KEGG   Panicum hallii: 112902702
Entry
112902702         CDS       T07366                                 

Name
(RefSeq) parkeol synthase
  KO
K19010  parkeol synthase [EC:5.4.99.47]
Organism
phai  Panicum hallii
Pathway
phai00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:phai00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    112902702
Enzymes [BR:phai01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.47  parkeol synthase
     112902702
SSDB
Motif
Pfam: SQHop_cyclase_C SQHop_cyclase_N Prenyltrans TED_complement Mago-bind
Other DBs
NCBI-GeneID: 112902702
NCBI-ProteinID: XP_025827654
Position
8:complement(13578227..13591822)
AA seq 759 aa
MWRLKVSEGSSPRLRSVNNLLGRQVWEFDPDLGTPEERAKVEKARREFAEHRFERKHSSD
LLMRMQFAKENPQKLDLPAVKLGENEEVTEEAVWNSLKRAVSRVCNLQADDGHWPGDYGG
LLFLLPGLIITLYVTGVVNTVLSPEHQKEILRYIYNHQNEDGGWGMHIEGHSTMLGSSLN
YVALRLLGEGPNAGDGAIEKCRKWILDHGGATFTASWGKFWLSVLGVFDWSGNKPVPPEL
WLLPYHLPFHPGRMSCYIRMVYLPMSYIYGKKFVGPVTPVVLELRNELYKVHYDEIDWNK
ARTECAKEDMYIPHSSVQDILWSIIHKFVEPVLMHWPGRKLREKALATAIRHIHYEDECT
RYINLGAVPKALNTLACWVEDPNSVAFKRHIARVYDYLWIAEDGMKMQIYDGSQVWDTGF
TVEALVATDLVKEIGPTLNRAHSFLKNSQLLDNCPGDFENWHRHISKGGWTFTTADDGWQ
VSDCTGTALKACLLLSKISPEIISEPLETERQYDAVNCLMSFMNDNGGFSSFERIRSYTW
LEYINPSDAFGCVMIEYPYVECTSSSIQCLALFRKLNPGHRKEEVEYCINKGASFIESSQ
RRDGSWYGSWGVCFTYATWFAVAGLISAGRTFENSATIRKACEFLLSKELPSGGWGESYL
SSHDEVYTNLKGNQPHGTHTAWAMLTLIDAGQAERDPMPLHRATRVLLNLQLEDGEFPQQ
EIIGVFLQTAMASYSQYRNIFPVWALTEYRRRVLLAGKK
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgtggaggctgaaggtgtcggagggcagcagcccacggttgaggtcggtgaacaacctc
ctcgggcggcaagtgtgggagtttgatcctgacctaggcacgccggaggagcgcgccaag
gtggagaaggcacgccgggagtttgccgagcaccgcttcgagcgcaagcattctagcgac
ctcctcatgcggatgcagtttgctaaagaaaaccctcagaagctagacctcccggccgtc
aagcttggagagaatgaagaagtcacggaggaagccgtctggaactctttgaaacgggca
gtaagcagggtctgtaatttgcaggcagatgatggacactggcccggggattatggaggg
cttctgttccttttgccaggcttgattataacattgtatgtgactggagttgtgaacact
gttctatcaccggaacatcagaaagagatactccggtacatctataatcatcagaatgaa
gatggagggtgggggatgcacattgagggccacagcacaatgcttggttcatccttgaac
tatgttgctttgagattgcttggagagggtccaaatgctggagatggagccatagagaaa
tgtcgaaagtggattttagatcatggaggagccacatttacggcgtcatgggggaagttt
tggctctcggtacttggggtatttgattggtccggtaataagccggtgccaccagaatta
tggctattgccatatcacctgccatttcacccaggtcgaatgtcatgctatatccgaatg
gtgtatctgcccatgtcttacatttacggaaagaagtttgttggcccagtcacaccagtt
gtactggaactgagaaatgaactctacaaagtccactatgatgagattgactggaacaaa
gctcgtacggagtgtgctaaggaagatatgtacattccgcattcgtcagttcaggatata
ctttggtccattattcacaagtttgttgaaccagttttgatgcattggcctgggagaaaa
ctgagggagaaagctctcgccaccgccataaggcacattcactatgaagatgagtgcact
cgatacatcaaccttggtgctgtacccaaggcattaaatacgcttgcttgctgggttgaa
gatccaaactcagtggcattcaaacgccatattgcacgagtatatgattacttgtggatt
gctgaagatggcatgaagatgcagatttacgatggcagccaagtgtgggacacaggtttc
acagttgaggcccttgtggctaccgaccttgtcaaagagattggaccaactcttaatcga
gcgcattccttccttaagaattcgcagttgcttgacaattgcccgggagattttgaaaac
tggcatcgccacatctccaaaggtggatggacatttactacagctgatgatggttggcaa
gtttcagattgcactggaacagcattaaaggcatgtctactgttatcaaagatttctcct
gaaatcattagcgaaccattggaaactgagagacaatatgatgctgtcaattgtctgatg
tctttcatgaatgataatggtggcttttcatcatttgaacgcataaggtcttacacatgg
ctggagtatattaatccttccgacgcatttgggtgtgtaatgattgaatacccgtatgtc
gaatgtacatcatcatcaattcagtgtctagcattattcagaaaacttaaccctgggcac
cgcaaggaagaggtggaatattgtatcaacaaaggtgctagtttcattgagagttctcaa
agaagagatggctcatggtatggctcttggggagtttgtttcacctatgccacatggttt
gccgtagcgggattaatttctgctggccggacattcgagaatagtgctacgatcagaaag
gcatgtgaatttctcttgtccaaagagcttccttcgggtggctggggagagagctatttg
tcaagtcatgatgaggtttacacaaatcttaaaggcaatcaacctcatggtacgcacact
gcatgggccatgctgacactaattgatgcaggacaggctgaaagagatccaatgcctctg
catcgtgcaaccagggttttgctgaacttacaattagaggatggagaatttccacagcaa
gagatcattggagtttttctccaaactgccatggccagttactcccagtacaggaacatc
ttccctgtatgggctctcacagagtaccgccgtcgagtattgctcgcaggcaagaaatag

DBGET integrated database retrieval system