KEGG   Pyrococcus horikoshii: PH1529
Entry
PH1529            CDS       T00014                                 

Gene name
PH1529
Definition
(GenBank) 369aa long hypothetical phosphate cyclase
  KO
K18105  RNA 3'-terminal phosphate cyclase (GTP) [EC:6.5.1.5]
Organism
pho  Pyrococcus horikoshii
Brite
KEGG Orthology (KO) [BR:pho00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PH1529 (PH1529)
Enzymes [BR:pho01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.5  RNA 3'-terminal-phosphate cyclase (GTP)
     PH1529 (PH1529)
SSDB
Motif
Pfam: RTC RTC_insert
Other DBs
NCBI-ProteinID: BAA30639
UniProt: O59198
Structure
PDB: 
4O89 4O8J

Position
1360699..1361808
AA seq 369 aa
MEEVEKEGKKKRNRAFKGNGHDSHRGYYMITIDGSYGEGGGQILRTSVALSTITGEPVRI
VNIRANRPNPGLRPQHLHAILALKHLANAEVKGAHVGSRELVFIPKKLEAKEISIDIGTA
GSITLVLQALLPAMVFAREKVKFRITGGTDVSWSPPVDYLSNVTLFALEKIGIHGEIRVI
RRGHYPKGGGIVEGYVEPWNEKRELVAKEYSRIIKIEGISHATNLPSHVAERQARAAKDE
LLQLKVPIEIRTEISRSIGPGSGIVVWAETDCLRLGGDALGKKGKPAEIVGKEAAQELLD
QLKPGHCVDKFLGDQLIPFLAFSGGVIWVSEITNHLKTNIWVVESFLGRIFDVDGNVGEP
GKIRVIRRV
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggaagaagttgagaaagaggggaagaaaaagcgaaatagagcttttaaaggaaatggc
cacgatagtcaccgggggtattatatgataaccatcgatggaagctatggggaaggaggg
ggtcaaattcttaggacttcagttgcactttcgacgataacgggcgagcctgtgagaata
gtgaacatcagggccaataggccgaatcctggcctaagaccacaacatttgcatgctata
ttagcccttaagcatcttgcaaatgctgaagttaaaggtgctcacgttggttcaagggag
ctcgtgttcatcccaaagaaacttgaagcaaaagagataagcattgacattgggactgca
ggtagtataaccctagttctccaagccctacttcctgcaatggtattcgctagggaaaag
gtgaaatttagaataacgggaggtacagatgtatcttggagtccaccggttgactacctt
agcaatgtaacgcttttcgcgttggaaaagatcggaatacatggagaaattagggtaatt
aggaggggacactatccaaagggtggtgggatagttgagggatacgtggaaccatggaat
gaaaagagggagttagtggcaaaggaatattccaggataataaagatcgaggggataagt
catgctacaaatttaccttctcatgtagctgaaaggcaagcgagggcagcaaaagacgaa
ctattgcaattaaaagtaccgatagagataaggacggagatttcaaggtcaattggtccg
ggaagcggaatagtagtatgggccgagacagattgcctaaggctgggaggggatgcacta
gggaagaaaggaaaacccgcagagattgttggaaaggaggccgctcaagaactattagat
cagctaaagccaggacattgcgtagacaagttcctcggtgatcaactaattcctttccta
gcattttcgggaggtgttatatgggttagcgaaattacaaatcatttaaaaacaaatatc
tgggttgtcgaaagcttcctgggaaggatttttgatgtagatggaaatgttggagaacct
ggaaagattagagttattaggagggtgtga

DBGET integrated database retrieval system