KEGG   Pseudomonas furukawaii: KF707C_49540
Entry
KF707C_49540      CDS       T07047                                 
Name
(GenBank) aldehyde dehydrogenase
  KO
K20199  4-hydroxybenzaldehyde dehydrogenase (NADP+) [EC:1.2.1.96]
Organism
pfuw  Pseudomonas furukawaii
Pathway
pfuw00623  Toluene degradation
pfuw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfuw00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    KF707C_49540
Enzymes [BR:pfuw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.96  4-hydroxybenzaldehyde dehydrogenase (NADP+)
     KF707C_49540
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: BAU76642
Position
5365667..5367142
AA seq 491 aa
MNSIRPAYQNLDLQPLAGQWRAGSTGRPLEVVDPFTEAPLLRIALASREDLDEAYRKARD
SQREWAAKAPAERARVLLEAVKIFDERREEIIDWIIRESGSTRIKAQIEWGAARAITLES
ASLPNRVHGRIIGSNIPGKESRVYRVPLGVIGVISPWNFPLHLTARSLAPALALGNAVVV
KPASDTPVTGGLLLARIFEEAGLPAGVLSVVVGSGAEIGDAFVEHPIPAFISFTGSTQVG
RGIGRIASGGEHLKHVALELGGNSPFVVLADADVEQAVNAAVVGKFLHQGQICMAVNRII
VEAPLLEAFTRRFVERVKALPYGDPSRPETVVGPVINARQLAGLKEKVATALAEGATLLA
GGEAQGNVLPPHVFGNVTADMEIAREEIFGPLVGIQSARDAEHALELANQSEYGLSSAVF
TGSLERGVQFARRIHAGMTHVNDIPVNDEPNAPFGGEKNSGLGRFNGDWAIEEFTTDHWI
TLQHSPRPYPF
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgaacagcatccgccctgcctaccagaacctcgacctgcaacccctcgccgggcaatgg
cgcgccgggagcaccggccgccccctcgaggtggtcgaccccttcaccgaagcgccgctg
ctgcgcatcgccctggccagccgcgaggacctcgatgaggcctaccgcaaggcccgcgac
agccagcgggagtgggcggccaaggccccggcggagcgcgcccgggtgctgctggaggcg
gtgaagatcttcgacgagcgccgtgaggagatcatcgactggatcatccgcgaatccggc
agcacccgtatcaaggcccagatcgaatggggcgccgcgcgggcgatcaccctggaatcg
gcgagcctgccgaaccgcgtccacggccgcatcatcggctccaacattcccggcaaggaa
agccgcgtctaccgcgtgcccctgggcgtgatcggcgtcatcagcccgtggaacttcccg
ctccatctcaccgcccgctccctggcgccggccctggcgctgggcaacgccgtggtggtc
aagcccgccagcgacaccccggtcaccggcggcctgctgctggcgcgcatcttcgaggaa
gccggcctgcccgccggggtactcagcgtggtggtgggttccggcgcggaaatcggcgac
gccttcgtcgagcacccgatcccggcgttcatctccttcaccggttccacccaggtggga
cgtggcatcggccgcatcgccagcggcggcgagcacctcaagcacgtggccctggagctg
ggcggcaacagccccttcgtggtcctggccgacgccgacgtcgaacaggcggtcaacgcc
gccgtggtgggcaagttcctccaccagggccagatctgcatggcggtcaaccgcatcatc
gtcgaggcgccgctgctggaggcttttacccgccgcttcgtcgagcgcgtcaaggccctg
ccctatggcgatccaagcaggcccgagactgtggtcggcccggtgatcaacgcccggcaa
ctggccggcctcaaggagaaggtcgccaccgccctggccgaaggcgccaccctgctggcg
ggcggcgaggcccagggcaacgtcctgccgccccacgtcttcggcaacgtcaccgccgat
atggaaatcgcccgcgaagagatcttcggcccgctggtgggcatccagtccgcccgcgac
gccgagcacgccctggaactggccaaccagagcgagtacggcctttccagcgccgtgttc
accggcagcctggagcgcggcgtgcagttcgcccggcgcatccacgccggcatgacccac
gtgaacgacatcccggtcaacgacgaacccaacgcccccttcggcggcgagaagaactcc
ggcctcggccgattcaacggcgactgggccatcgaggagttcaccaccgaccactggatc
accctgcaacacagcccgcggccctatccgttctga

DBGET integrated database retrieval system