KEGG   Pyrococcus furiosus COM1: PFC_09155
Entry
PFC_09155         CDS       T02183                                 

Name
(GenBank) sugar kinase
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
pfi  Pyrococcus furiosus COM1
Brite
KEGG Orthology (KO) [BR:pfi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PFC_09155
Enzymes [BR:pfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     PFC_09155
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-ProteinID: AFN04754
UniProt: I6TZ16
Position
complement(1663951..1664835)
AA seq 294 aa
MKLDVICMGNLNYDITFMLERFPEFHEKVNAKKVYTGLGGSAGNTATWLSFLGLRVGFIG
AVGNDDFGRLHLEFFEKIGVDTRGIKVVDEPTGVAVMMVIGEDKRIVKYPGANRFKEVKE
NYLKLARHLHLSSNPLPLVEKAVNLAKNLGLTVSFDPGEMEVPKHIEEKIDILMMNEDEF
KRKYGSLEKITELKSRIAIATLNGGGALVRDENGNVYEIRGLSAKAIDTTGGGDSFDAGF
IYGYLNGWDVKDSAKLGMLLAYLTVQKVGARSAVIPLDEVKKIAKELGLDLPFQ
NT seq 885 nt   +upstreamnt  +downstreamnt
atgaaactagacgtaatatgcatgggaaatctcaactacgacataacctttatgctagaa
agattccctgagttccacgaaaaagtaaatgccaaaaaagtttacacaggcttaggaggt
tctgcagggaatacagcaacttggttgtccttcctgggattaagagtcgggttcattgga
gctgtaggaaatgatgactttggaaggctacacttggaatttttcgaaaagataggggta
gataccagggggattaaagttgtagatgaaccaactggagttgccgtaatgatggtaatt
ggagaagataagaggattgtcaaatacccaggagctaatagatttaaggaagtaaaggaa
aattacctaaagctcgcaagacaccttcacctttcttcaaaccctcttccacttgttgaa
aaggccgtaaatttagccaaaaatcttggtctaacagtgtccttcgacccaggtgaaatg
gaggttcctaagcatattgaagaaaagattgacattctaatgatgaatgaagacgaattc
aagaggaagtacggaagcttagaaaaaataacggagttaaagtccagaatagctatagca
actctcaatggtggtggagctttagttagggatgagaatggaaatgtttatgagataaga
ggactatctgcaaaggccatcgatacaactggtggaggagattccttcgatgctggattt
atctacggctatctaaatggatgggatgtaaaggattctgccaaactcggaatgttactc
gcctatctaactgtccaaaaggtgggagcgagaagtgcagtaattccactggatgaagtc
aaaaagatagcaaaagagctgggcctagatctaccatttcaataa

DBGET integrated database retrieval system