KEGG   Panicum hallii: 112900040
Entry
112900040         CDS       T07366                                 

Name
(RefSeq) cytochrome P450 93G1-like
  KO
K23180  flavone synthase II [EC:1.14.19.76]
Organism
phai  Panicum hallii
Pathway
phai00941  Flavonoid biosynthesis
phai01100  Metabolic pathways
phai01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:phai00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    112900040
   00943 Isoflavonoid biosynthesis
    112900040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:phai00199]
    112900040
Enzymes [BR:phai01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.76  flavone synthase II
     112900040
Cytochrome P450 [BR:phai00199]
 Cytochrome P450, plant type
  CYP93 family
   112900040
SSDB
Motif
Pfam: p450 DUF6237
Other DBs
NCBI-GeneID: 112900040
NCBI-ProteinID: XP_025824525
Position
7:complement(870088..872263)
AA seq 537 aa
MEEQQQPRSMVADPVTAVLALIAAVTAVALHHLISSWRLQARLPPGPTSLPVIGHLHLLR
PPVHRTFQELASRVGPLMHIRLGSTHCVVASTAEVAGELIRSHEGSISERPLTAVARQFA
YDSAGFAFAPYNAHWRFMKRLCMSELLGPRTVEQLRPIRRAGAVSLLRAALAASARGEAV
DLTRELIRLANTSVIRMVASTVPGSVTDEAQELVKAVAELVGAFNVDDYIALCRGWDIQG
LRRRAADVHRRFDALLEEILRHKEESREARRLLTVDHRKTKEAAATTHKDLLDILMDKAE
DKTAEVKLTRDNIKAFIIDVVTAGSDTSAAMVEWMLAELMNHREALRKVVAEIDAVVGGD
RIAGEADLPQLPYLMAAYKETLRLHPAAPIAHRQSSEEMVVRGFTVPPQTAVFINIWAIG
RDPALWEEPLAFRPERFMPGGAAESLEPRGQQFQFMPFGSGRRGCPGMGLALQSVPAVLA
ALVQCFDWATGAGGDDGAAVKQQQLIDMDESDGLVCARKKPLLLRPTPRLNPFPAVV
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggaagagcagcagcagcccagaagcatggtcgccgatccggtgaccgcagtcctggct
ttgatcgcggccgtcaccgccgtggctttgcaccacctcatctcctcgtggcgcctgcag
gcccgtctgcccccgggcccgacgagcctcccggtgatcgggcacctccacctgctccgc
ccgccggtccaccgcacgttccaggagctggcgtcccgcgtgggccccttgatgcacatc
cgcctggggtccacgcactgcgtggtggcgagcaccgccgaggtggccggcgagctgatc
cgcagccacgagggcagcatctcggagcgcccgctcacggcggtggcccggcagttcgcc
tacgactcggcgggcttcgccttcgcgccctacaacgcgcactggcgcttcatgaagcgc
ctctgcatgtcggagctgctgggcccgcgcaccgtcgagcagctgcgccccatccgccgc
gccggcgccgtgtcgctgctgcgcgccgcgctggcggcgtcggcgcgcggcgaggccgtg
gacctcacccgcgagctcatccgactcgccaacacctccgtcatccggatggtcgccagc
accgtgcccgggagcgtcaccgacgaggcgcaggagctggtcaaggccgtggccgagctc
gtcggagccttcaacgtcgacgactacatcgccctctgccgcggatgggacatccagggc
ctccgcaggagagccgccgacgtccaccgccgcttcgacgcgctgctggaggagatcctc
aggcacaaggaggagtccagggaggcgcggaggctcctcacggtcgaccacaggaagacg
aaggaggccgccgccacgacgcacaaggacctgctggacatcctcatggacaaagctgag
gacaagacggcggaggtgaagctcacacgggacaacatcaaggccttcatcatcgacgtg
gtgaccgctgggtcggacacgtcggcggccatggtggagtggatgctggcggagctgatg
aaccaccgggaggccctacgcaaggtggttgcggagatcgacgctgtggttggcggtgac
cggatcgccggcgaggcggacctgccgcagctgccgtacctgatggcggcgtacaaggag
acgctgcggctgcaccccgcggcgcccatcgcgcaccggcagtcgtcggaggagatggtg
gtgcgcgggttcaccgtgccaccgcagaccgccgtgttcatcaacatctgggccatcggg
cgcgacccagccttgtgggaggagcccctggcgttccgaccggagcggttcatgcccggc
ggcgccgccgagagtctggagccccgcgggcagcagttccagttcatgcccttcggcagc
ggccgccggggctgccccggcatgggcctggcgctgcagtccgtgccggccgtgctggcg
gcgctggtgcagtgcttcgactgggccaccggcgccggcggcgacgacggagcagcggtc
aagcagcagcagctgatagacatggacgagtcggacggcctggtgtgcgctcgcaagaaa
ccgctcctgctccgccccacacctcgcctcaaccccttcccggccgtcgtctga

DBGET integrated database retrieval system