KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM066650
Entry
Phum_PHUM066650   CDS       T01223                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit, putative
  KO
K08291  G protein-coupled receptor kinase [EC:2.7.11.16]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04144  Endocytosis
phu04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:phu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04341 Hedgehog signaling pathway - fly
    Phum_PHUM066650
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Phum_PHUM066650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phu01001]
    Phum_PHUM066650
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.16  G-protein-coupled receptor kinase
     Phum_PHUM066650
Protein kinases [BR:phu01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   Phum_PHUM066650
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 8231134
NCBI-ProteinID: XP_002423550
VectorBase: PHUM066650
UniProt: E0VBQ6
AA seq 600 aa
MNFERVGFDPETGITAKLELMELENIVANTVYLKAREGGSDNNKGKSKKWRKILQFPHIS
HCLELKNKIDVKYSYIIDQQPIGRLLFRQFCESENNKKYHQYNDFLDLLERYEIESDENR
NESAQKIYSTYLDRDSLNAVDIINIDLIQKCKERLNNADRDLFLECLSIVKNYLANEPFS
EFLESMYFHRYLQWKWLESLPVTYKTFRMYRVLGKGGFGEVCACQVRATGKMYACKKLEK
KRIKKRKGEAMVLIEKQILQKINSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNMG
GEPGFDLYRARFYAAEVLCGLEHLHAQGIVYRDCKPENILLDDHGHVRISDLGLAVQIPE
GDMVRGRVGTVGYMAPEVIYNEKYTFSPDWFSFGCLIYEMIEGQAPFRARKEKVKREEVD
RRVKEDQEKYSHKFTEEAKSLCQQLLKKNPKIRLGCSSGRNGAKEIKQHELFKCLQWKRL
EAGVWEPPFVPDPHAVYAKDVLDIEQFSTVKGVNLDATDDTFYSKFNTGSVSIPWQNEMI
ETECFKELNEFGPNNTRTPDLILDAPPEPESPGCFPFRRKKRQPSRTKPIPIQNHQFVPS
NT seq 1803 nt   +upstreamnt  +downstreamnt
atgaattttgaaagggtcggtttcgacccggaaaccgggataaccgccaagctggaattg
atggagctagaaaatattgtcgcgaatacagtgtatttaaaggcaagagaaggtggttca
gataataataaagggaaaagtaaaaaatggagaaaaattctacagtttcctcacatatct
cactgtttggaattaaagaacaaaattgatgtcaaatactcgtacataatcgatcaacaa
cctattggaagattgttatttcgtcaattttgcgaaagtgaaaataataaaaaatatcat
cagtacaatgatttcctcgatttattggagagatatgaaattgaatcggatgaaaatcgt
aatgaaagtgcacagaaaatatactctacatatttagacagagacagtttaaatgctgtc
gatataatcaatattgatttgatacaaaagtgtaaagaaagattgaacaatgctgacagg
gatttgtttttagaatgtttatcaatagttaaaaattatttagcaaatgagccattttca
gagttcctagaatcaatgtatttccacagatatttacagtggaaatggctggaaagcttg
ccggttacgtacaaaacatttaggatgtatcgagtgttgggaaagggaggattcggagaa
gtctgtgcttgtcaggttcgagctacgggtaaaatgtacgcttgtaaaaaattggaaaag
aaaaggataaagaaaagaaagggagaagccatggtattgatagagaaacaaatattgcaa
aaaataaattcacgtttcgttgttagtctggcatatgcatacgaaacaaaagatgctctt
tgcctcgttttaacaattatgaacggtggagatttgaaatttcacatatacaatatgggt
ggggaaccaggtttcgatttgtatcgtgcaagattttatgctgccgaggttttgtgcgga
ctcgaacatttacacgctcagggtatcgtttacagagactgcaaacctgaaaacatatta
ttagacgatcacggtcacgttagaatatcagatttaggattagccgtacaaataccggaa
ggagacatggtgagaggtagagtgggtaccgtcggttacatggcacccgaagttatttac
aacgagaaatatacattttctccagactggtttagtttcggatgtttaatttatgaaatg
atcgaaggacaagctccttttagagcgagaaaagaaaaagtcaaaagagaggaagtcgat
aggagagtgaaagaagaccaagaaaagtattcgcataaatttacggaggaagccaaatct
ctttgtcaacaattgttgaaaaaaaatccaaaaattcgactcggttgctcgagtgggaga
aacggtgccaaagaaataaagcaacacgaattgtttaagtgtttgcaatggaaaaggctg
gaagctggagtttgggaacctcccttcgttccagatcctcacgccgtatacgccaaagat
gtattagacattgaacaattttcaaccgtcaaaggagtcaatctcgatgcgacagacgat
acgttttatagtaaattcaacacgggaagcgtttcgataccctggcaaaacgagatgatc
gaaacggaatgttttaaagaacttaacgagttcggaccgaacaatactcgcacacccgat
ttaatattggacgcaccaccggaacccgaatctcccggttgtttcccatttagaagaaag
aaaagacaaccgtcaagaacaaaaccgataccgattcaaaatcatcaattcgtacccagc
tga

DBGET integrated database retrieval system