KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM413310
Entry
Phum_PHUM413310   CDS       T01223                                 

Definition
(RefSeq) protein cubitus interruptus, putative
  KO
K16799  transcriptional activator cubitus interruptus
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:phu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04341 Hedgehog signaling pathway - fly
    Phum_PHUM413310
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:phu03000]
    Phum_PHUM413310
Transcription factors [BR:phu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    Phum_PHUM413310
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4
Other DBs
NCBI-GeneID: 8234299
NCBI-ProteinID: XP_002428976
VectorBase: PHUM413310
UniProt: E0VS82
AA seq 1377 aa
MNEFLYIFPGSPAAFRAAYRNCNCWRLGGASEPLLPALGIITPLIAYRSIWSTYTQAFTT
ARHRLCTVNYYYYYYHSRFIFEISIVQHWHWSIFTGLSFPSEYLTSIPPPSTVASTELPY
SIDSRLPSPCPSSAIRQSRKRALSSSPYSDSFDINSMIRFSPNSLVNSLVNGSRSSSASG
SYGHLSAGALSPALNMHMPQLQAHLLRSQGLLPPLGPTSHTQGSHGSLFSISHHPLGSTA
SLPKVEGRQDCSIRAEADSLTDRKVIYLFIDFKFVSIYIFLFLLCLKRENKFLKLNNHLS
KSFQQTNRIKKETKTGTGTGGGGGGGTETTKSPDCGDLKDEPADFIETNCHWKECTMEFP
TQDDLVKHINNDHIHVNKKSFICRWEDCSRDEKPFKAQYMLVVHMRRHTGEKPHKCTFEG
CFKAYSRLENLKTHLRSHTGEKPYTCEYPGCSKAFSNASDRAKHQNRTHSNEKPYVCRAP
GCSKRYTDPSSLRKHVKTVHGADFYANKKHKLGPSPDQEPDGSTNMPSPSRSDEGQLSKT
TSLSSPSTVKSEEAPSPGTNQGSPLSRQHAVWGDEVSDSPPSVLADLVEDANWSEDIDLG
SDLSVAVTTRNTRNRLKSRLQAKGLALSSAPGGMRLIDLGRKIAELKMEPKIQEQTRLGP
KSCGPGIKTILDNNRRDSNSTVSCYGTMSHVSSRRNSQASQASRANSCAIASFYDPISPG
SSRRSSQMSQPGRSPSIMGTNSQISMMHSHQYGTMCQGGKPGTVKTLMSPTNSPNYQPIS
PLPNHLSPSHSSTVAQNIHALSPNSNSLCPNLLCSDVLSPNSNILSPIYNSNVSSLTANH
NINSSSLSVGVQTVDSVPTLATLGPAMSPVRNIFTNTSNLVLQTANMSLNGELPPVLPPV
NPTEPCSDVTQQPTIDPLHPNQEVQLEQINEGEMIENKLVIPDEMERYLSQVAAILDTDN
QITELSSPPDPKLETKTETFNQDCNAEVHNIQQVFTDFNSNDMNDQNVKKLNTNTTTTTT
TNNNQAQQIVINPAAQHSDPSDDKSTVSQATTNINQQNGNYSNYGNNQCITQHGHDHYPP
SHYHHHHHGSYCSQNQGNHHYHNYQTQLQNQQGRAPDRNGYNFNNYRCHLNNGTKPVQTN
QVCSQTPIPGQNYQQDFNSSLQHPHQSSFYPSCQNHLCYAHDHCTNCVNVCQQTPNYPQC
GNNQIHNCNTGHQVMNNSHTVHQTVPYNSQIQQNQTINGQYSRCGCNNGNNHEVKTNCVQ
HHHNKMCRSCHYQNNGVGVVGGGVTPGTLNKDSEKNIYKNFNGENYDNEIQCTDISQSEV
RMPRDAYERTLEYVQQCQIWSNEVSSSTHPTSNMVVNDLTSSLNSLMQENRFFQMIN
NT seq 4134 nt   +upstreamnt  +downstreamnt
atgaatgaatttttgtatatttttccaggctctccagcagcgtttcgagcggcgtaccgg
aattgcaattgttggcggctcggcggggcctcggagccgctcctcccggccctggggatt
atcaccccgcttatcgcctaccgcagtatatggagcacatatacgcaagccttcacaaca
gcccgacatcgtctttgcacggtaaattattattattattattaccactcgcgttttatt
ttcgaaatttcgattgttcaacactggcactggtcaatttttacagggcttagttttcct
tcggaatatctcacgtcgataccaccgccgtcaacggtggcgagtaccgaattgccatat
tctatagattcgagacttccctcgccttgtccttctagtgctataagacaaagtagaaag
cgtgctttgtcatcgtctccctattccgactctttcgacatcaattctatgataaggttt
tcgccaaatagtttagttaatagtttagttaatgggagtcggagttcgtcagcgagcgga
agttatggacatttgtctgcaggggctctcagtcccgcacttaacatgcacatgccgcaa
ctacaggctcatttgcttcggagtcaaggacttttaccacctctgggtccgacttcgcac
acacaaggatctcatggtagtttgttttctatatctcatcatcctttgggttcaactgca
tcacttccaaaagttgaaggaagacaagattgcagtataagagccgaagcagacagtttg
actgatagaaaggtaatttatttatttattgattttaaatttgtttctatttatatcttt
ttattcttgttatgtctgaaacgagaaaacaaatttttaaaattaaataatcatctttcc
aaatcattccagcagactaatagaatcaaaaaagaaacaaaaacaggaaccggaaccgga
ggaggaggtggtggtggtacagaaacgacaaaatcacccgattgcggtgatttaaaagat
gaacccgcggatttcatcgaaacaaattgtcactggaaagaatgcactatggaatttcca
acccaagatgatttagttaaacatataaacaacgatcacatacatgtaaataaaaaaagt
tttatatgtcgttgggaagattgttctagagatgaaaaaccatttaaagctcaatacatg
ctcgtggtacacatgcgacggcacactggagaaaaacctcataaatgcacgttcgaaggt
tgttttaaagcatattcgagattagagaatttaaaaactcatttaagatcacacactgga
gaaaaaccatacacttgcgaatatccaggttgttcgaaagcattcagtaatgcgagcgat
agagcaaaacatcaaaatcggacacattcgaatgagaaaccgtacgtttgtagagctccc
ggttgttcgaaaaggtatacggatccaagttctcttagaaaacacgttaaaaccgtacac
ggagctgatttttacgcaaataaaaaacacaaattagggccatcacctgatcaagaacct
gacgggtcaactaatatgccctcaccttcgaggtcggatgaaggtcaactatcaaaaaca
acatcattatcgagtccttccactgttaaatccgaagaagcgcctagtcctggtacgaat
caaggttctcctctatcgaggcagcatgccgtttggggagacgaagtcagtgacagtcca
ccatccgttttagcagatctcgttgaagatgctaactggtcggaagacatcgacttagga
tccgatctcagcgtggcggtaacaacgagaaatacgagaaatcgtcttaaatcgagattg
caagccaaaggacttgcactatcgtctgctccgggcggaatgagattgatagatctcgga
agaaaaatagcagaattaaaaatggaacctaaaatccaagagcaaacgcgattgggtcca
aaatcttgcggtccaggtattaaaacgatactcgataataacagaagagattcgaattcg
acggttagttgctacggtacaatgtctcacgtgtcaagtagacgtaacagtcaagcatct
caagcatcacgtgccaacagctgtgccatagcttctttttatgaccccatatctccggga
agttcacgtcgatcgtctcaaatgtcacaaccgggaagaagtccatcgataatgggaaca
aattctcaaatatcaatgatgcattcacatcaatatggtaccatgtgtcagggtggtaaa
cctggaaccgttaaaactttgatgagtccgacaaacagtccgaattatcaaccgatttct
ccgttgcccaatcacttgagtccgagtcattcttcgaccgttgctcaaaatatccacgct
ttgagccccaattcgaattctctttgtccgaatttgttgtgttcagacgttctcagtcct
aattcaaatattttaagtcccatttacaattccaatgttagttcactgacagcaaatcac
aatataaacagttcctccttatctgttggtgttcaaactgtagattccgtaccgactttg
gcaacattaggccctgctatgagtccggttcgaaacatttttaccaacacatcgaattta
gttcttcagactgccaacatgtcactaaatggagaacttccaccggttttaccaccagtt
aatcctactgaaccttgctcagacgtaacgcagcagccaacaattgatccccttcatccg
aatcaagaagttcaactagaacagattaatgaaggcgaaatgattgaaaataaattagtc
attcccgacgaaatggaaagatatttgagtcaagtggctgccatacttgatactgataat
caaatcacagaattgtcatcacctcccgacccgaaattagaaacaaaaacggaaactttt
aatcaagactgcaacgctgaagttcacaacatccaacaagttttcacagacttcaattca
aacgacatgaatgatcaaaatgttaaaaaactcaacacaaataccaccaccaccaccaca
accaacaacaatcaagcacagcaaattgttattaatccagcggctcaacattccgatcca
tcagacgacaaatctaccgtcagtcaagctaccaccaacattaatcaacaaaatggaaat
tattcaaattatggaaataatcaatgtataacacaacacggtcacgatcattatccgcca
tcgcactaccatcaccaccatcacggttcatattgttctcaaaaccaaggaaaccaccac
tatcacaattaccaaactcagttacaaaatcaacaaggtagagcacccgatagaaacggt
tacaatttcaacaattacaggtgtcatttaaacaatggtaccaaacctgtacaaaccaat
caagtatgttcgcaaactcccattccgggacaaaactatcagcaagatttcaattcttct
cttcaacatcctcaccaatcttctttttatccgtcgtgtcaaaatcatttatgttacgca
cacgatcattgcacgaattgcgtaaacgtttgccagcaaactccaaactatccgcaatgc
ggtaacaatcaaatacacaattgcaacaccggtcaccaagtcatgaacaattctcacacg
gtacatcaaaccgtaccttataattctcaaatccaacaaaatcaaacaatcaacggacaa
tattcacgatgcggttgtaacaatggaaacaatcacgaagtgaaaacaaattgtgttcaa
catcatcacaacaaaatgtgtagaagttgtcactatcagaacaacggagtcggtgtcgta
ggaggaggtgtaacgcctggaactctaaacaaagactcggaaaaaaacatttataaaaat
ttcaacggagaaaattacgataacgaaatccagtgcaccgacattagccaatccgaagtg
agaatgccacgtgacgcttacgaaagaactctggaatatgttcaacaatgtcaaatatgg
tcgaacgaagtttccagttccactcatccgacatccaacatggtcgtcaacgatttgaca
tcttctttgaattctctaatgcaagaaaatcgtttttttcaaatgattaattaa

DBGET integrated database retrieval system