KEGG   Pyrococcus furiosus DSM 3638: PF1886
Entry
PF1886            CDS       T00075                                 

Name
(GenBank) sugar kinase
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
pfu  Pyrococcus furiosus DSM 3638
Brite
KEGG Orthology (KO) [BR:pfu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PF1886
Enzymes [BR:pfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     PF1886
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-ProteinID: AAL82010
UniProt: Q8TZU7
Position
1739367..1740251
AA seq 294 aa
MKLDVICMGNLNYDITFMLERFPEFHEKVNAKKVYTGLGGSAGNTATWLSFLGLRVGFIG
AVGNDDFGRLHLEFFEKIGVDTRGIKVVDEPTGVAVMMVIGEDKRIVKYPGANRFKEVKE
NYLKLARHLHLSSNPLPLVEKAVNLAKNLGLTVSFDPGEMEVPKHIEEKIDILMMNEDEF
KRKYGSLEKITELKSRIAIATLNGGGALVRDENGNVYEIRGLSAKAIDTTGGGDSFDAGF
IYGYLNGWDVKDSAKLGMLLAYLTVQKVGARSAVIPLDEVKKIAKELGLDLPFQ
NT seq 885 nt   +upstreamnt  +downstreamnt
atgaaactagacgtaatatgcatgggaaatctcaactacgacataacctttatgctagaa
agattccctgagttccacgaaaaagtaaatgccaaaaaagtttacacaggcttaggaggt
tctgcagggaatacagcaacttggttgtccttcctgggattaagagtcgggttcattgga
gctgtaggaaatgatgactttggaaggctacacttggaatttttcgaaaagataggggta
gataccagggggattaaagttgtagatgaaccaactggagttgccgtaatgatggtaatt
ggagaagataagaggattgtcaaatacccaggagctaatagatttaaggaagtaaaggaa
aattacctaaagctcgcaagacaccttcacctttcttcaaaccctcttccacttgttgaa
aaggccgtaaatttagccaaaaatcttggtctaacagtgtccttcgacccaggtgaaatg
gaggttcctaagcatattgaagaaaagattgacattctaatgatgaatgaagacgaattc
aagaggaagtacggaagcttagaaaaaataacggagttaaagtccagaatagctatagca
actctcaatggtggtggagctttagttagggatgagaatggaaatgtttatgagataaga
ggactatctgcaaaggccatcgatacaactggtggaggagattccttcgatgctggattt
atctacggctatctaaatggatgggatgtaaaggattctgccaaactcggaatgttactc
gcctatctaactgtccaaaaggtgggagcgagaagtgcagtaattccactggatgaagtc
aaaaagatagcaaaagagctgggcctagatctaccatttcaataa

DBGET integrated database retrieval system