KEGG   Parasphingorhabdus halotolerans: HF685_08390
Entry
HF685_08390       CDS       T07423                                 

Name
(GenBank) cytochrome P450
Organism
phao  Parasphingorhabdus halotolerans
Brite
Cytochrome P450 [BR:phao00199]
 Cytochrome P450, bacteria type
  CYP101 family
   HF685_08390
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: QJB69296
Position
1728708..1729892
AA seq 394 aa
MQDAATPDRPTHSFDIYHQPSIKVDVHDAFLDLKENAPPLFWTPENGGHWIVTDGDMMID
LLRKPNIFSNQNFSIPHQPDTPKTIPLSLDPPEHRPYRQMLRPFFEKKAIAPLNARIQEW
ADRLICAVKDQGECEFVDAVGSRFPVSVFMEMLGLSMDRFDEFRGLVQENFAKAGTPDAM
DVQMRIVAILAAFVKERQAEPKDDMMSQIIQSDIDGRALSFEELLSIAHLLFLAGLDTVV
NALSFAMKHLAGDEVLQRRIMDDPACIPDATEELLRRYSFVNLPRMIAEDTELGGQQLRK
GEKIICPLAIIGWEEKLNDNPLEVSVDRKVYRHGAFGSGIHTCIGLHLARMELHIFFATW
FREIGKFRLHPDKKPGAMRGGVVWAIEELWLEWE
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgcaggacgccgcgacaccggatagaccaacccacagctttgatatctatcaccaaccg
tcgatcaaagtggatgtgcatgatgcatttctcgacctgaaagaaaacgcgcctccgctt
ttctggacaccagaaaatggcggccactggatcgtcaccgatggcgatatgatgatcgat
cttctgcgcaagcccaatattttctccaaccagaatttttcgatcccgcatcaacccgat
acacccaaaaccattccactgtcgctcgatccgccagagcatcggccttaccgccagatg
ctgcgtccgttttttgagaaaaaagccatcgctccgctgaatgcccgcattcaagagtgg
gctgatcggctgatctgcgcggtcaaagaccaaggtgagtgtgaatttgtcgatgccgtg
ggttcgcgcttcccggtctcggtattcatggaaatgctggggctgtctatggaccggttc
gatgaatttcgcgggctcgtgcaggagaatttcgccaaggcgggtacgcctgatgcgatg
gatgtgcagatgcggattgtcgcgattctagcggcattcgtgaaggaacggcaagctgaa
cccaaagatgacatgatgagccagatcattcagtccgatattgacggtcgcgcgttgtca
ttcgaggaactcctctccatcgcgcatctcctgtttcttgccggactggatacggtggtg
aacgccctcagttttgcgatgaaacatcttgctggcgatgaggtgctgcaaaggcggatt
atggatgatcccgcctgcatcccggatgccaccgaagaactgctgcgccgatacagtttc
gtcaatctaccccgaatgatcgcggaagataccgaacttggcggtcagcaactgcgcaag
ggcgaaaaaataatctgcccgctggcgataatcggctgggaggagaagctcaatgacaat
ccgctggaggtctcggttgatcgcaaagtctatcgccacggcgcatttgggtccggcatc
catacctgcatcggactgcatcttgcgcggatggagctgcatatcttttttgcaacctgg
ttccgggagatcggaaaattccggctacatccggataaaaaaccgggagccatgcgcggc
ggcgtcgtgtgggcgattgaagagttgtggcttgagtgggaataa

DBGET integrated database retrieval system