KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM299830
Entry
Phum_PHUM299830   CDS       T01223                                 

Definition
(RefSeq) hypothetical protein
  KO
K20245  brother of ihog
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:phu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04341 Hedgehog signaling pathway - fly
    Phum_PHUM299830
SSDB
Motif
Pfam: Ig_3 Ig_2 I-set ig fn3 V-set C2-set_2 Pur_ac_phosph_N Ig_6 Psg1 Izumo-Ig
Other DBs
NCBI-GeneID: 8229809
NCBI-ProteinID: XP_002427175
VectorBase: PHUM299830
UniProt: E0VM31
AA seq 713 aa
MDDKSYFTLLVFDVGPKFINNPEPIVAPLGDEVEFDCSLDVKADYLRWKHNGKLLPFIYN
DTAKSRLVFKMNNESQIGDYQCIAWYGASAIASNSARLSLAEIGPIPPKSYRSVTVSEGN
NIGIKCRSPYSKPAAFIQYYKNNVSVEAHVSKSGTLLLTNVTSKDSGLYSCSITNPYVKE
NAIFLPSYDNILVSTDLKENPPQFSYLPESLYTVQIGANVTLECVGYGQPIPKYYWKRKN
GTLPLNKHTIVPGGLLLINVNASDEDFYTCEIDNGIPPKLIHNFKVVVQEPAFVEKGPLN
LLVKEGGKARMDCFIRGKPFPKVTWLLNGETVKNDSHVLINGSTIHIFVVEKRHAGMYQC
MAENILGSSFGSSTLRVEPRQVTAKNSFGMRQFSFHNPRFRGSEMIPPTRPNVTRLTDNS
VMVRWHVTPNKGLPILFFKVQHRELTKGKGSRWKTNNEDIPPHVGSYEVVNLTPDKYYRF
RIAAVYSNMDNKLSPNSARFFLHGGKVKQTPAAPELIHTSAAGPESIRLVWEYHNNSKIP
IEGFYVYYRSTSTAGDYIKATVEGEWIRTYVINYLNPDTAYDIKLQSFTIDAASDFSEIL
TQKTEKEPTVSPPSEKPTTKKTEDEENESSKSSNQLYVTLGAVLGGLGLLLMLCLGIFFC
NKHRQTSTVSQEQINLNGHIPISNGHVGKSNGYLTSKMNITNNPLADTDEDKV
NT seq 2142 nt   +upstreamnt  +downstreamnt
atggatgataagtcgtactttactttactcgtttttgatgttggaccaaaattcatcaac
aaccctgagccaattgtggctcctcttggagacgaagtagagttcgattgttctttggat
gttaaagctgactatcttagatggaagcacaatggaaaacttcttccttttatatataat
gatacggcaaaaagtcgattggtattcaaaatgaacaatgaatctcaaataggagattat
cagtgcattgcttggtatggagctagtgccattgcatccaattcggctcgtctcagccta
gctgaaattggacccattcccccgaaatcttataggtcggtgacggtttcagaaggaaac
aacattggaataaaatgtaggtcaccctacagcaaacctgcagcttttattcagtattat
aaaaataacgtttctgttgaagctcacgtttctaaatctggaacactattactgactaat
gtaacttcaaaggatagtggtttatattcatgctcaataacaaatccttatgttaaagag
aatgccatatttcttcccagttacgacaatattttagttagtacggatttaaaagaaaat
ccccctcagttttcttatctgcccgaatctctttatactgtacaaataggagcgaatgtg
acattagaatgcgtgggatacggtcaacccattccaaaatattattggaaacgaaaaaat
ggtacattacctttaaataaacacacgatagtgccaggaggtcttttattgatcaatgtt
aatgcgagtgatgaagatttttacacgtgtgaaatcgataacgggatacctcctaaactt
attcacaattttaaagtggtagtgcaagaacctgcttttgtcgaaaaaggtcctttaaac
cttttagtcaaagaaggaggaaaagctagaatggattgcttcattagaggtaaacctttt
cctaaagtcacgtggcttcttaatggcgaaaccgttaaaaacgattctcacgttttaata
aatggtagcacaattcacatttttgtggttgaaaaacgtcatgctggaatgtatcagtgc
atggcagaaaatattttgggatcttcttttggttcttctactcttcgtgttgaaccccgt
caggtaactgccaaaaattcatttggaatgcgtcaattttcatttcacaatccacgattt
cgaggaagtgaaatgattccacctactcgtcctaacgtgactagattgacagataactct
gtaatggttcgatggcatgtaacgccaaataaaggattaccaatattgttttttaaagtt
caacatagagaactaactaaagggaagggatcgaggtggaagacaaacaacgaagacatt
cctcctcatgttggaagttacgaagttgtaaatcttactcctgataaatattatagattc
agaattgcagccgtttattcaaatatggacaataaattgagtccgaattccgcgagattt
tttcttcacggaggaaaagtcaaacaaactcctgcagcacctgaattaattcacacgagt
gctgccggtcccgaatcaattcgcctcgtttgggagtatcataataatagtaaaatcccg
attgaaggattttacgtgtattatcgatccacttcaactgctggagattacataaaagct
acagttgaaggagaatggataagaacttatgttataaattatttgaatccggacactgcg
tacgatataaaattacaaagttttacaatagatgcagccagcgattttagtgaaatcctt
acacaaaaaacagaaaaagaaccgactgttagcccaccttcggaaaaacctacaacgaaa
aaaacagaagatgaagagaatgaaagttcaaaaagtagtaatcagttgtatgtgacatta
ggagcggttttaggaggtttgggattattgcttatgctttgtttagggatatttttttgt
aacaaacacaggcaaacttctacagtatctcaagaacaaataaatcttaacggacacatt
cctatatctaacggtcacgttggaaaaagtaacggttatctaacatcgaaaatgaatata
acgaataatccattggccgacacagacgaagataaagtatga

DBGET integrated database retrieval system