KEGG   Pseudomonas frederiksbergensis: PFAS1_28645
Entry
PFAS1_28645       CDS       T04786                                 

Definition
(GenBank) 2-hydroxychromene-2-carboxylate isomerase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
pfk  Pseudomonas frederiksbergensis
Pathway
pfk00626  Naphthalene degradation
pfk01100  Metabolic pathways
pfk01120  Microbial metabolism in diverse environments
pfk01220  Degradation of aromatic compounds
Module
pfk_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:pfk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    PFAS1_28645
Enzymes [BR:pfk01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     PFAS1_28645
SSDB
Motif
Pfam: DSBA Thioredoxin_5 DUF1479
Other DBs
NCBI-ProteinID: APV43294
UniProt: A0A1P8F4A0
Position
unnamed:11884..12483
AA seq 199 aa
MIVDFYFDFLSPFSYLANHRLSKLAQDYGFSIRYYAIDLARVKIAIGNVGPSNRDLIVKL
DYLKVDLQRWAELYEIPLVFPANYNSRRMNTGLYYSGAMAQTGAYVNVVFNAVWGDGIAP
DLESLPALVSEKLGWDRSAFEDFISSDAATERYDEQTHAAIERKVFGVPTMFLGDEMWWG
NDRLFMLENAVGGAPVNGE
NT seq 600 nt   +upstreamnt  +downstreamnt
gtgattgtcgatttttatttcgattttttgagtccgttctcttacttggccaaccatcgt
ttgtcaaagcttgcgcaagactatggcttttccattcgttattacgcaatcgatttggcg
cgagttaaaatagccatcggaaacgttggtccatctaatcgcgacctgatagtcaagctg
gactatttgaaagtagatttgcaacggtgggccgagctttacgaaataccgttggtattc
ccagctaactacaacagccgacggatgaatactgggctttattactcgggagccatggca
cagactggtgcctatgtgaatgtagtatttaatgcggtttggggagatggcatagctcca
gatttggaaagcttgcctgctctggtatctgaaaaactaggctgggatcgtagcgccttc
gaggactttatcagcagcgatgccgcaacagagaggtatgacgagcagacacatgccgcg
atcgaacgcaaagtgttcggtgtgccaacgatgtttttgggcgatgaaatgtggtgggga
aacgaccgtctatttatgctcgagaacgcagtgggaggtgcgcctgtaaatggagaatag

DBGET integrated database retrieval system