GenomeNet

Database: Pfam
Entry: VMAP-M4
LinkDB: VMAP-M4
Original site: VMAP-M4 
#=GF ID   VMAP-M4
#=GF AC   PF19966.2
#=GF DE   vWA-MoxR associated protein middle region (VMAP-M) 4
#=GF AU   Aravind L;0000-0003-0771-253X
#=GF AU   Iyer LM;0000-0002-4844-2022
#=GF SE   Aravind L
#=GF GA   27.00 27.00;
#=GF TC   33.40 158.10;
#=GF NC   26.90 26.70;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   32101166
#=GF RT   Highly regulated, diversifying NTP-dependent biological conflict
#=GF RT   systems with implications for the emergence of multicellularity.
#=GF RA   Kaur G, Burroughs AM, Iyer LM, Aravind L;
#=GF RL   Elife. 2020; [Epub ahead of print]
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   Highly variable central region of the vWA-MoxR associated
#=GF CC   protein (VMAP) of the classical ternary system (vWA-MoxR-VMAP)
#=GF CC   in NTP-dependent conflict systems. VMAP-Ms may be involved in
#=GF CC   sensing of invasive entities.
#=GF SQ   3
#=GS A0A1I4URT8_9BURK/257-363  AC A0A1I4URT8.1
#=GS A0A3N7JLM9_9BURK/276-383  AC A0A3N7JLM9.1
#=GS A0A2R4CBE8_9BURK/257-363  AC A0A2R4CBE8.1
A0A1I4URT8_9BURK/257-363             .DPRLDDALAAIQQVAITDAQVYRLYVRSLTLSADAVTPPVGLAVVLKLLHDLNPSRPGGPDPMSEFMMRAGREFPDAAIQAWIHKHL..TPQFRAQIDATLDKEAGDQS
A0A3N7JLM9_9BURK/276-383             .SRTVEELLKLVNKVSPAPALLYRLYLRSLPDASRSI-GHVAIEKWLRDLEDKRPREDNFPSPLVEFGERLAREAKSAEIASWVDTATrdNASARQALRSALDAEAQGQR
A0A2R4CBE8_9BURK/257-363             k-LPLPGAVAAVDQVALGNSTLYRLYVQSLPQAADAQDASVSPAAALRHLSELHPRKPGAPSPLAEFMVRLAAECANTKVDDWINQNV..TPQARTQLEQVLAKEGAADQ
#=GC seq_cons                        .shsL--ALAAVsQVAlusApLYRLYVRSLPpAADAlsusVulAssLRcLcDL+PR+PGuPSPLuEFMhRLAREsssAcIsuWIcpsl..TPQARsQL-usLDKEAuuQp
//
DBGET integrated database retrieval system