KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM452780
Entry
Phum_PHUM452780   CDS       T01223                                 

Definition
(RefSeq) suppressor of fused, putative
  KO
K06229  suppressor of fused
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:phu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04341 Hedgehog signaling pathway - fly
    Phum_PHUM452780
SSDB
Motif
Pfam: SUFU_C SUFU
Other DBs
NCBI-GeneID: 8230488
NCBI-ProteinID: XP_002429835
VectorBase: PHUM452780
UniProt: E0VUP1
AA seq 475 aa
MAEDNSRIKNHALPVLPPTPPGLEALYSLCRRIYPEQENPLQVTAVIKYWLGGPDPLDYI
SMYLNPGNPSINVPPHWHYISFGLSDLHGDGRVHEVSDSDSPSGFGFELTFRLKREPEET
APPTWPAAVMQALAKYVFSSGNTLCPNDHVSWHCALDNSESRIQHMLMYQDLQLGTVQTP
FGPVNFVQIVGITKEELQAAQHWNGAGVLDILKRLPGAGGEWLVTDMRRGESMLELDLNA
QEIIEKGIETEGSNLGGVSAKCSWIEKDFDIECSLHEQSSIIAKSELGGPRISEQESQQI
KSELKKGLLSSKPGINNSLIKTEDFEDFDRYVLFFLPNVSVRKSDIMFQGNFAESTELVH
VVHLEGIHLTFNLESGILLPLALRGRVKHGRHFTFKSVLGDTAITFVASSVTGTFVNSDH
PYAAHGPWLQVLIPDDFATEMITDIEMLNQNTDEITFPKTFAWPDRKIVITIVPN
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggccgaagacaattcaagaattaaaaatcatgctttacccgtgcttccaccgactcct
cctggtttagaagcattgtattccctctgtagaagaatttatccggaacaagaaaatcca
cttcaagtaactgcggttattaaatactggttgggtggtccagatcctttagattatata
agtatgtatttaaatcctggaaatccgagcataaatgtaccaccgcattggcattacatc
agttttggtttatccgatttacatggtgatggaagagtacacgaagtttctgattctgat
tctccaagcggtttcggttttgaattgacatttagacttaagagagaacccgaagaaaca
gcaccaccgacttggccagcagcagttatgcaagcacttgctaaatatgttttcagctct
ggaaacacattatgtccaaatgatcatgtgtcttggcattgtgctcttgataattctgaa
tctagaattcaacacatgcttatgtatcaagatttacaacttggaactgtgcaaacccca
ttcggaccggttaatttcgttcaaatcgttggaataactaaagaagaattacaagcagct
caacattggaacggtgctggagttttggacattttaaaaagattgccaggagctggggga
gaatggttggtcactgacatgagacgaggggaaagtatgcttgaactggatttgaacgct
caggaaataattgaaaaaggtatcgaaactgagggatcaaatttaggtggtgttagtgcg
aaatgttcatggattgaaaaagactttgacattgaatgcagtttacatgaacaaagttca
attattgctaaatcagaacttggggggcctagaatatcggaacaagaaagtcaacaaata
aaaagtgaacttaaaaaaggtttgctaagttcaaaacctggaataaacaattcgttaatt
aaaacggaagatttcgaagactttgacaggtatgtcctctttttccttccaaatgtgagc
gttagaaaaagcgatatcatgtttcaaggtaactttgcagaatccaccgaattagttcat
gttgtacatttagaaggaatacatttgacatttaatttagaatctggaattcttcttcca
ttagctctaaggggaagagtcaaacacggacgtcattttacatttaaatccgttctcgga
gacacggccatcacatttgtggcatcatccgtcacgggtacttttgtcaattccgatcat
ccctatgcagcacacggaccttggcttcaggtattgataccggatgattttgctacggaa
atgataacggatatcgagatgttaaatcaaaatacggatgaaataacgtttccgaaaacg
ttcgcttggccggatagaaaaattgttattacaatcgtgcctaattga

DBGET integrated database retrieval system