KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM346320
Entry
Phum_PHUM346320   CDS       T01223                                 

Definition
(RefSeq) protein decapentaplegic precursor, putative
  KO
K04662  bone morphogenetic protein 4
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04013  MAPK signaling pathway - fly
phu04341  Hedgehog signaling pathway - fly
phu04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:phu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Phum_PHUM346320
   04341 Hedgehog signaling pathway - fly
    Phum_PHUM346320
   04350 TGF-beta signaling pathway
    Phum_PHUM346320
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:phu04052]
    Phum_PHUM346320
   00536 Glycosaminoglycan binding proteins [BR:phu00536]
    Phum_PHUM346320
Cytokines and growth factors [BR:phu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   Phum_PHUM346320
Glycosaminoglycan binding proteins [BR:phu00536]
 Heparan sulfate / Heparin
  Morphogens
   Phum_PHUM346320
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 8231893
NCBI-ProteinID: XP_002427806
VectorBase: PHUM346320
UniProt: E0VNW2
AA seq 422 aa
MRWLLMVFLVVLTLNLMPLDANSQNNEGYDNDKEKYKKYNKGSETQKNIIDIKNKNIIAT
VEKNLMTLFGFSKRPRINKRDVVVPKAMLDLYKKQTGMDLDTTNFMLPGRLTSSANTVRS
FTHQESPIDNQFRQRHRFRLSFPIEGSIPKSERLKAAELHLNRVSIPQAVQNGCHTLQIL
VHDIILPGIKGKRQTITRLIDSKQVFLSENETVKMDVTPAVERWLANSADNHGLLVKIVI
PKTKSNKYYKNLMLSKLNHIDKHVRLKREAHVGRKDWKKVEPLLFTYTDDGKSKSSWKDS
SAGRLRRGIRKHKRKDGREHCRRHELYVKFEDVGWDDWILAPPGYDAFYCSGDCPFPLSD
HFNSTNHAIVQTLVNSVFPNTAPKACCVPTALAPISMLYVDEENKVILKNYDDMSILGCG
CR
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgcggtggctgctaatggtgttcttggtggtcctgacgctcaatcttatgccactagac
gccaattcgcagaataacgaaggctacgataacgataaggaaaaatataaaaaatataat
aaaggttcagaaactcaaaagaatattatcgatattaagaataaaaatataattgctacg
gtcgaaaaaaacctgatgactctgtttgggttttccaaaaggccgagaatcaataaaagg
gacgttgtcgttcctaaagctatgctagatttgtataaaaaacaaacaggcatggatttg
gataccacaaattttatgttaccgggcagacttacctcttctgctaatacggtcagaagc
tttacccatcaagaaagtccgattgacaaccaatttcgtcaaaggcatcgttttcgttta
tcttttccaatagaaggatcaataccaaagtcagaaaggctaaaggcagcggaattgcac
ctgaatcgagtgtcaatacctcaagcggttcaaaatgggtgtcacacccttcaaattcta
gtccatgatatcatactacccggaattaaaggaaagcgtcaaacaattactaggttaatt
gattcaaagcaagtttttttaagtgaaaatgaaactgtcaaaatggacgtgactccggct
gtcgaaagatggttggctaattccgctgataaccacggtctgctcgtgaaaattgtgatt
ccaaaaacaaaatcaaataaatactataagaatttaatgttgagtaaattaaaccatatt
gacaaacatgttagattaaaacgggaagcgcacgtcggacgaaaagactggaagaaggtt
gaaccattgctatttacgtatacggatgatggaaaatctaaaagttcttggaaagattca
tcggcgggaaggctgaggaggggaataagaaaacataagagaaaagatggaagagagcac
tgcaggcggcacgaactctatgttaaattcgaagatgtcggatgggacgactggattttg
gctccccccggctacgacgctttttattgttccggagactgtccttttccactgtccgat
cattttaattcaaccaatcatgctattgttcaaactttagttaatagtgtatttccaaac
acggcaccaaaagcatgctgtgttcccaccgcccttgcaccaatatcaatgttatatgta
gatgaagaaaacaaagttatattaaaaaattacgacgatatgtcaattttaggatgcggt
tgtcgatga

DBGET integrated database retrieval system