KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM137480
Entry
Phum_PHUM137480   CDS       T01223                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit, putative
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04140  Autophagy - animal
phu04213  Longevity regulating pathway - multiple species
phu04310  Wnt signaling pathway
phu04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:phu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Phum_PHUM137480
   04341 Hedgehog signaling pathway - fly
    Phum_PHUM137480
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Phum_PHUM137480
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Phum_PHUM137480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phu01001]
    Phum_PHUM137480
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:phu03019]
    Phum_PHUM137480
   03036 Chromosome and associated proteins [BR:phu03036]
    Phum_PHUM137480
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Phum_PHUM137480
Protein kinases [BR:phu01001]
 Serine/threonine kinases: AGC group
  PKA family
   Phum_PHUM137480
Messenger RNA biogenesis [BR:phu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Phum_PHUM137480
Chromosome and associated proteins [BR:phu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Phum_PHUM137480
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 Seadorna_VP7
Other DBs
NCBI-GeneID: 8234350
NCBI-ProteinID: XP_002424596
VectorBase: PHUM137480
UniProt: E0VEQ2
AA seq 367 aa
MPISMSEIKVEAPLDKSKSCERTGSLVTDLQAHLDRAKIDFNVKFNRKFTNPPNVLLEDF
DRMRTLGTGSFGRVMLVKNKKTGLFYAMKILDKSKLVRLKQVEHTLYEKRILSSIHFPFV
VYMEFFFKDNSYLYFVMPFILGGEMFSHLRKLGKFEENLCRFYAAQVVLALQYLHHLDLV
YRDLKPENILIDRNGYLKLTDFGFCKIVSGRTWTLCGTPEYLAPEVILSKGYGKSVDWWS
LGILIYEMAAGYPPFYANDPMKIYEKIVSGKFRFASNFTPDIKDLIKNLLQVDLSRRYGN
LKNGVEDIKGHKWFKNVEWLNLLNHMVEPPFMPKVRSPGDTSNYDHYDEETLHVGSNDKF
QKEFREF
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgcctatttcaatgagcgaaatcaaagttgaagctccactggataaatccaaatcctgt
gaaagaactggatctctcgtcacagatttacaagcccatttagatagggctaaaatcgat
ttcaatgttaaattcaacagaaaatttactaatcctccaaatgttttattagaagatttt
gatcgcatgagaactttaggtacgggatccttcggtcgagtcatgttggttaaaaataaa
aaaaccggacttttttacgccatgaaaattctagacaaatctaaattggtacgtttgaag
caagtcgaacatacgctatacgaaaaaagaattctttcgtccatacattttccttttgtg
gtttatatggagtttttttttaaagacaatagctacctctattttgtcatgccgttcatt
ttaggcggagaaatgttttcgcatcttcgaaaactcggtaaatttgaagaaaacctttgt
agattttacgcagctcaagttgttcttgctttacaatatcttcatcatttagaccttgtc
tatcgagatttaaaacccgaaaacattctcatagaccgaaacggttatttaaaattaacc
gatttcggattttgtaaaattgtttccgggcgaacgtggacgttatgcggaactcccgaa
tatttagcccccgaagttattctaagtaagggatatggtaaaagcgttgactggtggtcc
ctcggaattttaatttatgaaatggccgccggttatccgcctttttatgcaaacgacccc
atgaagatttacgaaaaaatagtatccggaaaatttcgtttcgcatccaatttcacgccc
gacataaaagatttgataaaaaatttacttcaagttgatttatcgcgacgctacggtaat
ttgaaaaatggcgtcgaagacattaaaggtcataagtggtttaaaaatgttgaatggtta
aatttactgaatcacatggttgaaccaccctttatgcccaaagtgagaagccccggggac
acttcaaattacgatcattacgatgaagaaaccttacatgtgggctctaatgataaattt
caaaaagaatttcgtgaattttaa

KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM318270
Entry
Phum_PHUM318270   CDS       T01223                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit, putative
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04140  Autophagy - animal
phu04213  Longevity regulating pathway - multiple species
phu04310  Wnt signaling pathway
phu04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:phu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Phum_PHUM318270
   04341 Hedgehog signaling pathway - fly
    Phum_PHUM318270
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Phum_PHUM318270
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Phum_PHUM318270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phu01001]
    Phum_PHUM318270
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:phu03019]
    Phum_PHUM318270
   03036 Chromosome and associated proteins [BR:phu03036]
    Phum_PHUM318270
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Phum_PHUM318270
Protein kinases [BR:phu01001]
 Serine/threonine kinases: AGC group
  PKA family
   Phum_PHUM318270
Messenger RNA biogenesis [BR:phu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Phum_PHUM318270
Chromosome and associated proteins [BR:phu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Phum_PHUM318270
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1
Other DBs
NCBI-GeneID: 8236051
NCBI-ProteinID: XP_002427414
VectorBase: PHUM318270
UniProt: E0VMS0
AA seq 385 aa
MLRYKSNNSGYANRCAFLLEKLSDNVEKKDVTKMGNAPTSNKKCDPVESVKEFLDQAKED
FEEKWKNVSSNTAELDDFERIKTLGTGSFGRVMIVQHKNLKEYFAMKILDKQKVVKLKQV
EHTLNEKRILQAINFPFLVSLKYHFKDNSNLYMVLDYVPGGEMFSHLRKVGRFSEPHSRF
YAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYL
APEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDL
KDLLRNLLQVDLTKRYGNLKNGVNDIKGHKWFASTDWIAVFQKKIEAPFIPRCKGAGDTS
NFDDYEEEALRISSTEKCAKEFAEF
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgttgaggtataagagtaataattccggctatgctaacaggtgtgcctttttacttgaa
aaattgtcagataacgttgaaaagaaagacgttacaaaaatgggaaatgcccccacttcg
aataaaaagtgcgatcccgttgaaagtgttaaagaatttctcgatcaagccaaggaagat
ttcgaagaaaagtggaaaaatgtatcatccaatacagctgaattggatgattttgaaaga
atcaaaactcttggaaccggttccttcggtagagttatgatcgttcaacataaaaactta
aaagaatactttgctatgaaaatattagacaaacaaaaagtagttaaattaaaacaagta
gaacatactcttaacgaaaagcgtatcttgcaagctatcaattttccatttttagtaagc
ttaaaatatcatttcaaagacaattcgaatctttacatggttttagattacgtacccggt
ggagaaatgttttcacatcttcgaaaagtaggaagattcagcgaacctcattcgaggttt
tacgctgcacaaatagtgcttgcctttgaatatcttcattacttagatctcatttacaga
gacctcaaaccggaaaatctgttaattgattcacaaggatatcttaaagttacggatttc
ggatttgccaaaagagtcaaaggaagaacatggaccctgtgcggtacaccagaatatctg
gcacctgaaataatattgagcaaaggatataacaaagcagtcgattggtgggcactcgga
gttctcgtctacgaaatggctgctggttatcctccattttttgctgatcaaccaatacaa
atatatgagaaaatagtatctggtaaagtgagatttccatcacactttggctcagattta
aaagatctactgagaaatttactccaagttgatctaactaaaagatatggaaatttaaaa
aatggagtgaatgatataaaaggtcataaatggtttgcatcgacggattggatagctgtt
ttccagaagaaaatagaagcgccattcatacctagatgcaagggtgcaggcgacacaagt
aattttgatgattacgaagaagaagcattgagaatatcatcaacagaaaaatgtgctaaa
gaatttgccgagttttaa

KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM488810
Entry
Phum_PHUM488810   CDS       T01223                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit, putative
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04140  Autophagy - animal
phu04213  Longevity regulating pathway - multiple species
phu04310  Wnt signaling pathway
phu04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:phu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Phum_PHUM488810
   04341 Hedgehog signaling pathway - fly
    Phum_PHUM488810
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Phum_PHUM488810
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Phum_PHUM488810
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phu01001]
    Phum_PHUM488810
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:phu03019]
    Phum_PHUM488810
   03036 Chromosome and associated proteins [BR:phu03036]
    Phum_PHUM488810
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Phum_PHUM488810
Protein kinases [BR:phu01001]
 Serine/threonine kinases: AGC group
  PKA family
   Phum_PHUM488810
Messenger RNA biogenesis [BR:phu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Phum_PHUM488810
Chromosome and associated proteins [BR:phu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Phum_PHUM488810
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like FTA2 Seadorna_VP7 ABC1 APH NAD_Gly3P_dh_N
Other DBs
NCBI-GeneID: 8231462
NCBI-ProteinID: XP_002430509
VectorBase: PHUM488810
UniProt: E0VWL5
AA seq 352 aa
MHRKKSRKDAKKLTIYKNYLIESREKTLKKLNERVYANTSLQDYKLLYVLGEGNYGMVLA
AQNRKSGKQYAIKIVEKRKVISTTQIKHLKSEIKILNAIRFTFAISLECYFTNSCNIFIV
LPEISGGHFCKFLKRIKRFDENSARFFAGQVILTIEYLHHMGIIYRDLKPENLLLDLNGY
LKFVDFGFSKYIENNLTYTFCGTPDYIAPEILANKGYTKSTDWWSLGILLYEMCNGEPPF
KSSNELKLYEKILIGKINWPEHFSSSLISVNEGLLQVNKTRRLGCMKNQVDDIKNHEWFN
NFDWYALWKKSIVPPVTYTPPKKRRNFSFDEKFPFACKDVYESFIKDFDHHV
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgcatcgtaaaaagagtcgaaaagatgcaaaaaaattaacaatttataaaaattattta
attgaatcaagagaaaaaacgttaaaaaaattaaatgaaagagtttatgccaatacaagt
ttacaagattacaaattgttgtacgtattaggggaaggaaattatgggatggtactggct
gcacaaaatcgtaaaagtggaaaacaatatgcaattaaaatcgttgaaaaaagaaaagta
atcagcacgactcaaataaaacacttaaaatccgaaattaaaatattaaacgccattaga
tttacttttgcaatttcattggaatgctactttacaaatagttgcaatatatttattgtt
ttaccagaaatcagtggtggacatttttgcaaatttttaaaaaggataaaaaggtttgat
gaaaactctgctaggttttttgctgggcaggttatattaacaatagaatatttacatcac
atgggtattatctacagagatttaaaacctgaaaatttattattagatttaaatggatac
cttaaatttgtggattttggattttcaaaatatattgaaaacaatttaacatacactttt
tgtggtactccagattatattgcccctgaaattctagcaaataaaggctatacaaaatca
actgattggtggtctttgggcattttgttgtacgaaatgtgtaatggagaacctcctttt
aagtcttctaatgaactcaaactatatgaaaaaatacttattggtaaaataaattggcca
gagcatttttccagttcattgatatctgttaatgagggtttgttgcaggtgaataaaaca
agaagacttggttgtatgaagaatcaagtggatgacattaaaaatcatgaatggtttaat
aattttgattggtatgctctttggaagaaatctatagtacccccagtaacatatacacct
ccaaaaaaacgtcgcaattttagttttgatgaaaaatttccatttgcctgcaaagatgtt
tacgaatcatttattaaagattttgatcatcatgtataa

DBGET integrated database retrieval system