Photobacterium sp. CCB-ST2H9: L4174_002065 Help Entry L4174_002065      CDS       T10200                                  Symbol mutT Name (GenBank) 8-oxo-dGTP diphosphatase MutT   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism phot  Photobacterium sp. CCB-ST2H9 Brite KEGG Orthology (KO) [BR:phot00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:phot03400]     L4174_002065 (mutT) Enzymes [BR:phot01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      L4174_002065 (mutT) DNA repair and recombination proteins [BR:phot03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     L4174_002065 (mutT)  Prokaryotic type     L4174_002065 (mutT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX_4 NUDIX Nudt16-like Motif Other DBs NCBI-ProteinID:  UTM57708 Position 1:447626..448024 Genome browser AA seq 132 aa AA seqDB search MEKKRVWISAGIILNSQQDKVFITRRPETSHKGGFWEFAGGKVELGETAEQAVIRELNEE VGIVATELEHFIALEHDYPEKALKFDFFLIKAFDGEAYGREGQPGQWVALEALRDFAFPE ANYPVIDKLLAR NT seq 399 nt NT seq  +upstreamnt  +downstreamnt gtggaaaaaaaacgagtctggatatcagctggcattattctgaacagccagcaggataaa gtatttattacccgtcgtccggaaacctcccacaaaggcgggttctgggaatttgccggt ggtaaggtcgaactcggtgaaacagcggaacaagcggtcatccgggagctgaatgaagaa gtgggcattgtggcaaccgagctggagcactttattgcactggagcacgattatccggag aaggccctgaaattcgacttttttctgatcaaagcttttgacggcgaagcttatggccgg gagggtcagccggggcaatgggttgcgctggaagcactccgggatttcgctttccctgaa gcgaattatcccgtgattgacaagctgttggctcggtaa

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (3) Pfam (3) All databases (4) Download RDF

DBGET integrated database retrieval system