KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM087130
Entry
Phum_PHUM087130   CDS       T01223                                 

Definition
(RefSeq) RING-box protein 1A, putative
  KO
K03868  E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu03420  Nucleotide excision repair
phu04120  Ubiquitin mediated proteolysis
phu04141  Protein processing in endoplasmic reticulum
phu04310  Wnt signaling pathway
phu04341  Hedgehog signaling pathway - fly
phu04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:phu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Phum_PHUM087130
   04120 Ubiquitin mediated proteolysis
    Phum_PHUM087130
  09124 Replication and repair
   03420 Nucleotide excision repair
    Phum_PHUM087130
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Phum_PHUM087130
   04341 Hedgehog signaling pathway - fly
    Phum_PHUM087130
   04350 TGF-beta signaling pathway
    Phum_PHUM087130
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:phu04121]
    Phum_PHUM087130
   03400 DNA repair and recombination proteins [BR:phu03400]
    Phum_PHUM087130
Enzymes [BR:phu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     Phum_PHUM087130
Ubiquitin system [BR:phu04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   Phum_PHUM087130
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     Phum_PHUM087130
   ECV complex
     Phum_PHUM087130
   Cul3 complex
     Phum_PHUM087130
   Cul4 complex
     Phum_PHUM087130
   Cul7 complex
     Phum_PHUM087130
   Cul9 complex
     Phum_PHUM087130
DNA repair and recombination proteins [BR:phu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      Phum_PHUM087130
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      Phum_PHUM087130
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 zf-C3HC4_3
Other DBs
NCBI-GeneID: 8231642
NCBI-ProteinID: XP_002423819
VectorBase: PHUM087130
UniProt: E0VCH5
AA seq 113 aa
MATLPMDVDDEEEMPSVSTNKLEKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIE
CQANQASATSEECTVAWGLCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
NT seq 342 nt   +upstreamnt  +downstreamnt
atggctacattaccaatggatgtcgacgatgaagaagaaatgcccagtgttagcacaaat
aaattggaaaaaaaaagatttgaagtaaaaaagtggaatgctgtagcactttgggcttgg
gatattgtagtggacaattgcgcaatttgtcggaatcatattatggatttatgtatagaa
tgtcaagcaaatcaagcttcagcaacatctgaagaatgtaccgttgcttgggggttatgt
aatcatgcttttcattttcattgcatttcaagatggctaaaaactagacaagtttgtcct
ttggataatagagaatgggaatttcagaaatatggccactaa

DBGET integrated database retrieval system