KEGG   Paraburkholderia hospita: C2L64_40520
Entry
C2L64_40520       CDS       T05305                                 

Name
(GenBank) 2,4,6-trichlorophenol monooxygenase
  KO
K24293  3,5,6-trichloropyridin-2-ol/2,4,6-trichlorophenol monooxygenase [EC:1.14.14.172 1.14.14.173]
Organism
phs  Paraburkholderia hospita
Pathway
phs00361  Chlorocyclohexane and chlorobenzene degradation
phs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:phs00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    C2L64_40520
Enzymes [BR:phs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.172  3,5,6-trichloropyridin-2-ol monooxygenase
     C2L64_40520
    1.14.14.173  2,4,6-trichlorophenol monooxygenase
     C2L64_40520
SSDB
Motif
Pfam: HpaB_N HpaB
Other DBs
NCBI-ProteinID: AUT74526
UniProt: A0A1H6K488
Position
3:1603282..1604835
AA seq 517 aa
MIRTGRQYLESLNDGRQVWVGNEKIDNIATHPKTRDYAQRHADFYDLHHRADLQDVMTYV
DENGKRRSMQWFGHHNKDQLRRKRKYHETVMREMAGASFPRSPDVNNYVLQTYLDDPTPW
ETQSIGAEGHIKAKNIVNFVNFAKDNDFNCAPQFVDPQMDRSNPEAQARSPGLRIVEQNE
KGIVVNGIKAIGTGVAFADWIHIGVFFRPGIPGEQVIFAATPVNTKGVTIVCREGVVKDD
PIEHPLASQGDELDGMTLFENVFIPWTHVFHIGNPEHAKLYPQRVFDWLHYHALVRQMVR
AELMAGLAVLITEHIGTNKIPAVMTRVAKLIGFHQAMLAHVIAAEELGFHTPGGHYKPNI
LVYDFGRALYLENFSQMIYELVDLSGRSALIFASEDQWNDATLNPWFERLNSGPVGKPHD
RVQIGRVIRDLFLTDWGSRLFVFENFNGTPLQAIRTLTMQRAEFSGSGPYAKLARKVCGI
ELESDGNSDYKATADYAKALDSARHQESLALSGTMAI
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgatccgaaccggtcgtcaatacctcgaatcgctgaatgacgggcgtcaagtctgggtt
ggaaacgaaaagatcgataacatcgcaacgcatccgaaaacgcgtgactatgcgcagcgt
catgcggatttctacgatctgcatcatcgggccgatttgcaagacgtcatgacctatgtc
gacgaaaatggcaaacgccgttcaatgcaatggttcggccatcacaacaaggaccagctc
cgtcgtaagcggaagtaccacgagacggtgatgcgcgaaatggctggcgcatcttttccc
cgaagccccgatgtgaacaactacgtcttgcagacgtacctcgatgatcccacgccatgg
gagacccaatctatcggcgcggaaggtcacatcaaggcaaaaaacatcgtgaacttcgtc
aactttgcgaaggacaatgatttcaattgcgcgccgcaatttgtcgatccgcaaatggac
cgctccaaccccgaagcacaggctcgctcgccgggtctgcgtatcgtcgaacagaacgag
aagggaatcgttgtcaacggtatcaaggcaatcggcactggcgtcgcctttgccgactgg
atccatatcggcgtgttcttccgtccgggtattcccggcgagcaggttattttcgcggcg
acgcccgtcaatacaaaaggggtgacgatcgtttgccgtgaaggcgtcgtgaaggatgat
ccgatcgaacacccgctcgcctcccaaggcgacgaactcgacggcatgacccttttcgaa
aacgtcttcattccgtggacgcatgtcttccatatcggcaatccagagcatgcgaagctt
tacccgcaacgtgtgttcgactggctgcattaccatgcgctggttcgccagatggtgcgc
gcagaactgatggcaggactggctgtactgatcaccgagcatatcggaaccaacaagatt
ccggccgtcatgacccgcgttgcaaaactgatcgggtttcaccaggcgatgttagcccac
gtcatcgcggccgaagagttgggcttccatacacctggaggacactacaagccgaatatt
ctggtctacgactttggccgcgcgctctatctggagaacttctcgcagatgatctacgag
ctggtcgatctttccgggcgcagtgcactgatcttcgccagcgaagaccaatggaacgat
gcaacgcttaatccgtggtttgaacgcctgaacagcggccccgttggcaagccgcatgac
cgcgtgcagatcggccgtgtgattcgcgacctgttcctgacggactggggcagccgcctg
ttcgttttcgaaaatttcaacggtacgccgttgcaagccattcgcaccctcaccatgcaa
cgcgccgaattctcgggatcgggcccgtacgcaaagctcgctcgcaaggtttgcggaata
gagctggaatccgatggcaacagcgattacaaagcgactgccgactacgcgaaagcgctc
gattcggcacgacatcaggaatcgctggcactcagcggcaccatggccatctga

DBGET integrated database retrieval system