KEGG   Polymorphum gilvum: SL003B_4081
Entry
SL003B_4081       CDS       T01458                                 

Definition
(GenBank) 2-hydroxychromene-2-carboxylate isomerase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
pgv  Polymorphum gilvum
Pathway
pgv00626  Naphthalene degradation
pgv01100  Metabolic pathways
pgv01120  Microbial metabolism in diverse environments
pgv01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pgv00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    SL003B_4081
Enzymes [BR:pgv01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     SL003B_4081
SSDB
Motif
Pfam: DSBA Thioredoxin_4 Thioredoxin_5
Other DBs
NCBI-ProteinID: ADZ72498
UniProt: F2J6L5
Position
complement(4385374..4385970)
AA seq 198 aa
MSPSRLDFYFDFMSPFAYLAFQKLPAICQRHGLELVPHAVNLPKLKLLAGNTAPPNVSLP
LKIRYLSKDLERWATLYGVPLVFPKSLASERLNKAFFFAQDRGQGEAFIREAWDRVWGRG
VDPADPALLGELAGLFGWAADELNAWVNSADAGERYESETRAAHEAGVFGTPTMIVGDQM
WWGNDRLAFMETALEKGL
NT seq 597 nt   +upstreamnt  +downstreamnt
ttgagcccgtcgcgtctggacttctacttcgacttcatgagccctttcgcctatttggcg
tttcagaagctgccggcaatctgtcagcgccatgggctcgaactcgtccctcatgcggta
aacctgcccaagctgaagctgctggccggcaacaccgcgccgccgaatgtcagccttcct
ctcaagatccgctatctgtcgaaggatctcgagcggtgggctacgctttacggggtgccg
ctggtgttcccgaaatcgcttgcgtccgaacggctgaacaaggctttcttctttgcgcag
gatcgtggtcagggcgaggccttcattcgcgaggcctgggacagggtatggggccgcggg
gttgatcccgccgatcccgcgcttctgggggaactggccggcctgttcgggtgggcggcg
gacgaactcaatgcctgggtgaattccgccgatgccggcgagcgctacgagtccgagacc
cgcgcggcccacgaggccggggtgttcggcacgccgacaatgatcgtcggagaccagatg
tggtggggcaatgaccgcctcgcattcatggaaacggccctggaaaagggcctctga

DBGET integrated database retrieval system