KEGG   Porphyromonas gingivalis W83: PG_1361
Entry
PG_1361           CDS       T00145                                 
Name
(GenBank) dipeptidyl aminopeptidase IV, putative
  KO
K18574  Xaa-Xaa-Pro tripeptidyl-peptidase [EC:3.4.14.12]
Organism
pgi  Porphyromonas gingivalis W83
Brite
KEGG Orthology (KO) [BR:pgi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pgi01002]
    PG_1361
Enzymes [BR:pgi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.12  Xaa-Xaa-Pro tripeptidyl-peptidase
     PG_1361
Peptidases and inhibitors [BR:pgi01002]
 Serine peptidases
  Family S9: prolyl oligopeptidase family
   PG_1361
SSDB
Motif
Pfam: DPPIV_N Peptidase_S9 Peptidase_S15 BD-FAE Hydrolase_4 SGL ANAPC4_WD40 Abhydrolase_1 AXE1 Esterase FrsA-like
Other DBs
NCBI-ProteinID: AAQ66425
UniProt: Q7MUW6
Structure
Position
complement(1440000..1442198)
AA seq 732 aa
MKKTIFQQLFLSVCALTVALPCSAQSPETSGKEFTLEQLMPGGKEFYNFYPEYVVGLQWM
GDNYVFIEGDDLVFNKANGKSAQTTRFSAADLNALMPEGCKFQTTDAFPSFRTLDAGRGL
VVLFTQGGLVGFDMLARKVTYLFDTNEETASLDFSPVGDRVAYVRNHNLYIARGGKLGEG
MSRAIAVTIDGTETLVYGQAVHQREFGIEKGTFWSPKGSCLAFYRMDQSMVKPTPIVDYH
PLEAESKPLYYPMAGTPSHHVTVGIYHLATGKTVYLQTGEPKEKFLTNLSWSPDENILYV
AEVNRAQNECKVNAYDAETGRFVRTLFVETDKHYVEPLHPLTFLPGSNNQFIWQSRRDGW
NHLYLYDTTGRLIRQVTKGEWEVTNFAGFDPKGTRLYFESTEASPLERHFYCIDIKGGKT
KDLTPESGMHRTQLSPDGSAIIDIFQSPTVPRKVTVTNIGKGSHTLLEAKNPDTGYAMPE
IRTGTIMAADGQTPLYYKLTMPLHFDPAKKYPVIVYVYGGPHAQLVTKTWRSSVGGWDIY
MAQKGYAVFTVDSRGSANRGAAFEQVIHRRLGQTEMADQMCGVDFLKSQSWVDADRIGVH
GWSYGGFMTTNLMLTHGDVFKVGVAGGPVIDWNRYEIMYGERYFDAPQENPEGYDAANLL
KRAGDLKGRLMLIHGAIDPVVVWQHSLLFLDACVKARTYPDYYVYPSHEHNVMGPDRVHL
YETITRYFTDHL
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgaagaagacaatcttccaacaactatttctgtctgtttgtgcccttacagtggccttg
ccttgttcggctcagtctcctgaaacgagtggtaaggagtttactcttgagcaactgatg
cccggaggaaaagagttttataacttttaccccgaatacgtggtcggtttgcaatggatg
ggagacaattatgtctttatcgagggtgatgatttagtttttaataaggcgaatggcaaa
tcggctcagacgaccagattttctgctgccgatctcaatgcactcatgccggagggatgc
aaatttcagacgactgatgctttcccttcattccgcacactcgatgccggacggggactg
gtcgttctatttacccaaggaggattagtcggattcgatatgcttgctcgaaaggtgact
tatcttttcgataccaatgaggagacggcttctttggatttttctcctgtgggagaccgt
gttgcctatgtcagaaaccataacctttacattgctcgtggaggtaaattgggagaaggt
atgtcacgagctatcgctgtgactatcgatggaactgagactctcgtatatggccaggcc
gtacaccagcgtgaattcggtatcgaaaaaggtacattctggtctccaaaagggagctgc
cttgctttctatcgaatggatcagagtatggtgaagcctaccccgatagtggattatcat
ccgctcgaagccgagtccaaaccgctttattaccccatggcaggtactccgtcacaccac
gttacggttgggatctatcatctggccacaggtaagaccgtctatctacaaacgggtgaa
cccaaggaaaaatttctgacgaatttgagttggagtccggacgaaaatatcttgtatgta
gctgaggtgaatcgtgctcaaaacgaatgtaaggtaaatgcctatgacgctgagaccggt
agattcgtccgtacgctttttgttgaaaccgataaacattatgtagagccgttacatccc
ctgacattccttccgggaagtaacaatcagttcatttggcagagccgtcgcgacggatgg
aaccatctctatctgtatgatactacaggtcgtctgatccgtcaggtgacaaaaggggag
tgggaggttacaaactttgcaggcttcgatcccaagggaacacggctctatttcgaaagt
accgaagccagccctctcgaacgccatttttactgtattgatatcaaaggaggaaagaca
aaagatctgactccggagtcgggaatgcaccgcactcagctatctcctgatggttctgcc
ataatcgatatttttcagtcacctactgtcccgcgtaaggttacagtgacaaatatcggc
aaagggtctcacacactcttggaggctaagaaccccgatacgggctatgccatgccggag
atcagaacgggtaccatcatggcggccgatgggcagacacctctttattacaagctcacg
atgccgcttcatttcgatccggcaaagaaatatcctgttattgtctatgtttacggagga
cctcatgcccaactcgtaaccaagacatggcgcagctctgtcggtggatgggatatctat
atggcacagaaaggctatgccgtctttacggtggatagtcgcggatctgccaatagaggg
gctgctttcgagcaggttattcatcgtcgtttggggcagaccgagatggccgatcagatg
tgcggtgtggatttcctcaagagccaatcatgggtggatgccgatagaataggagtacat
ggctggagctatggtggctttatgactacgaatctgatgcttacgcacggcgatgtcttc
aaagtcggagtagccggcgggcctgtcatagactggaatcgatatgagattatgtacggt
gagcgttatttcgatgcgccacaggaaaatcccgaaggatacgatgctgccaacctgctc
aaacgagccggtgatctgaaaggacgacttatgctgattcatggagcgatcgatccggtc
gtggtatggcagcattcactccttttccttgatgcttgcgtgaaggcacgcacctatcct
gactattacgtctatccgagccacgaacataatgtgatggggccggacagagtacatttg
tatgaaacaataacccgttatttcacagatcacttatga

DBGET integrated database retrieval system