................................................-------------.......--.---.MD..T.Y..................T...........F.....R.....DGS..Q.K...DLLN..FVGTIPM..T.......YQ............G...NS....Y.N...........IPVQLWILDSHPF...........................APP..L..C..F..L.KPTATM..............GIH...V.GK...HVD.T..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VLGL.FAEMIL.......KFEEELPL................................................................
A0A6P9E011_JUGRE/41-162                .......................................................i-RQHLVSLTSAYP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTVPM..S.......FQ............G...LT....Y.N...........IPVIIWLMDSYPR...........................HPP..C..V..Y..V.NPTRDM..............VIK...R.PH..pYVN.P..S....GLV....SV..P...........Y.L..H..N.WVY.........PSSN...............LVDL.VRNLSL.......HFGRDPPL................................................................
A0A1Y1ZFJ2_9PLEO/26-148                ........................................................TYNDVAEALSNYP.......SL.SPR.TE..V.Y..................T...........Y.....E.....NGA..S.A...LLLV..LSGTVPV..A.......FR............G...AT....Y.G...........FPVAIWVPHAYPR...........................ESP..I..V..Y..V.TPSQDM..............LVR...P.GQ...HVS.G..D....GRI....YH..P...........Y.L..A..Q.WGKy.......wDKST...............VFDF.LAVLRG.......VFAKEPPV................................................................
A0A067BZX7_SAPPC/25-145                .......................................................v-RQDVETLLRQIP.......SL.APQ.SG..V.Y..................T...........H.....N.....NGT..T.S...TMLS..LSGTIPI..Y.......YN............G...SQ....Y.N...........IPVEIWMPEAYPF...........................AAP..T..C..Y..V.RPTADM..............MIR...P.GH..pHVD.Q..N....GLI....LL..P...........Y.S..T..H.WDS.........-DHS...............LVEL.IGYQCS.......VFGTQPPV................................................................
A0A1D5QFP8_MACMU/23-143                ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............EIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A2U1L479_ARTAN/41-162                .......................................................i-RQHLISLTEAYP.......SM.SPK.TA..V.F..................T...........H.....N.....DGR..S.V...NLLQ..SEGTIPM..V.......YQ............N...VT....Y.N...........IPVVIWLMETYPR...........................YAP..A..V..Y..V.NPTRDM..............VIK...R.QH..pFVN.P..N....GLV....VV..S...........Y.L..Q..N.WVY.........PSSN...............LLDL.CRNLSH.......YFGLDPPL................................................................
A0A662Y4C9_9STRA/972-1092              ............................................annvsnldqils-------------.......SL.QCY.PR..M.T.................rP...........H.....N.....DGT..T.S...TLLN..LEGTIPI..F.......YR............G...NQ....Y.N...........IPVEFWVVETYPM...........................APP..V..C..F..V.RPTADM..............MVK...P.GH..pHVT.S..D....GYV....KI..P...........Y.T..T..D.WRP.........-DFT...............LLEL.VAHMCS.......IFGNMPPV................................................................
A0A485NY25_LYNPA/23-143                ........................................................TVEELKNVNRFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YH............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GVS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A1D2VQQ3_9ASCO/26-152                ........................................................TYQDTAVVLQAFP.......SL.RAR.TK..I.Y..................T...........F.....S.....NGT..D.R...LLLN..LHGTVPS..F.......FN............A...VS....Y.K...........IPVEIWLPTDYPL...........................SPP..T..V..Y..V.VPSSDM..............IIQ...P.SN...YID.N..N....GKF....YN..P...........Y.L..S..N.WSSnsq...thtQNSS...............LLQL.CNILST.......CFSKQPPL................................................................
A0A0E0CTL9_9ORYZ/45-172                .......................................................i-RNHLVALADAFP.......SL.HPK.AA..L.F..................T...........H.....N.....DGR..A.A...HLLQ..ADGTIPI..H.......HA............G...AS....Y.N...........LPAVLWLPEPYPR...........................SPP..L..V..F..L.SPTRDM..............VIK...P.HH..pLVD.R..S....GLV...aNA..P...........Y.L..R..S.WVF.........PSSN...............LVDL.VRSLSH.......LFPA----spqlaarpp.......................................................
A0A316V9C9_9BASI/23-145                ........................................................VYADIDRTLIANS.......SL.SPK.TE..V.Y..................T...........Y.....D.....DGR..S.Q...LLLV..LTGTVPM..Q.......YR............S...AT....Y.N...........IPVAFWIPRSYPK...........................QHP..L..A..Y..V.TPTNDM..............LVR...K.GR...HVD.L..S....GRI....GG..D...........Y.L..E..R.WQRk.......wEGCN...............LLEL.VQDCQA.......IFGQEPPV................................................................
A0A329SZ62_9STRA/25-145                ......................................................vr--GDVYNLLGQIP.......SL.QPN.CG..T.F..................A...........H.....N.....DGT..T.S...TLLN..LEGTIPI..F.......YR............G...NQ....Y.N...........IPVEFWVVETYPM...........................SPP..V..C..F..V.RPTADM..............MVK...P.GH..pHVT.S..D....GYV....KI..P...........Y.T..S..D.WRP.........-DFT...............MLEL.VAHMCS.......IFGNMPPV................................................................
A0A1Y2IKD4_PYCCO/25-147                ........................................................VYAHADAALTRHP.......TI.RPK.TD..V.Y..................T...........Y.....D.....DGR..T.Q...LLLC..LHGLLPI..S.......FR............G...AS....Y.N...........IPVAVWIPREYPR...........................NPP..L..A..Y..V.VPTSDM..............LVR...P.GP...DMD.T..S....GRC....LI..E...........Y.L..R..N.WERk.......cEGCD...............LVAL.LDAMKD.......AFSRQPPV................................................................
A0A565B991_9BRAS/37-158                .......................................................i-RTHLINLISSYP.......SL.EPK.TA..T.F..................M...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......FH............G...VT....Y.N...........IPVIIWLLESYPR...........................HPP..C..V..Y..V.NPTADM..............IIK...R.PH..aHVT.P..S....GLV....SL..P...........Y.L..Q..N.WVY.........PSSN...............LVDL.VSELSA.......AFASDPPL................................................................
A0A3B6KKU0_WHEAT/43-165                .......................................................i-RNHLVALADAFP.......SL.HPK.AA..L.F..................T...........H.....N.....DGR..A.A...HLLQ..ADGTVPI..H.......HA............G...AT....Y.N...........LPAVIWLPETYPR...........................SPP..L..V..F..L.SPTRDM..............LIK...P.HH..pLVD.R..S....GLV...aNA..P...........Y.L..R..S.WVF.........PSSN...............LLDL.VRSLSH.......LFGLDPPL................................................................
A0A091UJ99_NIPNI/8-128                 ........................................................TVQETTSVITQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
A0A663M5V2_ATHCN/21-138                ..................................................raepfk-------LILCFK.......ST.ICS.LS..-.-..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
A0A0G2GNX8_9EURO/589-638               ........................................................TYSDLVHTLAQYP.......SL.APR.TD..V.Y..................T...........Y.....E.....NGA..S.A...LLLH..LTGTIPV..Q.......FR............G...TS....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------pep.............................................................
C4M9S4_ENTHI/24-140                    .......................................................v-EQDIRSIHVKYP.......QF.RVD.T-..-.W..................T...........S.....R.....I-S..G.K...QLLV..LTGFLPI..L.......FN............G...RK....F.G...........IPLLIGFPYDYPL...........................SPP..E..I..I..C.NISEGM..............EIV...K.KH..pEVD.E..N....GVI....R-..K...........V.G..D..E.WNP.........-SSD...............LLMV.LESLAN.......SFGRYPPV................................................................
A0A0A1TI53_9HYPO/25-147                .......................................................c-YDDVAQVLTRYP.......SL.SPR.TD..V.H..................T...........F.....S.....NGS..S.A...LLLH..LSGTIPV..N.......FR............G...NT....Y.R...........FPLSVWVPHAYPR...........................EPP..L..I..Y..V.TPTETM..............TVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..V..G.WAQf.......wDKST...............LQDF.MAILTD.......VFAKEPPV................................................................
A0A0V0X969_9BILA/24-144                .......................................................t-KEEIMEALSQFH.......DL.IVR.KD..F.Y..................V...........G.....N.....DGV..R.E...LAIC..FCGTIPV..N.......YM............G...KT....Y.N...........IPICIYLLKNYPH...........................VPP..I..C..F..V.RPTASM..............IVK...P.SS...NVD.S..N....GKI....NV..P...........Y.L..T..E.WHQ.........SKSD...............LLGL.LQVLAI.......VFGESCPV................................................................
A0A317WJA8_9EURO/33-155                ........................................................TYYEVAGVLGQYP.......SL.GPR.TE..V.Y..................T...........F.....E.....NGF..S.A...LLLQ..LTGTLPV..T.......FR............G...TV....Y.K...........FPITIWLPNTYPR...........................EPP..L..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wERSS...............LSDF.LLILRE.......VFAKEPPV................................................................
A0A0C4EWP8_PUCT1/46-156                ................................................hpsrppaa-------------.......--.---.--..-.-..................-...........F.....D.....DGR..T.A...LLVS..LTGTIPV..H.......YR............A...LR....Y.N...........IPIAIWLPFEFPG...........................EPP..I..I..Y..L.TPTNDM..............VIR...K.GT...HVE.P..G....GKC....IA..G...........Y.F..D..S.WQSkp....ellQACS...............LVEL.LEFLQD.......IFSREPPL................................................................
A0A162MPS9_CORFA/25-147                ....................................................sydg----IARVLSRYP.......TL.SPR.TD..V.Y..................T...........S.....P.....DGA..S.A...LLVH..LSGTLPV..N.......FR............G...ST....Y.R...........FPLSIWIPHRYPR...........................EPP..I..I..Y..V.TPTESM..............LIR...P.GQ...HVD.Q..Q....GQV....YH..P...........Y.L..V..G.WQQf.......wDKST...............LQDF.LAILAD.......VFAKEPPV................................................................
A0A3B5Q0P4_XIPMA/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSTM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A0C3AW68_9AGAM/21-143                ........................................................VYNDVDSALASHP.......TV.RPK.TD..V.Y..................T...........Y.....D.....DGR..A.E...LLIC..VHGLLPI..S.......FR............G...AS....Y.N...........IPISVWIPHGYPK...........................EVP..I..V..Y..V.VPTSDM..............LVR...A.SK...SID.P..S....GRC....SF..P...........Y.M..E..A.WERk.......sEGCN...............LREL.LDIMQE.......HFSREPPL................................................................
A0A022S1A0_ERYGU/35-155                .......................................................i-RQHLISLFQDFP.......CF.KPS.VD..V.F..................T...........Y.....N.....DGT..E.V...KLLN..ASGKLTV..S.......QD............-...-A....P.P...........VPVTIWVPEYYPE...........................MAP..I..V..Y..V.DSGSPL.............yPIY...E.NH..pFSN.C..S....GET....TC..P...........Y.L..E..N.WRF.........SKCD...............LSGL.TRNLKK.......LFSHNHP-f...............................................................
A0A1L8GI41_XENLA/1-98                  ........................................................-------------.......--.---.--..-.-..................-...........F.....N.....DGS..S.R...ELLS..LSGTIPV..P.......YK............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSTM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PPSD...............LLGL.IQILIV.......VFGEEPPV................................................................
A0A6P9BSB7_PANGU/8-128                 ........................................................TIEELKHINELYP.......NI.RFT.MS..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FTSTVPV..K.......YK............G...NI....Y.N...........IPICIWILDSYPF...........................TPP..I..C..F..L.NPTANM..............GIS...V.GK...HVD.V..R....GRI....YL..P...........Y.L..Q..A.WSH.........PQSV...............IIGL.LKEMSI.......KFEEELPL................................................................
L1IJT2_GUITC/1-81                      ......................................................mf-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......YN............Q...KK....Y.N...........CPVRIWFCLDYPK...........................SPP..I..C..Y..V.TPTRDM..............GIK...P.RH..vHVD.S..A....GFI....YH..Q...........Y.L..T..Q.WSD.........-SSS...............VKEL.VATLKN.......VFSREPPV................................................................
A0A1Q9D930_SYMMI/1-72                  .......................................................m-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........--VTIYFDPPYPK...........................QPP..R..C..F..V.TPTAGM..............ALK...Q.NH..qSVD.S..G....GMV....YS..P...........F.L..S..S.WSE.........TSST...............LPQL.VKSLAE.......SFSSSPPV................................................................
A0A397GCY8_9EURO/33-155                ........................................................TYYDVANVLAQYP.......SL.SPR.TD..V.Y..................T...........Y.....E.....TGF..S.A...LLLH..LTGTIPV..S.......FR............G...TV....Y.K...........FPIALWIPNTYPR...........................EPP..M..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wDRSN...............LVDF.LMILRE.......VFAKEPPV................................................................
A0A2I3LWH0_PAPAN/12-132                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A2S4VS78_9BASI/22-125                ......................................................is--TQITQTLASYS.......SL.APK.TE..P.F..................T...........F.....D.....DGR..T.A...LLLK..LSGTIPV..N.......YR............R...II....Y.N...........LPIAIWLPFSFPA...........................DPP..I..L..Y..L.TPTNEM..............VIR...P.SS...NVD.P..S....GRI....NL..E...........-.-..Q..H.WNA.........----...............----.------.......--------kpelnrs.........................................................
A0A061DQB8_THECC/33-152                .......................................................i-LRHLLSLLQEYP.......SF.RPS.TG..R.F..................L...........H.....N.....DGN..E.V...NLLC..ASGYVHV..S.......NS............-...-T....P.S...........IPLTIWLHENYPH...........................KAP..L..V..F..V.SLDPMT..............RIH...R.HH..pFVD.T..S....GAT....TP..P...........Y.I..L..T.WKY.........PPCN...............LSDL.LHNLVQ.......LFSHDHP-f...............................................................
W5JIK1_ANODA/22-142                    ........................................................TKKDVINVLRLYH.......GL.QHR.VE..E.Y..................V...........F.....N.....DGS..T.K...MLLN..LHGTIPV..K.......FK............G...NT....Y.N...........IPICIWLMDTHPK...........................NAP..I..C..Y..V.KPTPDM..............RIK...V.SS...FVD.F..N....GKI....YL..P...........Y.L..H..E.WNP.........KNAD...............LLDL.IQIMSV.......TFGDVPPV................................................................
A0A3L6QGY7_PANMI/43-165                .......................................................i-RNHLVALAEAFP.......SL.HPK.AA..L.F..................T...........H.....N.....DGR..A.A...HLLQ..ADGTIPI..H.......HA............G...AS....Y.N...........LPAVIWLPEPYPR...........................SPP..L..V..F..L.SPTRDM..............VIK...P.HH..pLVD.R..S....GLV...aNA..P...........Y.L..R..S.WVF.........PSSN...............LVDL.VRSLSH.......LFGLDPPL................................................................
G7PQL3_MACFA/21-141                    .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A1R3KQ00_9ROSI/41-162                .......................................................i-RQHLLSLNSHYP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......YQ............G...VT....Y.N...........IPIIIWLMESYPR...........................HPP..V..V..Y..V.NPTRDM..............IIK...R.PH..pHVT.P..S....GLV....SM..P...........Y.L..Q..N.WIY.........PSSN...............LVDL.VLNLSS.......AFSRDPPL................................................................
A0A444UMY6_ACIRT/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.K...DLMS..LTGTVPV..S.......YR............G...NT....Y.N...........IPVCLWLLDVYPY...........................SPP..I..C..F..V.KPTSAM..............MIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMVV.......VFGEEPPV................................................................
A0A2A2J5F5_9BILA/75-195                .......................................................a-KEDILAALQQFK.......DL.APS.TE..N.F..................L...........F.....P.....DGK..R.K...MSFR..LSGTIPV..P.......YK............G...NT....Y.N...........IPVCVYLYDTHPY...........................YAP..V..C..Y..V.RPTNSM..............VIK...E.SE...HVN.K..E....GRV....FL..P...........Y.L..N..E.WRF.........PGYD...............LNGL.LQMMAM.......IFQEKCPV................................................................
A0A5N6LAZ6_9ASTR/42-163                .......................................................i-RQHLLSLYETYP.......SL.HPQ.TA..V.F..................T...........H.....N.....DGR..S.V...NLLQ..SDGTVPM..V.......YQ............N...VT....Y.N...........IPVVIWLMETYPR...........................HPP..L..V..F..V.NPTRDM..............IIK...R.QH..aFVN.P..S....GLV....SI..P...........Y.L..Q..N.WVY.........PSSN...............LVDL.TRNLSH.......YFGLDPPL................................................................
A0A1Q5QBH5_9EURO/33-155                ........................................................TYHDVARALAQYP.......SF.GPR.TD..V.Y..................T...........S.....E.....NGT..P.S...LLLH..LAGTLPV..S.......FR............G...AV....Y.N...........IPIDTWVPTAYPL...........................EAP..I..V..Y..V.SPTPDM..............LVR...S.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WHEa.......wDRSS...............IVEL.FAILRE.......VFAKEPPV................................................................
A0A484D1S4_PERFV/21-141                .......................................................a-VEELQKIHRGYP.......GI.QPF.TG..T.Y..................T...........F.....S.....DGT..Q.K...DLLK..LIGNIPV..K.......YE............G...RS....Y.N...........FPIQLWLMDSFPF...........................TPP..I..C..L..L.RPTPDM..............VIR...E.GK...HVD.G..G....GRI....HL..P...........G.L..H..N.WDY.........PKSS...............VVGL.LTEMIA.......KFEEDPPL................................................................
A0A5B6WIE9_9ROSI/63-135                ...........................................pslpsrclresha-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................RPP..V..V..Y..V.NPTRDM..............IIK...R.PH..pHVS.P..S....GLV....SI..P...........Y.L..Q..N.WIY.........PSSN...............LVDL.VVNLGS.......AFSHDPPL................................................................
A0A7N5PA08_AILME/59-179                ........................................................TVEELKNVNMFFP.......HF.RYS.VD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTVPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..H..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A165KFB9_9APHY/25-135                ........................................................VFQHVDAAITRYP.......TI.RPK.TD..V.Y..................T...........F.....D.....DGR..T.Q...LLLC..LHGLLPI..A.......FR............G...AS....Y.N...........IPVAIWLTRDYPQ...........................HAP..L..A..Y..V.VPTTDM..............LVR...P.GP...DMD.V..S....GRC....HI..Q...........Y.L..R..D.WAR.........K---...............----.------.......--------pevrvlrrahv.....................................................
A0A384BSD5_URSMA/1-80                  .......................................................m-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A0F8CZB9_CERFI/25-147                .......................................................s-YYDISQALATYP.......NL.TLQ.NE..V.H..................T...........F.....S.....NGA..S.A...LMLN..IYGTVPV..V.......FR............G...HT....Y.Y...........FPISIWVPHAYPR...........................EPP..I..V..Y..V.TPTPKM..............VVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.I..S..G.WSTf.......wDKST...............IVDM.LAILID.......VFAKEPPL................................................................
A0A6P8Q992_GEOSA/1-47                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.-----M..............GIH...V.GK...HVD.S..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VLGL.IAEMIL.......KFEEEHPL................................................................
A0A0J7L578_LASNI/25-145                ........................................................TRKHVVSVLNLYK.......GL.VYE.IE..P.F..................I...........F.....N.....DGS..R.K...ELVN..LQGTIPV..V.......YK............G...TC....Y.N...........IPICIWLMDTHPN...........................NAP..M..C..Y..V.KPTADM..............HIK...V.SM...FVD.H..N....GKI....YL..P...........Y.L..H..D.WVP.........HNSD...............LLAL.IQVMIV.......TFGEQPPV................................................................
A0A5N6VDC3_9EURO/33-155                ........................................................TYYDVASVLAQYP.......SL.SPR.TE..V.Y..................T...........Y.....E.....HGF..S.A...LLLQ..LTGTVPV..T.......FR............G...TV....Y.K...........FPISLWVPNTYPR...........................EPP..I..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wERST...............LVDL.VSILRE.......VFAKEPPV................................................................
A0A182GPL4_AEDAL/17-137                ........................................................TKKDVSECLKQYK.......AL.SCR.YE..E.Y..................V...........F.....N.....DGT..V.K...QLIN..LQGTIPV..R.......YK............G...NT....Y.H...........IPICIWLLDTHPR...........................YAP..I..C..Y..V.KPTSDM..............HIK...V.SM...YVD.H..N....GKI....YL..P...........Y.L..H..E.WTP.........MQSD...............LLGL.IQVMIV.......TFGEYPPV................................................................
A0A3Q1LZA3_BOVIN/1-102                 .....................................................mvq-------------.......--.---.--..-.-..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..I.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQDELPL................................................................
Q4DA96_TRYCC/124-208                   ..................................................qapphr-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....Y.V...........LPLQIWLTHLYPI...........................EPP..L..V..F..L.LSAEQG.............cRIA...S.NH..kYVD.A..T....GRC....HT..P...........E.L..A..A.WHP.........VSSS...............LCDV.VKKLCQ.......LLSA----egsiplc.........................................................
A0A261Y092_9FUNG/23-145                ........................................................TFRDVDAVLQMYA.......NL.KPK.MD..N.Y..................T...........Y.....D.....NGH..T.Q...LLLC..LQGTVPI..T.......YR............K...NP....Y.N...........IPMAFWIPSDYPL...........................HPP..I..P..Y..V.KPTPTM..............WVK...K.NN...NVD.V..S....GLC....YH..P...........Y.R..S..D.WGSd.......iQNHN...............IVEL.IYILQQ.......VFSEEPPV................................................................
A0A4E0R7K2_FASHE/21-141                ........................................................VTNDVKCALSAYK.......EL.RLK.VE..N.F..................T...........F.....N.....DGR..S.H...NLVC..LNGTIPV..V.......YY............G...QK....Y.N...........IPIAIFIQEPHPH...........................TAP..M..V..Y..V.RPTSTM..............QIA...P.SH...FVD.K..T....GLV....NL..P...........Y.L..S..E.WKH.........PESD...............LVGL.LQVLQV.......TFGEKSPV................................................................
A0A1L9UCW0_ASPBC/33-155                ........................................................TYYDVANVLGQYP.......SL.GPR.TE..V.Y..................T...........Y.....E.....NGF..S.A...LLLQ..LTGTLPV..T.......FR............G...TV....Y.K...........FPITLWIPNTYPK...........................EPP..L..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wERSS...............LIDF.LMILRE.......VFAKEPPV................................................................
A0A5J9UIN3_9POAL/165-273               .......................................................i-RNHLVALAEAFP.......SL.HPK.AT..L.F..................T...........H.....N.....DGR..A.A...HLLQ..ADGTIPI..H.......HA............G...EP....YpR...........SPP----SSGYPSp.........................tHAP..R..L..S..S.SSLTCD..............MVE...P.NH..pLAH.R..S....GLV...aNV..P...........Y.L..R..A.RVF.........PSSN...............LVDL.V-----.......--------................................................................
A0A101MNK6_9EURO/32-154                ........................................................TYHDVANALSQYP.......SL.SPR.TD..V.Y..................T...........Y.....E.....TGF..S.A...LLLH..LVGTLPV..T.......FR............G...TT....Y.R...........FPIALWIPNTYPR...........................EPP..I..V..Y..V.TPTQEM..............AVR...V.GQ...HVT.L..E....GQV....YH..H...........Y.L..A..H.WAEa.......wDRST...............IVDL.LSILQD.......IFAKEPPV................................................................
A0A1L9NFQ6_ASPTC/33-155                ........................................................TYYDVANVLGQYP.......SL.GPR.TE..V.Y..................T...........Y.....E.....NGF..S.A...LLLQ..LTGTLPV..T.......FR............G...TV....Y.K...........FPITLWIPNTYPR...........................EPP..L..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wERSS...............LIDF.LMILRE.......VFAKEPPV................................................................
A0A2V3ITJ3_9FLOR/35-157                ........................................................VIHDLIECCTRYP.......TL.HAI.IS..N.F..................R...........P.....L.....GGT..P.Q...RLVA..LRGTIPI..V.......YK............S...SS....Y.K...........IPVHIWVMSFHPQ...........................GPP..L..I..Y..V.VPTRSM..............VFR...A.NH..pHVNhT..N....GFV....HL..P...........Y.L..S..Q.WDP.........LTST...............LQAC.VHAMIQ.......VFSVKPPV................................................................
A0A392QIL4_9FABA/42-163                .......................................................i-RQHLLTLITAFP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..T.V...XXXX..XXXXXXX..X.......XX............X...XX....X.X...........XXXXXXXXXSYPR...........................HPP..C..V..Y..V.NPTRDM..............IIK...R.PH..pHVN.P..S....GLV....SV..P...........Y.L..H..N.WIY.........PSAT...............LVDL.VLNLSL.......IFGRDPPL................................................................
A0A0A0KT64_CUCSA/44-165                .......................................................i-RQHLVALTTAFP.......SL.VPR.TA..S.F..................T...........H.....N.....DGR..S.V...NLLQ..SDGTVPM..S.......FQ............G...AT....Y.N...........IPVVIWLMESYPR...........................HPP..C..V..Y..V.NPTRDM..............IIK...R.PH..pHVN.P..S....GMV....SI..P...........Y.L..Q..N.WIY.........PSSN...............LVEL.VRNLSV.......MFGRDPPL................................................................
A5DLZ2_PICGU/26-162                    .......................................................a-YTHIIRFLQSHLyg...eeKF.KIR.TQ..V.Y..................T...........F....pE.....SGY..E.A...LMLN..LAGNLSI..P.......GH............-...--....S.T...........VPIQIWVPHRYPFe.........................dGVP..I..V..Y..V.TPDPSQg............aILL...P.GN...HID.G..S....GRF....YH..P...........Y.L..S..R.WFS.........ECSSynqds.....fgrynLLEL.VQVMRQ.......SFSKEFPL................................................................
A0A5N5ND53_9ROSI/38-159                .......................................................i-RQHLLSLTTTSP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..T.V...NLLQ..ADGTVPI..A.......FV............S...VT....Y.N...........IPVIIWLTESYPR...........................HPP..C..V..Y..V.NPTRDM..............IIK...R.SH..pFVN.P..S....GLV....SV..P...........Y.L..Q..N.WIY.........PSSN...............LVDL.AHELSS.......VFGRDPPL................................................................
A0A6P9BP77_PANGU/21-141                ........................................................TIEELKHINELYP.......NI.RFT.MS..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FTSTVPV..K.......YK............G...NI....Y.N...........IPICIWILDSYPF...........................TPP..I..C..F..L.NPTANM..............GIS...V.GK...HVD.V..R....GRI....YL..P...........Y.L..Q..A.WSH.........PQSV...............IIGL.LKEMSI.......KFEEELPL................................................................
A0A2R9AWV2_PANPA/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
F1PQX3_CANLF/35-118                    ....................................................rysm-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......TY............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A3Q1J802_ANATE/21-76                 .....................................................vag---EIYHAVTHFK.......NL.VPI.MD..K.Y..................V...........Y.....N.....DGT..T.K...HLMS..LTGTIPV..M.......FT............D...NI....Y.N...........IPICTH-------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------v...............................................................
A0A2I3M6T7_PAPAN/21-141                ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A2G2X618_CAPBA/50-170                .......................................................i-RRHLVSLVQDYP.......HF.KPY.ID..A.F..................A...........H.....D.....DGT..S.V...NLLN..ANGELQV..S.......SS............-...-T....P.A...........VPLTIWLHESYPF...........................VAP..I..V..L..V.STNTTY..............PIY...D.NH..pFVD.S.sS....GAV....SS..Y...........Y.L..V..N.WKY.........PGCN...............LSDL.VHNLVK.......IFSLNHP-f...............................................................
A0A068Y336_ECHMU/100-220               .....................................................ari---DIEKASQAYH.......SL.QVK.LQ..D.F..................T...........F.....E.....NGQ..T.S...KLLC..MEGTIPV..K.......YM............G...NV....Y.N...........IPLAVYFVRQHPY...........................HPP..I..A..Y..V.RPTSSM..............QIK...A.GP...NVD.T..N....GKI....FL..P...........Y.L..S..E.WNF.........PDSS...............TQGL.LEILQN.......VFGQRTPV................................................................
A0A2K5C4H3_AOTNA/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A2K5JZZ1_COLAP/22-116                ...........................................cvlllfedmflls-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......QI............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........VRSI...............----.------.......--------wifyrkilkkllilnsqdnpl...........................................
A0A2K5S838_CEBIM/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
N1QB75_PSEFD/42-164                    ........................................................TYSDTARTLSLYP.......SL.LPA.TE..V.Y..................T...........Q.....E.....DGT..S.S...LLLR..LAGTVPA..A.......FR............G...TT....Y.R...........FPVKIWIPHAYPY...........................EAP..F..A..Y..V.VPGKEM..............VVR...P.GQ...HVG.V..D....GRI....YH..P...........Y.L..R..D.WGRi.......wDRAN...............TSDF.LDHLSQ.......VFSREPPV................................................................
A0A5A9PQT2_9TELE/29-149                .......................................................v-LSEVCTVLSQHQ.......NL.EAV.ID..K.F..................V...........F.....N.....DGT..V.K...NLIS..LTGTVMV..F.......YE............G...KR....Y.N...........IPVCLWLNESYPR...........................SAP..I..C..Y..V.KPTRDM..............MIV...S.SR...HVN.S..N....GEI....ML..P...........Y.L..E..E.WRH.........TQCD...............LHSL.IQVIMA.......VFSEVPPV................................................................
A0A6J5Y4C9_PRUAR/49-174                ......................................................il--TDVIQLLFHMP.......SL.VPK.RG..R.F..................-...........-.....Q.....KGE..P.-...LVLV..IKGTIPI..F.......YK............A...QH....Y.K...........TPIKIWVPLGYPR...........................DSP..K..V..R..V.VVEDQAi............lSIK...F.PH..pYVD.AgaG....GLV....NV..P...........Y.M..Q..A.WTE.........SHLEi............rtLTDL.VINMCE.......CFSVDPPV................................................................
G2X5W8_VERDV/26-134                    ....................................tygdvaqalsqypslsprtd-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..VHRTLPV..I.......FR............G...TT....Y.R...........FPLSIRVPYAYPR...........................EAP..L..I..Y..V.TPTEHM..............VVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..A..G.WSTf.......wDKST...............LVDF.LTILRD.......VFAKEPPV................................................................
M4CB71_BRARP/37-158                    .......................................................i-RQHLLNLISSYP.......SL.EPK.TA..T.F..................I...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..P.......YH............G...VT....Y.N...........IPVIIWLLESYPR...........................HPP..C..V..Y..V.NPTADM..............IIK...R.PH..aHVT.P..S....GLV....SL..P...........Y.L..Q..N.WVY.........PSSN...............LVDL.VSDLGA.......AFATDPPL................................................................
A0A158PJS4_ANGCS/28-144                ......................................................ak--SDILGALAEFK.......DL.IPD.IE..S.F..................T...........F.....P.....DGT..T.K...TAFR..LRGTIP-..-.......--............G...AR....Y.N...........IPISVYLWDTHPY...........................YAP..I..C..Y..V.NPTSSM..............VIR...E.SE...HVT.K..Q....GRI....FL..P...........Y.L..N..E.WRF.........PGYD...............LNGL.LQVMAM.......VFQEKCPV................................................................
A0A6I9T993_SESIN/33-153                .......................................................i-REHLISLFQDFP.......SL.RPS.TG..F.F..................T...........H.....N.....DGT..E.V...KLLY..ATGDLPV..S.......RP............-...-S....P.P...........VPVTIWVPELYPQ...........................APP..F..V..Y..V.NVECVM.............hPIY...D.HH..pFVD.S..S....GAT....VS..S...........Y.L..L..N.WQF.........SKCN...............LSDL.VRSLIK.......LFSHNHP-f...............................................................
A0A315VNU9_GAMAF/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGT..S.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSTM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A0C3AJW1_9AGAM/24-146                .......................................................v-FVDIDAALARFT.......TL.HPK.SD..V.Y..................T...........Y.....D.....DGR..T.Q...LLLC..VHGLLPM..V.......FR............N...TT....Y.N...........IPIAVWITRDYPR...........................APP..I..A..Y..V.VPTQDM..............LVK...A.TK...FVD.V..S....GRC....NI..D...........Y.L..Q..T.WERk.......sEGCN...............LSAL.LEAMQG.......HFSREPPL................................................................
A0A5F8GZK3_MONDO/103-208               .................................................seaaaeq-------------.......--.---.--..-.-..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..N.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSI...............ITGL.ISEMII.......KFQEELPL................................................................
A0A673UXU3_SURSU/37-119                ...................................................pvlds-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......-Y............G...NI....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A452CBH9_BALAS/21-141                ........................................................TMEELKNVNMFFP.......HF.IYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...NLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.T..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A4Q4ZNI7_9PEZI/25-147                ........................................................TYNDVAQALSQYS.......SL.SPR.TD..V.H..................T...........F.....D.....NGI..S.A...LLLH..LSGTIPV..V.......FR............G...TT....Y.R...........FPISIWVPHAYPR...........................EAP..L..A..Y..V.TPTENM..............MVR...P.GQ...HVD.P..Q....GRI....YH..P...........Y.L..A..A.WPEf.......wDKSS...............LLDF.LAILRD.......IFAKEPPV................................................................
A0A3M6ULB7_POCDA/9-129                 ......................................................cr--ADVMRALHQYP.......TL.PAD.LQ..N.F..................T...........H.....N.....DGR..E.A...QLLA..LDGTLPV..L.......IR............G...VT....Y.N...........IPVCVWLQENHPY...........................VPP..L..V..Y..V.KPTNTM..............AIK...P.SQ...FVD.S..N....GKV....YH..P...........F.L..H..E.WTY.........PKSD...............LAAL.LQILCS.......IFAQQSPV................................................................
A0A059D226_EUCGR/33-155                .......................................................i-RKDMLSLLQDFP.......NL.SPS.MD..A.Y..................I...........H.....N.....DGS..I.V...NILN..AHGTVHV..S.......SS............-...-S....P.Q...........VPLTIWLHENYPH...........................AAP..I..V..M..V.GLPGVAs...........slTIH...H.NH..pFID.P..S....GLT....TS..P...........Y.I..Q..T.WEF.........PRCN...............LKDL.VHNLVK.......IFSRDHP-f...............................................................
A0A484DWJ4_BRELC/45-165                .......................................................v-REDVYNLLGQIP.......SL.QPN.CG..T.F..................A...........H.....N.....DGT..T.S...TLLN..LEGTIPI..F.......YR............G...NQ....Y.N...........IPIDFWVVETYPM...........................NPP..V..C..F..V.RPTADM..............MVK...P.GH..pHVT.S..D....GYV....KI..P...........Y.T..C..D.WRP.........-DFT...............LLEL.VAHMCS.......IFGNIPPV................................................................
G3UDD7_LOXAF/21-141                    .......................................................t-VRETINVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A671FWS3_RHIFE/21-141                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.VKEMIA.......KFQEELPL................................................................
A0A6P3VXT0_CLUHA/21-141                .......................................................a-IEEIQKVNRIHP.......DV.QIR.VG..S.F..................T...........S.....T.....DSM..Q.K...DLLK..LVGNIPV..K.......YQ............G...RT....Y.N...........LPILMWLLESFPF...........................TPP..V..C..L..L.RPTTNM..............VIQ...K.GR...HVD.A..Q....GRM....YL..P...........G.L..H..N.WDH.........PKST...............VNGL.MAEMIA.......KFEEEPPL................................................................
A0A5A9PS66_9TELE/23-143                ........................................................TVRDVTNVTSQYK.......DL.KPV.MD..N.Y..................V...........F.....N.....DGS..N.K...ELLS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCMWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKP.........PQSD...............LLGL.IQVIVV.......VFGEEPPV................................................................
A0A2Y9JQ99_ENHLU/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YK............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A3P8Z5N4_ESOLU/20-140                ........................................................TVREITNVISQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..T.K...SLMS..LTGTVPV..S.......YR............G...NI....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A2I4AIC2_9TELE/24-145                ......................................................al--QDLHTVRARFS.......DL.RLY.VD..F.Y..................C...........F.....P.....NNE..K.R...KLVY..LSGTLPV..L.......FE............G...SE....Y.N...........LPVCIWLHETHPA...........................LCP..C..C..F..V.CPSPTM..............VIN...R.SC..pFVD.A..T....GSV....SL..D...........G.L..R..N.WTH.........GTSN...............LSLL.MSEMRR.......AFQKDTPL................................................................
A0A161W0L2_9PEZI/25-147                ........................................................TYNDVAQALSHYP.......SL.SPR.TD..V.H..................T...........F.....D.....NGA..S.A...LLVH..LSGTIPV..I.......FR............G...TT....Y.R...........FPISIWVPHAYPR...........................DAP..L..V..Y..V.TPTETM..............MVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..V..G.WAAf.......wDKST...............ILDF.LAILRD.......IFAKEPPV................................................................
A0A2K5SC55_CEBIM/20-140                ........................................................TVEELKNVNMFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A1Y1WCD5_9FUNG/1-86                  .....................................................mdd-------------.......--.---.--..-.-..................-...........-.....-.....--A..T.R...GLLC..FHGTIPV..P.......YH............G...AV....F.N...........IPSEVLVPAGVPD...........................AP-..-..-..-..-.-----A..............DFK...A.GK...YVD.D..K....CKI....YH..P...........Y.L..A..S.WSS.........-ESV...............TVEL.IAQLIK.......VFS-----ppsqt...........................................................
A0A0F0I7R7_ASPPU/385-507               ........................................................TYYDVASVLAQYP.......SL.SPR.TE..V.Y..................T...........Y.....E.....NGF..S.A...LLLQ..LTGTVPV..T.......FR............G...TV....Y.K...........FPISLWVPNTYPR...........................EPP..I..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wERST...............LVDL.VSILRE.......VFAKEPPV................................................................
A0A3Q7HZ13_SOLLC/45-166                .......................................................i-RQHLVSLIDTCP.......SL.QPR.TA..T.F..................T...........Y.....N.....DGR..T.V...NLLQ..ANGTVPM..V.......YL............D...AT....Y.N...........IPVIIWLLESYPR...........................QSP..L..V..F..V.NPTRNM..............VIK...D.SH..pFVN.S..S....GIV....SI..P...........Y.L..K..N.WVY.........PSSN...............LVEL.ARNLSH.......FFSRDPPL................................................................
A0A5N5DN80_9PEZI/67-175                ...............................................nvvfavvaa-------------.......--.---.--..-.-..................-...........Y.....E.....NGV..P.A...LLLL..LSGTLPV..Q.......FR............G...AI....Y.R...........FPIALWVPHDYPR...........................EPP..M..V..Y..V.TPTQDM..............LVR...P.GQ...HVS.G..E....GRV....YH..P...........Y.L..S..G.WASy.......wDKSS...............ISDF.LTVLRG.......VFAKEPPV................................................................
A0A5F4D8C2_CANLF/62-182                ........................................................TVEELKNVNRFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
V9DWH8_PHYPR/25-145                    ......................................................vr--GDVYNLLGQIP.......SL.QPN.CG..T.F..................A...........H.....N.....DGT..T.S...TLLN..LEGTIPI..F.......YR............G...NQ....Y.N...........IPVEFWVVEAYPM...........................SPP..V..C..F..V.RPTADM..............MVK...P.GH..pHVT.S..D....GYV....KI..P...........Y.T..S..D.WRP.........-DFT...............MLEL.VAHMCS.......IFGNMPPV................................................................
A0A084FZY5_PSEDA/31-153                ........................................................TYNDVAQALSLYP.......SL.SPR.TD..V.H..................T...........F.....D.....NGV..S.A...LLVH..LSGTLPV..V.......FR............G...AT....Y.R...........FPVSLWVPHAYPK...........................AAP..L..V..Y..V.KPTETM..............LVR...P.GQ...YVD.P..Q....GQV....YH..P...........Y.L..A..A.WANf.......wDKST...............LADL.LTILTD.......IFAKEPPV................................................................
H3GRU5_PHYRM/25-139                    .....................................................vrg---DVYNLLGQIP.......SL.QPN.CG..T.F..................-...........-.....-.....---..G.S...TLLN..LEGTIPI..F.......YR............S...NQ....Y.N...........IPVEFWVVETYPL...........................APP..V..C..F..V.RPTADM..............MVK...P.GH..pHVT.S..D....GYV....KI..P...........Y.T..S..D.WRS.........-DFT...............LLEL.VAHMCS.......IFGNMPPV................................................................
A0A0D2B7C2_9EURO/26-148                ........................................................TYSDLAYVLSRNN.......GF.APR.TD..V.Y..................T...........F.....E.....NGV..S.A...LLIH..FKGTIPV..N.......FR............G...NV....Y.R...........FPISLWVPHTYPY...........................EPP..M..C..Y..V.TPTDDM..............IIR...P.GQ...YVG.G..D....GKI....YH..P...........Y.L..A..H.WREa.......wERSN...............LVDF.LSILAD.......VFAKEPPV................................................................
A0A3B6KS41_WHEAT/30-154                ......................................................vp--DHLATLAEAFP.......SL.RPR.TA..L.F..................T...........H.....D.....DGR..A.A...RLLQ..AAGTIPI..A.......HA............G...GS....Y.D...........LPAVVWLPERYPR...........................CPP..L..V..F..L.SPARGT..............VLR...T.DH..pLVD.R..S....GLVa.aaDA..P...........Y.L..R..S.WAF.........PSSN...............LRDL.VRSLSH.......AFGIDPPL................................................................
A0A0C9X8X0_9AGAR/22-144                ........................................................VYSDINAALARFQ.......TL.RPK.SD..I.Y..................T...........F.....D.....DGR..T.Q...LLLC..IHGLLPI..S.......FR............Q...AS....Y.N...........IPISVWLPRQYPQ...........................QPP..I..P..Y..V.VPTTDM..............LVK...P.GP...YVD.V..S....GRC....NP..E...........Y.I..Q..H.WERk.......yEGCS...............LSAL.FEALQD.......QFSREPPV................................................................
A0A7N4PQJ2_SARHA/1-103                 ........................................................-------------.......--.---.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..N.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTPNM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............ITGL.ISEMII.......KFQEELPL................................................................
G2YDZ8_BOTF4/26-148                    ........................................................TYNDVAQTLSQYN.......SL.SPR.TD..V.Y..................T...........C.....E.....NGA..S.S...LLLH..LSGTLPV..N.......FR............G...TT....Y.R...........FPIALWIPHAYPH...........................EAP..L..V..Y..V.TPVEGM..............VVR...A.GQ...HVD.P..Q....GKV....YH..P...........Y.L..M..R.WPDy.......wDKSN...............VLDF.LAILRD.......VFAKEPPV................................................................
A0A4Z0Z9T3_9PEZI/25-147                ........................................................TYNDVAQAISQYP.......SL.SPR.TD..V.H..................T...........F.....D.....NGV..S.A...LLLH..LSGTIPV..A.......FR............G...TT....Y.R...........FPISIWIPHAYPR...........................EPP..L..G..Y..V.TPTDTM..............VVR...P.GQ...HVD.P..Q....GRI....YH..P...........Y.L..V..R.WAEf.......wDKSS...............LVDF.IAILRD.......IFAKEPPV................................................................
A0A6J2PV87_COTGO/21-141                .......................................................a-VEQLQKIHQIYP.......GM.TPS.TG..T.Y..................T...........F.....N.....DNT..Q.K...DLLK..LIGNIPV..Q.......YG............G...RS....Y.N...........IPILLWLMDSFPF...........................TPP..I..C..L..L.RPTPNM..............VIR...E.GK...HVD.G..G....GRL....HM..P...........E.L..H..N.WNY.........PRSS...............VVSL.LTEMIA.......KFEEDPPL................................................................
A0A550CLW8_9AGAR/27-149                ........................................................VVQHVTDALSRYA.......TL.HVK.SD..V.Y..................I...........Y.....D.....DGR..S.H...LLLC..VHGLLPV..V.......FR............G...AA....Y.N...........IPLSVWIPLDYGS...........................TPP..I..V..Y..V.VPTTGM..............VVR...K.SK...DVD.V..S....GLV....EG..D...........Y.A..R..N.WRRk.......nEGCT...............LVGI.LESLQH.......QFGLEPPV................................................................
A0A3Q0GE12_ALLSI/420-540               ........................................................TVQETISVITQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
A0A1U8P639_GOSHI/1-66                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------MESYPR...........................YAP..A..V..Y..V.NPTRDM..............IIK...R.PH..pHVS.P..S....GLV....SI..P...........Y.L..H..N.WIY.........PSSN...............LVDL.VLHLSS.......AFSRDPPL................................................................
B5X3I4_SALSA/21-141                    .......................................................a-IEELQKVHQIHP.......AM.KPV.AG..T.Y..................T...........F.....S.....DGT..Q.K...DLLK..LIGNIPV..K.......YE............G...RS....Y.N...........LPILLWLMDSFPF...........................TPP..I..C..L..L.RPTTNM..............VIR...E.GK...HVD.A..R....GRI....YL..P...........S.L..H..N.WDH.........PKSS...............VVGL.LAEMIS.......QFEEEPPL................................................................
A0A212FP45_DANPL/1-47                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.-----M..............SIK...V.SK...YVD.N..N....GKI....YL..P...........Y.L..H..E.WKA.........NVST...............LQRL.VQQMII.......AFGELPPV................................................................
A0A6J0XJS8_ODOVR/21-141                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..I.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIL...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A0L6WFC2_9AGAR/25-147                ........................................................VYADIDLLLQRYS.......TL.RPK.SD..V.Y..................T...........F.....D.....DGR..T.Q...LLLC..VHGLLPI..S.......FR............G...AS....Y.N...........IPVAIWLAREYPK...........................QPP..I..A..Y..V.VPTNDM..............LVK...P.GK...HLD.V..S....GRC....NI..E...........Y.I..Q..H.WERk.......sEGCN...............LSAL.VEAMQV.......QFSEEPPV................................................................
A0A369S2L0_9METZ/20-147                .......................................................i-ITEIINAVKLFN.......SF.DIK.IS..E.H..................V...........F.....T.....DGR..A.E...QLLT..INGAVPI..NssvipaeFR............R...VR....H.S...........VPIALYLRKNFPL...........................SAP..I..C..F..I.SPEENQ..............ELL...T.TG...MVD.S..N....CRI....SL..S...........Y.L..E..D.WKW.........PGSD...............LRSL.FEIMIV.......EFSSEIPL................................................................
A0A1S4DCE8_TOBAC/37-158                .......................................................i-RQHLLSLIETYP.......SL.QPK.TA..T.F..................T...........H.....N.....DGR..T.V...NLLQ..ADGTVPM..V.......YQ............D...VT....Y.N...........IPVIIWLMESYPR...........................HSP..L..V..F..V.NPTRDM..............IIK...R.PH..qFVN.P..S....GVV....SI..P...........Y.L..Q..N.WIY.........PSSN...............LVEL.ARNLSH.......FFGRDPPL................................................................
A0A7H9AY83_ZYGMR/35-150                ........................................................TFHDSVAVLSRFD.......QF.RPR.TR..V.F..................T...........N.....E.....NGI..S.E...LLLC..IYGTLQ-..-.......--............-...DI....L.P...........VPLLLWIPRSYPL...........................VHP..L..I..Y..L.DLEQLEd............sRPS...V.GD...YVN.P..N....GLI....SL..P...........I.F..S..R.WSA.........DTNN...............ILQV.IQEAAG.......IC------qync............................................................
K0KE88_WICCF/18-145                    ........................................................TYHDVATTLQSYP.......TL.KPR.TR..V.Y..................T...........S.....E.....TGE..S.Q...LLLC..LYGSIPS..P.......IG............G...KI....Y.K...........IPIELWVPHEYPL...........................MAP..F..V..Y..V.VPTEKM..............ILQ...P.GN...HVD.N..S....GRC....YL..P...........Y.L..A..N.WGS.........NNNEdnn........gqstIVKL.CEHLSK.......IFGLEPPV................................................................
A0A5G2R2A4_PIG/36-119                  ....................................................rysm-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......TY............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIT.......KFQEELPL................................................................
A0A670XNM7_PSETE/21-141                .......................................................a-VQETVNVTGQYK.......DL.KPV.MD..N.Y..................V...........F.....N.....DGS..S.R...ELMS..LTGTIPV..N.......YR............G...NI....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GRI....YL..P...........Y.L..H..E.WKH.........PQSD...............LIGL.IQVMIV.......VFGEEPPV................................................................
A0A2K6CCQ9_MACNE/21-141                ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A369JIJ8_HYPMA/22-144                ........................................................VYADIDAVLDRFP.......TL.RPK.SD..V.Y..................T...........Y.....D.....DGR..T.Q...LLLC..VHGLLPI..S.......FR............N...AS....Y.N...........IPIAVWLTREYPR...........................QPP..I..A..Y..V.VPTNDM..............LVK...A.GK...YVD.V..S....GRC....EI..E...........F.L..Q..H.WARk.......sEGCS...............LASL.LEAMQD.......QFSKEPPV................................................................
A0A1Y1XFD7_9FUNG/6-101                 ....................................................gcfy-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...NLLG..MTGVIPV..T.......YR............N...VT....Y.N...........IPIGVWVMFDYPI...........................TPP..E..F..I..V.MPTENM..............KIV...V.GK...HVT.S..E....GKI....TH..P...........Y.L..D..T.FSS........kPQNS...............MLEF.ISILRK.......IFSTETPV................................................................
A0A6P7MQ90_BETSP/21-141                ......................................................ai--DELQKVSRIFS.......DM.KPS.TG..T.Y..................T...........F.....S.....DSS..Q.K...DLLK..VIGNIPV..K.......YE............G...RS....Y.N...........FPIQLWLTDSFPF...........................SPP..I..C..L..L.RPTPSM..............VIR...E.GK...HVD.A..Q....GRI....HL..P...........G.L..H..S.WDY.........PKSS...............VVGL.LNEMIA.......KFEEDPPL................................................................
A0A6J3EQ96_SAPAP/20-140                ........................................................TVEELKNVNMFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A2I1BTR6_ASPN1/48-170                ........................................................TYYHVANVLAQYP.......SL.SPR.TD..V.Y..................T...........Y.....E.....TGF..S.A...LLLQ..LTGTIPV..S.......FR............G...TV....Y.K...........FPIALWIPNTYPR...........................EPP..M..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wDRSN...............LVDF.LMILRE.......VFAKEPPV................................................................
A0A2I2F2G2_9EURO/33-155                ........................................................TYYDVANVLAQYP.......SL.SPR.TD..V.Y..................T...........F.....E.....SGF..S.A...LLLQ..LSGTVPV..T.......FR............G...TI....Y.K...........FPISLWVPSTYPH...........................EPP..I..V..Y..V.TPTQDM..............VVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WADa.......wERSS...............LSDL.VSILRE.......VFAKEPPV................................................................
A0A6P6ESW6_OCTDE/21-141                ........................................................TVEELKNVNTFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NV....Y.N...........IPVRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIT...V.GK...HVD.V..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A5N5L997_9PEZI/25-147                ........................................................TYNDVAQALSQYP.......SL.SPR.TD..V.H..................T...........F.....P.....NGT..S.A...LLLH..LTGTIPV..L.......FR............G...TT....Y.R...........FPISLWVPHAYPR...........................EAP..L..V..Y..V.TPTETM..............VVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..V..G.WTTf.......wDKST...............ILDF.LAILRD.......IFAKEPPV................................................................
A0A226P3E7_COLVI/39-119                .....................................................mds-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......-Y............G...NI....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFAEEPPV................................................................
A0A455C860_PHYMC/1-47                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.-----M..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A5E4Q5Y0_9NEOP/21-141                .......................................................t-CKEVAGLIQVYR.......GL.NYR.LE..G.F..................V...........F.....N.....NGT..R.K...ELLN..LEGTIPV..N.......YK............G...TM....Y.N...........IPVCIWLVDTHPQ...........................HAP..L..C..F..V.KPTPDM..............SIK...V.SK...YVD.S..N....GKV....YL..P...........Y.L..H..E.WNA.........NGST...............LLKL.VQCMIS.......AFGELPPV................................................................
A0A060S7W7_PYCCI/25-147                ........................................................VYAHADAALSRHP.......TI.RPK.TD..V.Y..................T...........Y.....D.....DGR..T.Q...LLLC..LHGLLPI..S.......FR............A...AS....Y.N...........IPIAVWVPREYPR...........................SPP..I..A..Y..V.VPTSDM..............LVR...P.GP...DTD.T..S....GRC....LI..E...........Y.L..R..N.WERk.......cEGCD...............LVAL.LDAMKE.......AFSRQPPV................................................................
A0A367K3I2_RHIAZ/19-140                ........................................................TFHDVDAVLQTYV.......SL.KPK.MD..T.Y..................T...........S.....N.....DGH..T.Q...LLLC..LHGTIPI..T.......YR............S...IP....Y.N...........IPVAFWVPKEYPS...........................TSP..I..P..Y..V.KPTANM..............LIR...E.GR...HVD.K..S....GLC....YH..Q...........Y.R..S..S.WSN........dQKHN...............LLEL.IAILQQ.......VFAQEPPV................................................................
A0A2Y9D851_TRIMA/21-141                ........................................................TVEELKNVNMFYP.......HF.RYS.VD..T.Y..................I...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A0V0U1W2_9BILA/36-119                ....................................................ivrk-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......FY............G...KT....Y.N...........IPICIYLLKNYPH...........................VPP..I..C..F..V.RPTASM..............IVK...P.SS...NVD.S..N....GKI....NV..P...........Y.L..T..E.WHQ.........SKSD...............LLGL.LQVLAI.......VFGESCPV................................................................
A0A1E3P650_WICAA/1-89                  ........................................................--------LQSYP.......SL.KPR.TR..V.Y..................T...........S.....E.....TGE..S.Q...LLLC..LYGSLPS..P.......IG............G...RV....Y.K...........IPIELWIPHEYPI...........................AAP..F..V..Y..V.VPTEKM..............TLQ...P.GN...HVD.N..S....GRC....YS..P...........Y.L..A..N.W--.........----...............----.------.......--------................................................................
A0A1S8BK57_9PEZI/26-148                .......................................................a-YNDAAEALAQYP.......SL.SPR.TD..V.Y..................T...........Y.....E.....NGV..P.A...LMLL..LSGTLPV..Q.......FR............G...AI....Y.R...........FPIALWVPHDYPH...........................EPP..M..V..Y..V.TPTQDM..............LVR...P.GQ...HVS.G..E....GRV....YH..P...........Y.L..S..G.WASy.......wDKSS...............MSDF.LTVLRG.......VFAKEPPV................................................................
A0A6J8CH56_MYTCO/21-141                .......................................................a-KKDILGVFSQYK.......DL.RPT.HG..P.F..................I...........F.....N.....DGS..Q.K...DLVN..LDGTIPV..N.......YR............G...NI....Y.N...........IPIGIFILDTHPY...........................NPP..I..C..Y..V.KPTNTM..............QIK...Q.GT...NVD.A..N....GKV....DL..P...........Y.L..R..D.WRY.........PQSD...............LLGL.IQILVI.......VFSEEPPV................................................................
A0A195AWK8_9HYME/25-145                ........................................................TKKHVINVLNTYK.......GL.VYK.IE..P.F..................V...........F.....N.....DGS..R.K...ELLN..LQGTIPV..V.......YK............G...SC....Y.N...........IPICIWLMDTHPN...........................NAP..M..C..Y..V.KPTADM..............HIK...V.SM...FVD.H..N....GKI....YL..P...........Y.L..H..D.WVP.........HNSD...............LLAL.IQVMIV.......TFGEQPPV................................................................
A0A183NJG5_9TREM/39-105                .....................................................fed-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........--------FTYPH...........................KSP..M..V..Y..V.RPTNTM..............QIK...P.SD...FVD.S..A....GLV....QL..P...........Y.M..T..D.WKH.........PDAD...............LVEL.ISVLQA.......VFGETSPV................................................................
A0A094D030_9PEZI/26-148                ........................................................TYNDVAQALSHYS.......SL.SPK.TE..V.Y..................T...........Y.....E.....NGV..S.E...LLLQ..LSGTLPV..A.......FR............G...TT....Y.R...........FPVTVWIPHQYPR...........................AEP..V..V..Y..V.SPAEGM..............MVR...A.GQ...HVD.P..Q....GRV....YH..P...........Y.L..A..G.WAEf.......hDKSN...............ILDF.LAILRD.......VFAKEPPV................................................................
A0A132AIN5_SARSC/13-133                .......................................................a-KKDIGDVLQQYR.......NL.HAS.IE..K.C..................T...........L.....P.....TGV..Q.R...ELVV..LKGTIPV..T.......FK............K...IV....Y.N...........IPISIWILGNHPE...........................SAP..Y..C..W..V.NPTKDM..............AIK...V.SQ...HVD.N..F....GRV....YL..P...........Y.L..S..N.WTS.........QTSD...............LLGV.IQVMII.......LFGENPPL................................................................
A0A423VXB7_9PEZI/25-147                ........................................................TYNDVAQALSQYP.......SL.SPR.TD..V.H..................T...........F.....P.....NGS..S.A...LLLH..IAGTIPV..N.......FR............G...TT....Y.R...........FPVSIWIPHAYPR...........................EPP..L..V..Y..V.TPTETM..............VVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..V..G.WADf.......wDKSN...............LLDF.LAIMRD.......IFAKEPPV................................................................
H3CMA3_TETNG/22-142                    ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTIPI..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPF...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A6P6KFB1_CARAU/23-143                .......................................................t-ARDITTVASHYK.......DL.KPV.MD..N.Y..................V...........F.....N.....DGS..T.K...ELLS..LTGTVPV..S.......FR............G...NV....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKP.........LQSD...............LLGL.IQVMIV.......VFGEEPPV................................................................
A0A1U7LNE6_NEOID/25-128                .......................................................t-QTDVINCLSKYP.......SL.APR.TD..I.F..................T...........Y.....E.....DGQ..S.V...LLLC..LEGIIPI..V.......FR............D...RP....Y.N...........IPIAIWIPHCYPK...........................FPP..I..S..F..V.LPSKNM..............LIR...P.GN...HVD.S..S....GRI....YH..P...........Y.L..A..Y.WED.........N---...............----.------.......--------psvs............................................................
G4UXI3_NEUT9/25-147                    ........................................................TYNDVAQVLSHYP.......SL.SPR.TD..V.H..................T...........F.....P.....NGA..S.A...LLVH..LSGTLPV..V.......FR............G...TT....Y.R...........FPISVWVPQAYPR...........................EAP..L..V..Y..V.TPTEHI..............MVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..A..G.WSTy.......wDKST...............ILDF.LAILRD.......VFAKEPPV................................................................
A0A218YS03_9HELO/26-148                ........................................................TYNDVAQTLSHYS.......SL.SPR.TD..V.Y..................T...........Y.....E.....NGK..S.A...LLLH..ISGTLPV..V.......FR............G...TT....Y.R...........FPIALWIPHGYPL...........................EAP..L..V..Y..V.TPTESM..............MVR...P.GQ...HVD.P..Q....GKV....YH..P...........Y.L..V..G.WAEf.......wDKST...............ILNF.LSILRE.......VFSNEPPV................................................................
G0SXL9_RHOT2/437-560                   .....................................................aaa---QALAVLAAYP......gLL.NPE.QS..D.F..................T...........Y.....D.....DGR..V.E...LLLS..LTGVLPV..P.......IG............P...NT....Y.H...........CPIAIWLPLDFPA...........................KPP..T..V..F..V.LPSETL..............AIR...K.GK...NVD.A..S....GKV....GV..P...........Y.L..D..Y.WARk.......aEGCS...............LTGL.IEDLIP.......VFSARYPV................................................................
A0A3Q1FUS1_9TELE/21-141                ........................................................VTHDIHVALTYFK.......NL.VPV.MD..R.F..................V...........Y.....N.....DGK..T.K...DLMS..LTGTIPT..M.......FS............G...KT....Y.N...........IPICLWIEETYPQ...........................TAP..I..C..Y..V.KPTREM..............MVV...T.GS...YIS.S..N....GEI....LL..P...........Y.L..Q..H.WNK.........DECD...............IVSL.LQVMVA.......MFGETPPL................................................................
A0A0V1DHC5_TRIBR/24-144                .......................................................t-KEEIMEALSQFH.......DL.IVR.KD..F.Y..................V...........G.....N.....DGV..R.E...LAIC..FCGTIPV..N.......YM............G...KT....Y.N...........IPICIYLLKNYPH...........................VPP..I..C..F..V.RPTASM..............IVK...P.SS...NVD.S..N....GKI....NV..P...........Y.L..T..E.WHQ.........SKSD...............LLGL.LQVLAI.......VFGESCPV................................................................
A0A1S3XQZ1_TOBAC/45-166                .......................................................i-RQHLVSLTDTCP.......SL.QPK.TA..T.F..................T...........H.....N.....DGR..T.V...NLLQ..SDGTVPM..V.......YQ............G...VT....Y.N...........IPVIIWLMESYPR...........................HAP..L..V..F..V.NPTRDM..............IIK...R.QH..pFVN.P..S....GIV....SI..P...........Y.L..S..N.WVY.........PSSN...............LVDL.AGNLSH.......FFSRDPPL................................................................
A0A6I8W2F3_DROPS/22-142                ........................................................TKKDVIDVVTTYR.......SL.TYD.LQ..K.F..................V...........F.....N.....DGS..Y.K...DLFT..LQGTIPV..V.......YK............N...NT....Y.Y...........IPICIWLMDTHPQ...........................NAP..M..C..F..V.KPTPNM..............HIK...V.SM...YVD.H..N....GKV....YL..P...........Y.L..H..D.WQP.........NSSD...............LLSL.IQVMIV.......TFGDHPPV................................................................
A0A397HZN3_9GLOM/31-154                ........................................................VFRDVDACLGVFK.......AL.TPQ.TD..T.Y..................T...........Y.....D.....DGK..S.K...VLLC..LHGTIPI..T.......YQ............S...TL....Y.N...........IPVDFWIPTEYPK...........................VPP..I..A..F..V.VPTSSM..............LVK...P.SR...NVD.V..S....GRC....YH..P...........Y.L..H..H.WSTq......pnDESN...............LITI.CTIFQT.......IFGQNPPV................................................................
A0A162VJA9_DIDRA/25-147                ........................................................TYHDATEALAQYP.......SL.AVR.TD..V.Y..................T...........Y.....E.....NGA..S.H...LLLN..LSGTLPV..T.......FR............G...AT....Y.G...........FPVAVWLPYAYPR...........................ESP..I..V..Y..V.KPDKDM..............LVR...P.GQ...HVS.G..D....GRV....YH..P...........Y.L..A..Q.WAKy.......wDKST...............LFNF.LALLRA.......VFAKEPPV................................................................
A0A484BY26_DRONA/22-142                ........................................................TRKDVVDVITAYR.......SL.TYN.LE..K.F..................V...........F.....N.....DGS..V.K...DLFA..LQGTIPV..V.......YK............N...NT....Y.Y...........IPICIWLMDTHPQ...........................NAP..M..C..F..V.KPTPTM..............QIK...V.SM...YVD.H..N....GKV....YL..P...........Y.L..H..D.WQP.........HSSD...............LLSL.IQVMIV.......TFGDHPPV................................................................
A0A167VMN4_9EURO/39-167                ........................................................TYSDVVNVLSHNP.......GF.SVR.TD..V.Y..................T...........Y.....E.....NGS..F.A...LLCC..LSGTLPV..S.......FR............G...AI....Y.H...........FPITLWFPLKYPR...........................EAP..I..A..Y..V.TPPPPRpqdn.....apvvtVIR...P.GQ...HVS.V..E....GKI....YH..P...........F.L..A..A.WSE.........-GSS...............IADL.LAILRD.......IFSKEPPV................................................................
A0A1Y1K7W7_PHOPY/22-142                ......................................................vl--REILTITGSYQ.......GL.FPQ.LD..T.Y..................T...........F.....N.....DGT..P.M...ELVH..LKGTIPV..R.......YK............S...NV....Y.N...........IPICIWIMDTHPN...........................NAP..I..C..Y..V.KPTPDM..............SIK...V.SM...YVD.Q..N....GKI....YL..P...........Y.L..H..E.WDL.........NSSD...............VLGL.IQVMMV.......TFGEQPPV................................................................
A0A2R9AQ37_PANPA/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A2H3C8A7_9AGAR/23-145                ........................................................VYSDTDAALSRYP.......SL.RPK.SD..V.Y..................T...........Y.....D.....DGR..T.Q...LLLC..LHGLIPI..S.......YR............G...AS....Y.N...........IPVAIWLTRDYPA...........................QPP..I..V..Y..V.VPTSDM..............LVK...A.GK...CID.V..S....GRC....NI..E...........Y.T..Q..N.WSRk.......sEGCS...............LSGL.VESLQD.......YFSREPPV................................................................
A0A3Q7JGU6_SOLLC/35-156                .......................................................i-RQHLLSLIDMYP.......SL.QPK.TA..S.F..................T...........H.....N.....DGR..T.V...NLLQ..AVGTVPM..V.......YL............D...RT....Y.N...........IPVIIWLMESYPR...........................HPP..L..V..F..V.NPTRDM..............VIK...K.PH..pFVN.P..S....GIV....SI..P...........Y.L..Q..N.WIY.........PSSN...............LVEL.VRNLSH.......FFGRDPPL................................................................
A0A6J1SVM2_FRAOC/23-144                .......................................................t-SRDVLNTVTQFR.......GL.SHQ.IE..P.F..................V...........F.....N.....DGK..E.K...QLCK..LHGTIPV..P.......YK............G...QN....Y.N...........IPVCIWIMDTHPN...........................NAP..L..C..Y..V.KPTSDM..............VLK...I.SR...STD.H..S....GKI....YL..P...........Q.L..H..L.WDP.........RQPN..............lLPNL.VQAMIS.......AFSVEPPV................................................................
A0A1L9WGR2_ASPA1/33-155                ........................................................TYHDVANALAQYP.......SI.APR.TE..V.Y..................T...........Y.....E.....TGF..S.A...LLLQ..LSGTLPV..S.......FR............G...TV....Y.R...........FPVTLWIPNTYPR...........................EPP..M..V..Y..V.TPTQDM..............AVR...V.GQ...HVT.L..E....GRV....YH..H...........Y.L..A..H.WAEa.......wERSS...............LVDF.LLILRE.......VFAKEPPV................................................................
A0A3P7EAM7_WUCBA/28-107                ......................................................ak--IDILSALSGFP.......DL.TPN.VE..D.F..................I...........Y.....P.....NKT..C.T...LAFC..LKGTIPV..F.......YK............G...KT....Y.N...........IPVALYLWDTHPY...........................YAP..I..C..Y..V.CPTPNM..............VLK...E.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------s...............................................................
A0A7F8PWG2_LEPWE/23-143                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A669QYB9_PHACC/21-140                ........................................................TVEEVTAVSRAHP.......NF.CFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIA...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............IIGL.IKEMIA.......KFEEELPL................................................................
A0A6J2AG91_ACIJB/21-141                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YK............G...NI....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A1W0X4Y2_HYPDU/11-92                 .....................................................mrl-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......FP............G...AS....Y.N...........IPVEIWIMDSHPY...........................NPP..L..C..Y..V.KPTADM..............KIK...H.NR...HVD.Q..N....GRV....YL..P...........Y.L..T..D.WNH.........NSSD...............LLEC.CQIMAL.......MFGEEPPV................................................................
A0A673BN40_9TELE/22-138                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................G...........I.....V.....N-N..A.C...VLFK..LSFWFIV..C.......NV............-...--....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
S0E9D2_GIBF5/25-147                    .......................................................a-YNDVAQALDRFP.......SL.SPR.TD..V.H..................T...........F.....S.....NGA..N.A...LLLH..LSGTLPV..N.......FR............G...TT....Y.R...........FPISIWVPHAYPR...........................EPP..M..I..Y..V.VPTETM..............MIR...P.GQ...HID.P..Q....GLV....YH..P...........Y.L..V..G.WAEf.......wDKSN...............LRDF.LNILTD.......IFAKEPPV................................................................
A0A1D2MHL2_ORCCI/23-153                .....................................................tel---DVLEVIHKY-.......GL.TPR.QD..S.Y..................V...........Vp..neE.....AGE..G.R...TLLN..LTGTIPI..K.......RN...........aG...KKfeqlE.E...........VSVVIWLMETYPL...........................SAP..V..V..F..V.EPRAHN.............gIIK...I.GR...YVN.E..F....GEV....AL..P...........Y.L..N..R.WTAa.......ePGFN...............LCAL.IQCLTV.......AFYTELPV................................................................
A0A3B3IPA0_ORYLA/22-142                ........................................................TVREITYVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTVPV..S.......YR............G...NT....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LIGL.IQVMIV.......VFGEEPPV................................................................
A0A671XVE8_SPAAU/21-141                .......................................................a-IEELQKIHRIFP.......GM.TPS.TG..T.Y..................T...........F.....T.....DSS..Q.K...DLLK..LIGNLPV..K.......YG............G...RS....Y.N...........IPILLWLMDSFPF...........................TPP..I..C..L..L.RPTANM..............VIR...E.GK...HVD.A..Q....GRL....HL..P...........G.L..R..S.WDY.........PKSS...............VVGL.LNEMIA.......QFEEEPPL................................................................
K1WUH6_MARBU/26-148                    ........................................................TYTDVAQTLSHYS.......SL.SPR.TD..V.Y..................T...........Y.....E.....NGK..P.A...LLLH..ISGTLPV..V.......FR............G...TT....Y.R...........FPVAIWVPHAYPM...........................EPP..L..V..Y..A.APTDGM..............MVR...P.GQ...HVD.S..Q....GKV....YH..P...........Y.L..V..G.WAEf.......wDKSN...............ILDF.MAILRE.......IFAKEPPV................................................................
A0A674DD49_SALTR/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..T.R...TLVS..LTGTVPV..S.......YR............G...NI....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A3Q2DXC9_CYPVA/21-141                .......................................................v-AHQVFIAITYFK.......DL.VPA.VE..E.F..................V...........Y.....R.....DGS..R.K...NLLN..LTGIIPV..V.......YK............D...KT....Y.N...........IPICVWIEPNYPN...........................VAP..M..C..F..V.KPTHEM..............IIV...K.GK...YIS.S..D....GKV....RM..P...........Y.L..K..D.WKK.........GEGD...............LFSL.LQVMVA.......VFGEFPPL................................................................
A0A667X0Q7_9TELE/22-142                ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A6J2WRP0_CHACN/22-142                ........................................................TVREITNVVSQYK.......DL.KPM.MD..A.Y..................V...........F.....N.....DGS..S.R...ELMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
F5H442_HUMAN/21-141                    .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
F4Q6S1_CAVFA/26-145                    .......................................................v-KNDTTEVFRFFP.......NL.QPC.CA..P.Y..................N...........-.....R.....GGH..M.V...TLIY..LKGTIPI..V.......YQ............N...VT....Y.Y...........IPVVVWIPETYPY...........................VPP..V..V..M..L.DPTPEM..............EIV...K.NH..pQVS.D..N....GMC....HH..Q...........Y.L..S..S.WTW.........-QSN...............ISQA.VKYLCD.......VYSGYPP-l...............................................................
A0A2K6RHM5_RHIRO/14-134                ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSYPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A2R8MAN8_CALJA/69-189                ........................................................TVEELKNVNMFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...NLLN..FAGTIPV..I.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
M2WWG6_GALSU/32-153                    ........................................................IIQDCQEALRQCP.......SL.VAR.VD..T.L..................T...........H.....N.....NGF..V.S...RLIC..LGGTVAV..R.......YK............G...NG....Y.N...........IPVDIWIPEPYPS...........................YPP..L..V..Y..V.TPTPNM..............YIP...S.DH..pYVD.T..S....GLV....NL..T...........Y.L..A..K.WDP.........SSYS...............IAGL.IGVLVS.......IFSSKPPV................................................................
A0A2K6NCD3_RHIRO/12-132                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
Q6FS29_CANGA/27-147                    ........................................................VFHDAVQTLTEFK.......NL.RPR.TR..V.F..................T...........D.....E.....DGS..P.R...LLLC..LYGGIPI..E.......QG............-...--....L.D...........VPVLIWIPESYPI...........................AKP..L..L..F..I.DLELLDk...........dlQLA...T.NE...SVE.P..D....GRV....HT..R...........L.L..R..Q.WNP.........QSAN...............LFNV.IQDLAD.......MCNAIAPI................................................................
A0A0D3FCI7_9ORYZ/45-133                .......................................................i-RNHLVALADAFP.......SL.HPK.AA..L.F..................T...........H.....N.....DGR..A.A...HLLQ..ADGTIPI..H.......HA............G...AS....Y.N...........LPAVLWLPEPYPR...........................SPP..L..V..F..L.SPTRDM..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------laarppptedpaev..................................................
A0A5E4G941_PRUDU/41-92                 ......................................................il--NHLIFLTTANL.......SL.DPK.TA..T.F..................T...........H.....N.....NGC..S.V...NLL-..-KGTIPM..S.......FH............G...VT....Y.N...........ILVII--------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------................................................................
F0ZTJ6_DICPU/42-159                    .......................................................v-AKDLKETFHLFP.......NL.SPY.YE..-.-..................-...........N.....I.....PSR..N.I...NLIN..IKGTIPI..C.......FK............N...IN....Y.Y...........LPIIVWVPLNYPL...........................EYP..T..I..F..L.DPTPEM..............RIV...E.SH..qHAN.L..Q....GLV....YH..P...........Y.I..S..S.WNS.........-AST...............LGQC.LKLLCD.......AFSFKPPL................................................................
A0A2J6KTJ6_LACSA/33-154                .......................................................i-RKHLLSLHIEFS.......SL.SPS.VA..M.F..................T...........H.....N.....DGT..M.V...NLLK..AEGYLHI..S.......QY............-...-L....P.S...........IHVSIWIHEHYPH...........................KPP..I..V..Q..V.TSKSNPt............yPIR...P.NH..pFVD.P..S....GVT....TS..S...........Y.L..H..T.WGP.........FGHD...............LLGL.AYSLVK.......IFSLDHP-f...............................................................
B9GXA7_POPTR/38-159                    .......................................................i-RQHLLSLTTTSP.......SL.EPK.TA..T.F..................T...........H.....N.....DGR..T.V...NLLQ..ADGTVPI..T.......FI............S...VT....Y.N...........IPVIIWLFESYPR...........................HPP..C..V..Y..V.NPTRDM..............IIK...R.SH..pFVN.P..S....GLV....SI..P...........Y.L..Q..N.WIY.........PSSN...............LVDL.ARELSS.......VFGRDPPL................................................................
A0A2B4RII4_STYPI/20-140                .......................................................c-IQDVEQVLKYFH.......GL.RPG.MQ..E.Y..................T...........Y.....E.....HGR..Q.A...ELFA..LEGTIPI..K.......FR............D...VT....Y.N...........IPVCVLLQEGHPE...........................VVP..L..V..Y..V.RPTRSM..............VIK...A.SP...YVD.R..N....GKV....DH..P...........Y.L..H..K.WNY.........KSSN...............INTL.LQELCK.......IFAQRPPV................................................................
A2EN70_TRIVA/20-134                    ....................................................ghyn---NLVYLVQAYR.......SL.QF-.--..-.F..................R...........-.....N.....NNN..P.A...QPL-..IQGFVII..Y.......IQ............G...QP....C.P...........LPINMMLSQNFPT...........................TPP..I..C..Q..L.PIPPSI..............QVP...P.SA...FIN.P..Q....RCV....IP..D...........A.I..M..R.WEP.........-RTP...............LVNY.MHRLRE.......VLSANPP-f...............................................................
A0A1V4JNQ3_PATFA/36-119                ......................................................tf-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-----SM..N.......TY............S...NS....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VIGL.IKEMIA.......KFEEELPL................................................................
A0A2B7YG57_9EURO/33-155                ........................................................TYNDVANLLAQYQ.......SF.SPR.TE..V.Y..................T...........Y.....E.....NGT..S.A...LLLQ..IPGTLPV..T.......FR............G...VV....Y.G...........FPITLWMPYSYPR...........................EPP..T..V..Y..V.TPTQGM..............LVR...P.GQ...HVS.G..E....GRV....YH..H...........Y.L..A..H.WADa.......wDRST...............LVDL.MSILRE.......VFAKEPPV................................................................
A0A671Y0A4_SPAAU/22-142                ........................................................TVREITNVISQYK.......DL.KPL.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NI....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A1Y2GPV8_9FUNG/24-146                .......................................................m-YADVEAVLRRFQ.......NFlVPH.AD..T.Y..................T...........H.....D.....NGR..S.Q...LLLS..LVGTIPI..V.......YQ............S...AT....Y.N...........IPVAFWLPTSYPS...........................VAP..I..V..F..V.TPTALM..............LVR...A.GK...HVD.I..S....GRC....YH..P...........Y.L..A..Y.WSN........kSDSN...............LVEL.IGIMQK.......VFSLDPPV................................................................
Q4E187_TRYCC/77-161                    .................................................eqapphr-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....Y.V...........LPLQIWLTRLYPI...........................EPP..L..V..F..L.LSAEQG.............cRIA...S.NH..kYVD.A..T....GRC....HT..P...........E.L..A..A.WHP.........VSSS...............LCDV.VKKLCQ.......LLS-----aeglipl.........................................................
A0A420YFZ0_9PEZI/27-149                ........................................................TYNDVAQALSQYP.......SL.SPK.TD..V.Y..................T...........F.....P.....NGT..S.A...LLLN..LSGTIPV..L.......FR............G...TT....Y.R...........FPISLWVPHAYPR...........................EAP..L..V..Y..V.TPNDTM..............VVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..V..G.WATf.......wDKST...............ILDF.LAILRD.......VFAKEPPV................................................................
A0A200PVL3_9MAGN/41-162                .......................................................i-RQHLLTLIDVYP.......SL.QPK.TA..T.F..................N...........H.....T.....DGR..T.V...NLLQ..ADGTIPM..F.......YQ............N...VT....Y.N...........IPIVIWLMETYPR...........................HPP..C..I..Y..V.APTRDM..............IIK...R.PH..pHVN.P..S....GLV....SI..P...........Y.L..H..N.WIY.........PSSN...............LVDL.IRELSH.......LFGRDPPL................................................................
A0A4Z1HLN6_9HELO/26-148                ........................................................TYNDVAQTLSQYT.......SL.SPR.TD..V.Y..................T...........Y.....E.....NGA..S.S...LLLH..LSGTLPV..N.......FR............G...TT....Y.R...........FPIALWIPHAYPH...........................EAP..L..V..Y..V.TPVEGM..............VVR...A.GQ...HVD.P..Q....GKV....YH..P...........Y.L..M..K.WPDy.......wDKSN...............VLDF.LAILRD.......VFAKEPPV................................................................
A9TJ74_PHYPA/39-160                    .......................................................i-REHLLKVLQEFP.......GL.QVK.SA..V.F..................N...........H.....N.....DGR..T.L...NLLQ..AEGTIPM..F.......YQ............D...VK....Y.N...........IPINIWLLETYPR...........................QPP..L..I..Y..V.KPTRDM..............VIT...Q.RH..pNVD.G..S....GMV....NC..Q...........Y.L..Q..Q.WVF.........PRSN...............LVEL.VQSLSL.......LFGQKPPL................................................................
A0A2K6CCQ0_MACNE/16-136                ........................................................TVEELKNVNVFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............EIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A2S4L8S4_9HYPO/25-147                ........................................................TYNDVARALSRFS.......TL.APR.TD..V.H..................T...........F.....P.....NGT..S.A...LLLH..ISGTLPV..V.......FR............G...ST....Y.R...........FPLSIWVPHAYPR...........................EPP..L..V..Y..V.TPTETM..............VVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..V..R.WSEf.......wDKST...............LEDF.INVLSD.......VFAKEPPV................................................................
M2PPT3_CERS8/25-147                    ........................................................VFAHVDAVLVRFT.......TI.RPK.TD..V.Y..................T...........Y.....D.....DGR..T.Q...LLLC..LHGLLPI..H.......FR............G...AA....Y.N...........IPIAVWLTRDYPR...........................EPP..I..V..Y..V.VPTNDM..............LVR...P.SK...NVD.V..S....GRC....QI..D...........Y.I..R..D.WERk.......sEGCS...............LVAL.LEALQD.......VFSREPPV................................................................
A8XL86_CAEBR/22-132                    .......................................................a-KKDVVGALSQFK.......DL.AAG.TD..T.F..................M...........F.....P.....DGK..R.R...TAFR..LKGTIPV..Y.......YK............G...AC....Y.N...........IPVTVFLWDTHPY...........................YAP..I..C..Y..V.NPTATM..............VIK...E.SE...HVN.K..E....GKV....FL..P...........Y.L..N..E.WRF.........PGYD...............LSGL.LQ----.......--------is..............................................................
A0A2H3DSH6_ARMGA/23-145                ........................................................VYSDTDAALSRYP.......SL.RPK.SD..V.Y..................T...........Y.....D.....DGR..T.Q...LLLC..LHGLVPI..S.......YR............G...AS....Y.N...........IPVAIWLTRDYPA...........................QPP..I..V..Y..V.VPTSDM..............LVK...A.GK...YID.V..S....GRC....NI..E...........Y.T..Q..N.WSRk.......sEGCS...............LSGL.VESLQD.......YFSREPPV................................................................
A0A673JWU0_9TELE/23-143                .......................................................t-SRDITSVASHYT.......DL.KPV.MD..N.Y..................V...........F.....N.....DGS..T.K...ELLS..LTGTVPV..N.......YR............G...NV....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKP.........PQSE...............LLGL.IQVMIV.......VFGEEPPV................................................................
A0A6A3AMG2_HIBSY/4-124                 ...................................................tktpl------SLLQEFP.......GF.EPS.TD..R.Y..................M...........H.....N.....DGT..Q.V...HLLR..ATGFIHV..S.......ND............-...ST....P.P...........VPLVIWLHENYPQ...........................RAP..L..V..F..V.SIDPMT..............PIH...R.HH..pFIDnT..T....GAA....SP..P...........Y.L..I..T.WKY.........PSCN...............LTGL.LRNLVH.......LFSIDHP-f...............................................................
A0A6P4XWN7_BRABE/23-143                .......................................................t-KREVLQVFTSYS.......DL.KPN.LQ..P.H..................I...........F.....N.....DGS..R.K...DLLT..LEGTIPV..Q.......YR............G...TT....Y.N...........IPVCMYLMETHPF...........................NPP..L..C..Y..V.RPTATM..............EIK...T.GK...HVD.S..S....GRV....YL..P...........Y.L..H..E.WKH.........PKSD...............LIGL.IEVMRI.......VFGEEPPV................................................................
B5YNX5_THAPS/27-150                    ...........................................lrdaetllnsplg------------H.......HL.RPT.TE..P.L..................M...........L.....N.....DGT..S.T..pPVLM..LSGTLPM..T.......YR............G...VT....Y.N...........LPIDMYLPPPYPL...........................RPP..T..V..F..V.RPVASM..............AIK...E.NH..rHVG.L..D....GKV....YL..P...........Y.L..H..E.WRP.........QSHD...............LREL.AVWMSS.......TFGDEPP-c...............................................................
A0A6J0CX61_PERMB/21-141                .......................................................t-VRQTVSVIAMYK.......DL.KPV.LD..S.Y..................V...........F.....S.....DGS..S.R...ELVN..LTGTIPV..R.......YR............G...NT....Y.N...........IAICLWLLDTYPY...........................NPP..V..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..D.WKH.........PRSE...............LLEL.IQIMIV.......IFGGEPPV................................................................
K7F3W1_PELSI/1-103                     ........................................................-------------.......--.---.MD..T.Y..................T...........F.....K.....DGS..L.K...DLLN..FSGTIPV..K.......YQ............G...NS....Y.N...........IPICLWILDSHPF...........................APP..I..C..F..L.KPTMNM..............EIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKSI...............IVGL.IKEMIE.......KFEEELPL................................................................
W2Y3L1_PHYPR/25-145                    ......................................................vr--GDVYNLLGQIP.......SL.QPN.CG..T.F..................A...........H.....N.....DGT..T.S...TLLN..LEGTIPI..F.......YR............G...NQ....Y.N...........IPVEFWVVEAYPM...........................SPP..V..C..F..V.RPTADM..............MVK...P.GH..pHVT.S..D....GYV....KI..P...........Y.T..S..D.WRP.........-DFT...............MLEL.VAHMCS.......IFGNMPPV................................................................
A0A4D9EKQ4_9SAUR/21-141                ........................................................TVQETTSVITQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LIGL.IQIMIV.......VFGEEPPV................................................................
A0A673UMM8_SURSU/21-81                 ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...VS....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------dinsknwanhehkt..................................................
A0A093RH68_PYGAD/8-128                 ........................................................TVQETTSVITQYK.......DL.KPV.MD..S.Y..................V...........F.....N.....DGS..S.R...ELMS..LSGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPF...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKY.........PQSD...............LLEL.IQVMIV.......VFGEEPPV................................................................
G3BDK1_CANTC/32-171                    ........................................................TYTHIIQFLQLYFe.....tGF.RIR.TR..V.Y..................T...........A....eK.....TGS..S.N...LLIN..LFGKI--..-.......--............-...-N....G.Y...........IPIEIWIPLSYPFnatsa................pdeasgGIP..I..V..Y..A.VPNNADg............vFLK...P.GN...FID.S..Q....GKF....YH..P...........F.L..S..Q.WFN.........QCKQedvni.....lrtynLVNL.VRLLND.......AFLIEPPI................................................................
A0A671REW0_9TELE/1-103                 ........................................................-------------.......--.---.MD..A.Y..................V...........F.....N.....DGL..S.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A6J3EVP7_SAPAP/64-184                ........................................................TVEELKNVNMFFP.......HF.KYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A5J9WMW9_9POAL/42-164                .......................................................i-RNHLVALAEAFP.......SL.HPK.AA..L.F..................T...........H.....N.....DGR..A.A...HLLQ..ADGTIPI..H.......HA............G...AS....Y.N...........LPAVVWLPEPYPR...........................SPP..L..V..F..L.SPTRDM..............VVK...P.NH..pLVD.R..S....GLV...aNA..P...........Y.L..R..S.WVF.........PSSN...............LVDL.VRSLSH.......LFGLDPPL................................................................
E4XMK5_OIKDI/3-120                     ......................................................ln---QLDQLARHYP.......DL.KIE.SR..-.N..................C...........R.....I.....DGI..G.D...EYTV..LDGSIPA..T.......FK............G...VN....Y.N...........FATKILLPYAFPQ...........................EPP..R..V..K..A.APTEQM..............RVR...S.SE...YVS.E..T....GKI....TI..P...........Y.L..Q..S.WTI.........-SSS...............LVEL.CNDLSA.......LFSHFPPL................................................................
A0A0S4KKV9_BODSA/57-148                ...................................lfmvkgplfpandlrglpqve-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........--YVVTITQTFPN...........................SYP..I..L..T..I.EGPPVG.............wSFK...R.HP...NVD.F..S....GCC....FL..R...........S.V..S..S.WDP.........RRSK...............VVDC.VRELQQ.......AFRSNHP-f...............................................................
A0A6P6ESD3_OCTDE/1-47                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.-----M..............GIT...V.GK...HVD.V..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
I1LPI0_SOYBN/34-155                    .......................................................i-RQHLVALTTAFP.......SL.EPK.TA..S.F..................T...........H.....N.....DGR..S.V...NLLQ..ADGTIPM..T.......FQ............G...VT....Y.N...........IPVVIWLMESYPR...........................HPP..C..V..Y..V.NPTRDM..............IIK...R.PH..pHVN.P..S....GLV....SV..P...........Y.L..Q..N.WTY.........PSSN...............LVDL.ILNLSL.......HFGRDPPL................................................................
A0A6P6ESB6_OCTDE/10-93                 ....................................................glcr-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......FR............G...NV....Y.N...........IPVRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIT...V.GK...HVD.V..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A4Q4TRC6_9PEZI/25-147                ........................................................TYNDVAQALSQYS.......SL.SPR.TD..V.H..................T...........F.....D.....DGN..S.A...LLLH..LSGTIPV..V.......FR............G...TT....Y.R...........FPMSIWVPHAYPR...........................EAP..L..A..Y..V.TPTDNM..............MVR...P.GQ...HVD.P..Q....GKI....YH..P...........Y.L..A..A.WPEf.......wDKSS...............LLDF.LAMLRD.......IFAKEPPV................................................................
A0A2I3RBS4_PANTR/23-143                .......................................................t-VRETVNVITLYK.......DL.KPV.LD..S.Y..................V...........F.....N.....DGS..S.R...ELMN..LTGTIPV..P.......YR............G...NT....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSSM..............TIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LLGL.IQVMIV.......VFGDEPPV................................................................
A0A6G0WKG4_9STRA/13-133                .......................................................v-RQDVETLLRQIP.......SL.GPQ.NG..V.F..................T...........H.....N.....NGT..T.S...TMLS..LSGTIPI..Y.......YG............G...NQ....Y.N...........IPVEIWMPEAYPF...........................AAP..T..C..F..V.RPTADM..............MIR...P.GH..pHVD.Q..N....GLI....VL..P...........Y.S..T..N.WDS.........-DHS...............LVEL.IGYQCS.......IFGATPPV................................................................
H2TSN0_TAKRU/22-142                    ........................................................TVREITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGN..S.R...DLVS..LAGTIPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PHSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A024UEP7_9STRA/25-145                .......................................................v-RYDVETLLRQIP.......SI.SPQ.HG..V.Y..................T...........H.....N.....NGS..T.S...TMMS..LTGTIPI..Y.......YG............G...NQ....Y.N...........IPVEIWIPEAYPF...........................AAP..T..C..F..V.RPTTDM..............MIR...P.GH..pHVD.Q..N....GLI....VV..P...........Y.S..T..N.WDC.........-DHS...............LVEL.VGYHCS.......IFGAQPPV................................................................
A0A251TIQ9_HELAN/59-178                .......................................................i-RRHLISLHREFS.......SL.CPI.VD..T.Y..................I...........H.....H.....DGG..G.V...NLLK..VDGYLYI..S.......HS............-...-L....P.L...........VRINIWVHEHYPH...........................MAP..M..V..H..V.NTDLTN..............PIR...L.NH..pFVD.P..S....GLT....TS..S...........Y.L..H..T.WRP.........FEYD...............LLGL.ARNLVN.......IFSLDHP-f...............................................................
E3KWF8_PUCGT/25-147                    ......................................................al--NQIQSTLEHYP.......SL.SPK.TE..S.F..................T...........F.....D.....DGR..T.A...LLVS..LTGTIPV..H.......YR............A...LS....Y.N...........IPIAIWLPFEFPT...........................EPP..I..I..Y..L.TPTNEM..............IIR...K.GT...HVE.P..G....GKC....IA..G...........Y.F..N..S.WQSk.......pEACS...............LKEL.LEFLQD.......VFSREPPL................................................................
A0A2K3DLC5_CHLRE/31-151                .......................................................v-RDHVSELQKVFP.......TL.TAK.LS..E.Y..................H...........S.....N.....DGR..L.L...NVLK..VEGTMPI..H.......YQ............G...AK....Y.N...........IPILMWLAERYPY...........................NPP..Q..V..F..V.VPTANM..............IIR...P.SA...FVN.P..S....GQV....AT..P...........L.L..R..S.WLF.........PSSN...............LVDV.VLEMSQ.......VFGNEPPL................................................................
A0A6J3EQ93_SAPAP/79-162                ....................................................kysm-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..D.......TY............G...NT....Y.N...........IPIRFWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A0P7UK92_SCLFO/23-143                ........................................................TVHDVSGVISRYT.......EL.RPL.RD..A.Y..................V...........F.....N.....DGS..S.K...ELMN..LSGTIPV..I.......YK............G...KV....Y.N...........IPVCLWLLDTYPY...........................APP..I..C..F..V.KPTSTM..............VIK...T.GK...HVD.A..N....GKI....YL..P...........Y.L..H..E.WLP.........PKSD...............LFGL.IQVMIM.......MFGEEPPV................................................................
A0A383USP1_BLUGH/26-148                ........................................................TYKDVAQTLSYYY.......SL.SPK.TD..V.Y..................T...........Y.....E.....NGS..A.A...LLLH..IFGTLPV..V.......FR............E...IT....Y.R...........FPIELWIPHSYPK...........................DAP..I..V..Y..V.TSAENL..............MIR...P.GQ...HVD.L..Q....GKI....YH..P...........Y.L..V..R.WAEn.......wDKCN...............ILEF.LEILRN.......IFAKEPPV................................................................
A0A672TTV2_STRHB/23-142                ........................................................TIEELKNVNKTYP.......NF.TFS.MN..T.Y..................T...........F.....K.....DGS..Q.K...DLLN..FSGTVPV..K.......YG............-...NS....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTVNM..............GIS...V.GK...HVD.A..H....GRI....YL..P...........Y.L..Q..N.WSH.........PKST...............VIGL.IREMIA.......KFEEELPL................................................................
A0A0E0CTL8_9ORYZ/45-172                .......................................................i-RNHLVALADAFP.......SL.HPK.AA..L.F..................T...........H.....N.....DGR..A.A...HLLQ..ADGTIPI..H.......HA............G...AS....Y.N...........LPAVLWLPEPYPR...........................SPP..L..V..F..L.SPTRDM..............VIK...P.HH..pLVD.R..S....GLV...aNA..P...........Y.L..R..S.WVF.........PSSN...............LVDL.VRSLSH.......LFPA----spqlaarpp.......................................................
A0A6I9JTS5_CHRAS/21-141                ........................................................TVEELKNVNMFYP.......HF.RYS.VD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQDELPL................................................................
A0A6J2PWH4_COTGO/21-141                .......................................................v-AHEIYFAVSHFN.......NL.VPM.MD..K.Y..................V...........Y.....N.....DGT..T.K...DLMS..LTGTIPV..M.......IE............D...KT....Y.N...........IPICLWIEESYPQ...........................TAP..I..C..Y..V.TPTREM..............IVL...S.GK...YIS.S..N....GEV....LL..P...........Y.L..E..E.WKM.........GECD...............LVSV.LQVMVA.......MFGDFPPV................................................................
M1BPA9_SOLTU/50-170                    .......................................................i-RRHLVSFLQDYF.......SF.KPS.ID..A.F..................M...........H.....D.....DGT..S.V...NLLN..ANGELQL..S.......SS............-...-T....P.S...........IPLTIWLHESYPF...........................IAP..I..V..L..M.STNTTY..............PIY...D.NH..pFVD.S.sS....GAI....ST..F...........Y.L..V..N.WKY.........PGCN...............LSDL.VHNLFK.......IFSHNHP-f...............................................................
A0A0W4ZNM9_PNEJ7/26-147                .......................................................a-YNDVKDMIDSYP.......SM.DFW.IE..N.Y..................E...........F.....E.....KQK..-.Q...QVLA..IKIIFSI..I.......FH............D...NS....Y.D...........IPVVLWIPLLYPQ...........................KAP..A..V..L..I.VSEEGT..............VIR...Q.NN...HID.F..D....GRC....NY..P...........Y.L..T..L.WNEh.......sSDCN...............LIRL.CIFLRK.......VFSKDIPI................................................................
A0A3P9CN78_9CICH/21-107                .......................................................v-AHEINVALTYFR.......NL.VPV.MD..K.Y..................V...........Y.....N.....DGT..T.K...NLMS..LTGTIPA..T.......IN............N...IT....Y.N...........IPICLWIEETYPQ...........................TAP..I..C..Y..I.RPTQQM..............MIL...S.GK...YIS.S..N....G--....--..-...........-.-..-..-.---.........----...............----.------.......--------................................................................
A0A5A9PT57_9TELE/22-142                .......................................................a-VRDITNVISQYK.......DL.KPV.MD..A.Y..................V...........F.....N.....DGS..S.R...DLMS..LTGTVPV..S.......YR............G...SV....Y.N...........IPICLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LFGL.IQVMIV.......VFGEEPPV................................................................
A0A668RIL4_OREAU/22-142                ........................................................TVREITNVISQYK.......DL.KPL.MD..A.Y..................V...........F.....N.....DGS..T.R...DLMS..LTGTVPV..S.......YR............G...NV....Y.N...........IPVCLWLLDTYPY...........................NPP..I..C..F..V.KPTSAM..............MIK...T.GK...HID.A..N....GKI....YL..P...........Y.L..H..E.WKH.........PQSD...............LYGL.IQVMIV.......VFGEEPPV................................................................
A0A1D1V7N9_RAMVA/24-145                .......................................................t-AKDAQKVIAYYP.......DL.RTL.TA..Q.Y..................V...........F.....P.....DGL..S.R...ELLN..LTGTLPI..T.......YK............G...NT....Y.N...........IPVEMWIMDTHPY...........................NPP..L..C..Y..V.KPTADM..............RIK...S.PH..rHVD.Q..N....GRI....YL..P...........Y.L..T..D.WNH.........AKSD...............LLEC.CHVLVM.......IFSEEPPV................................................................
A0A654I8H4_9CEST/7-59                  ......................................................ar--SDIEAAARTYP.......SL.PVK.FQ..S.F..................T...........F.....D.....DGT..T.C...DLLS..LDGTLPV..T.......YD............R...RT....Y.N...........IPV----------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------a...............................................................
A0A1D2MJW1_ORCCI/23-143                ........................................................TTRDILEAIRMYK.......GL.KPI.SD..R.F..................V...........F.....N.....NGT..Q.K...TLLS..LTGTIPI..R.......YK............G...SS....Y.N...........IPVVIWLLDTHPI...........................NAP..M..V..F..V.NPTPDM..............RIK...V.SR...YVD.H..N....GKV....YL..P...........Y.L..H..E.WTI.........ANSD...............LLGL.IQVLIC.......TFSEQPPV................................................................
A0A179GB16_PURLI/25-147                ........................................................TYSDVARVLSRFS.......TL.SPR.TD..V.H..................T...........F.....P.....NGA..S.A...LLLH..ISGTIPV..I.......FR............A...NT....Y.R...........FPISIWVPHAYPR...........................EPP..L..I..Y..V.TPTETM..............MVR...P.GQ...HVD.P..Q....GQV....YH..P...........Y.L..V..R.WTEf.......wDKST...............IEDF.LMVLSD.......VFAKEPPV................................................................
A0A0V1HEX6_9BILA/35-155                .......................................................t-KEEIMEALSQFH.......DL.IVR.KD..F.Y..................V...........G.....N.....DGV..R.E...LAIC..FCGTIPV..N.......YM............G...KT....Y.N...........IPICIYLLKNYPH...........................VPP..I..C..F..V.RPTASM..............IVK...P.SS...NVD.S..N....GKI....NV..P...........Y.L..T..E.WHQ.........SKSD...............LLGL.LQVLAI.......VFGESCPV................................................................
A0A5F5PV93_HORSE/21-72                 ........................................................TMEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTVPV..M.......YH............G...VS....-.-...........-------------...........................---..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------dinsk...........................................................
A0A5A7REZ5_STRAF/125-192               ....................................................vtsa----STHLIETYP.......SL.QPK.TA..V.F..................T...........H.....N.....DGQ..P.P...P---..GHGTVPI..F.......FQ............G...VT....Y.N...........IPVIMWLMDSSPK...........................ER-..-..-..-..-.------..............---...-.--...---.-..-....---....--..-...........-.-..-..-.---.........----...............----.------.......--------aihmqae.........................................................
A0A1B8GY54_9PEZI/26-148                ........................................................TYHDVAQALSHYS.......SL.SPK.TE..V.Y..................T...........Y.....E.....NGV..S.E...LLLQ..LSGTLPV..A.......FR............G...TT....Y.R...........FPVTVWIPHQYPR...........................AEP..V..V..Y..V.SPAEGM..............MVR...A.GQ...HVD.P..Q....GRV....YH..P...........Y.L..A..G.WAEf.......hDKSN...............ILDF.LAILRD.......VFAKEPPV................................................................
A0A2Y9JQD0_ENHLU/23-143                ........................................................TVEELKNVNMFFP.......HF.RYS.MD..T.Y..................V...........F.....K.....DSS..Q.K...DLLN..FTGTIPV..M.......YQ............G...NT....Y.N...........IPIRLWILDSHPF...........................APP..I..C..F..L.KPTANM..............GIS...V.GK...HVD.A..Q....GRI....YL..P...........Y.L..Q..N.WSH.........PKSV...............IVGL.IKEMIA.......KFQEELPL................................................................
A0A428QFA4_9HYPO/25-147                .......................................................a-YNDVAQALTRYP.......TL.SPR.TD..V.H..................T...........F.....S.....HGA..N.A...LLLH..LSGTLPV..N.......FR............G...TT....Y.R...........FPVSIWVPHAYPR...........................EPP..M..I..Y..V.VPTETM..............MIR...P.GQ...HVD.P..Q....GLV....YH..P...........Y.L..V..G.WAEf.......wDKSN...............LQDF.LAILTD.......IFAKEPPV................................................................
A0A0D1YRA5_9EURO/1-49                  ........................................................-------------.......--.---.--..-.-..................-...........-.....-.....---..-.-...----..-------..-.......--............-...--....-.-...........-------------...........................---..-..-..-..-.-----M..............VVR...P.GQ...HVG.G..D....GRV....YH..P...........Y.L..A..H.WREa.......wERSN...............TVDF.LSILSD.......VFAKEPPV................................................................
A0A1Y2DR58_9FUNG/24-144                ........................................................IYEEFDEILTQYN.......GL.NPK.FD..R.H..................V...........F.....G.....GC-..F.Y...NLLG..MTGVIPV..T.......YR............N...VT....Y.N...........IPIGVWVMFDYPL...........................TPP..E..F..V..V.MPTESM..............KIV...V.GK...HVK.P..D....GII....TH..P...........Y.L..D..T.YSS........kPQYS...............MMEF.ISILRQ.......IFSNETPV...............................................