KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM490680
Entry
Phum_PHUM490680   CDS       T01223                                 

Definition
(RefSeq) hypothetical protein
  KO
K24680  protein dispatched 1
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:phu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04341 Hedgehog signaling pathway - fly
    Phum_PHUM490680
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:phu04990]
    Phum_PHUM490680
Domain-containing proteins not elsewhere classified [BR:phu04990]
 Other domain-containing proteins
  Patched domain-containing proteins
   Phum_PHUM490680
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 8235751
NCBI-ProteinID: XP_002430568
VectorBase: PHUM490680
UniProt: E0VWS4
AA seq 1108 aa
MNWYFKFVANHPFVVVSTIGTLSVAALIISLISSKQPDFSDPQLGFETRGTIIAKRIISW
ENLYEAARPSGILTVNPNAVNSVFKSTNTSSNNSSTSKELLSNFLWHTQLNNSSSEEENY
GKVKKLNDKVENYNDDEESFEIEKNFEEDFSNLESAHNHSHDHLSSDGFFCDVINPDYSH
LVVETVNSSQSLLSLDALKSICIIQENLMNNEIMDSICQTVSHGHCCNPWSLPNYIALLY
NHTSCFNITEKSVGKTKALLYECSKYYNNLQLSSDCHDKTLCRGVPKKCKKFNAVYNILY
YLTDVDFLPSNYSKIKKENVFLNYTMIFLPIARSSAILPYYYNLSSSILKHDSVFVSAMD
LGLKNTLFNDCLVRDAFLTVAGGGFMILCIWTYTNSIVITISTLLAVFMSLITSYFIYTF
IFNIKFFPFMNLLAIIVAIGIGADDAFIFHKIWNCLKMDKGNPCLVKLVSDTLKHSSLSM
FVTSLTTAAAFYSSSVSSITAINCFSVFAGTAVLVNFLLTVTWLPACFVISQKNLFPSVL
CQCQPNFFNQFQTANKYLYQVKATIEKSLITLIFRLRWLWLIIFSAIAIGSSVIVLYHPK
LRLPDSKNFHLFQSSHLFEKYDFVYKDKFWFERLERVTGWDNSNFKLPLRFVWGIHPVDN
GNYFEPNSKGTLEFDPTFDMADPESQAWLLDFCRHLRTQPFYQSTHGPLLPNCFIESFKN
WMQRRCKDSIDNIDRTPCCESSLFPFERETFKKCIKEAIGSLYETPSDYFLPGVAGPKFS
KTSSGEIKVVVVEYDSNYSNSLSFTDMHAFYTEVEDWFQKQLEGAPRGMKNGWFISHLGF
YDLQLALSNGTSVAIGVSMMIALTVFFFVSLNLLISIYTVITISCIIFVTVGFLVLIGWR
LNVLESIAVTTAIGLAVDFSLHYGIHYGLSIDNDRKSAVEFTLNKMIGPTFMAALTTGAA
GFFMLPSSVLAYIQIGVFLLILMTSSWFYSTIFLMSLLSVFGPLKGFGQFSYKHIFRLCS
EKDINSPAQSNKTLYTNIFSDVLPSSSATDEIVSRSPRNSREIHEVKTLTGLNRKKWRLK
NGKKSCLKHQSSEENAFSITTPLSDKNG
NT seq 3327 nt   +upstreamnt  +downstreamnt
atgaactggtattttaaattcgtagccaaccatccctttgtggttgtatcaactatagga
acactttcggttgctgctcttattatttctttaattagttcaaaacaaccggatttttct
gatccacaactgggctttgaaactaggggaacaatcatagccaaaagaataatttcatgg
gaaaatttatatgaagccgcaagaccttctggtattcttacagtaaatccaaatgctgtc
aattcggtttttaaatcgactaatacatctagcaataattcttctacatcgaaagaattg
ctaagtaattttttatggcacactcaattaaataattcttcttctgaagaagaaaattat
ggaaaggtcaaaaagttaaatgacaaagtagaaaattataacgacgatgaagaatccttt
gaaattgagaaaaattttgaagaagatttttccaacttggaatcggctcacaatcattcg
catgatcatttatccagtgatggatttttctgtgatgtaataaatccagattattctcat
ttggtcgtagaaaccgttaattcttcgcagtctttgctatcgttagatgcattaaaatct
atttgcataattcaagaaaatttaatgaataatgaaattatggattcaatatgtcaaaca
gtttcacatggccattgttgtaatccatggagtcttcccaattatatcgctctactgtat
aatcataccagttgctttaacataacagaaaaaagtgttgggaaaacaaaagcattgtta
tacgagtgttctaaatattataacaatttgcaattgagttcagattgtcatgataaaact
ctttgtcgaggagttccaaaaaaatgtaaaaaatttaatgcagtttacaacatactatat
tacttgactgatgttgatttcttaccttcaaattactccaaaattaaaaaagaaaatgta
tttcttaattacacaatgatttttttacccattgcacgaagttcagccatattgccttat
tattataatttatcttcttctattttaaagcatgattccgtgtttgtttcagcaatggac
ctaggtttaaaaaatacactttttaatgattgcctcgtgagagatgcttttctgacagtt
gcaggaggtggttttatgattttatgtatttggacttacactaattccatagtaattaca
atttcaacacttctggcagtttttatgtctctcattacatcatactttatttatacattt
atttttaatataaaattttttccttttatgaatcttttggcaatcatagtggccattggt
atcggagccgatgatgcattcatatttcataaaatatggaactgtttaaagatggacaaa
ggaaatccatgtttggtaaaactggtgtcagatactctaaagcattcatctctatccatg
tttgtaacttctttgacgactgcggcagcattttattccagctcagtaagttctatcaca
gccattaattgtttcagcgtattcgctggaactgcagtcttagtaaattttttactgacc
gttacatggttacctgcttgttttgtgatttcacaaaaaaatttatttccctcggtattg
tgtcaatgccagcctaattttttcaatcaatttcaaacggctaacaaatatttatatcag
gttaaagccaccattgaaaaatcgttgataacgttaatatttcgccttagatggctgtgg
ctaataatattttccgccattgctattggaagttctgtaattgttttatatcatccaaaa
ttgagacttccggattcaaaaaattttcatttgtttcaatctagtcatttatttgaaaaa
tacgattttgtatataaagataaattttggttcgaaagactggaaagggtaactggatgg
gataatagtaattttaaattaccgttgagattcgtatggggcatacatcccgtcgacaat
ggaaattatttcgaacccaattctaaaggcacgttggaattcgatccgacattcgacatg
gcggatccggaatctcaagcttggctacttgatttctgtcgtcatcttcgaactcaaccg
ttttatcaatcaacccatgggccattgttgccaaattgttttattgaatcatttaaaaat
tggatgcaaagacgttgcaaagattccatagacaacatagatcgtactccatgttgtgaa
tcatctttatttccgttcgagcgtgaaacttttaaaaagtgcattaaagaagcgatcggt
agtttatacgaaacaccttccgattattttcttcccggagtggctggacccaagttttct
aaaacgtccagcggggaaattaaagtcgtggtggtcgaatatgacagtaattattccaat
tctttgtccttcaccgacatgcacgccttttacaccgaagtagaagattggtttcaaaaa
cagttggagggtgcaccacgtggaatgaagaacggatggtttatcagccatttgggtttc
tacgatctccaattagctttatcgaatggtacttccgtggcaatcggagtgtccatgatg
atcgcattgaccgtattttttttcgttagtttaaatttactgattagcatatacaccgtc
attacgatttcttgtattattttcgtgacggttggatttttggtgttgatcggttggaga
ttgaacgtgttagaatcgattgctgttaccacggctatcggactcgcagtggattttagt
cttcattacgggattcattatggactttcgatagacaatgacaggaagtcagcagttgaa
ttcacgcttaataaaatgattggtccaactttcatggctgctctcacgaccggagccgcg
gggtttttcatgctcccatcttcggttttagcttacattcaaatcggagtatttttatta
atattgatgacgtccagttggttttactccacaatatttctcatgtcacttttaagtgtt
ttcggtccgctcaaaggtttcggacagttttcttacaaacacatatttaggctgtgcagt
gaaaaagacataaattcaccagctcaaagtaataaaacattgtatacgaacatattttcc
gatgttttgccgtcatctagtgcaacagacgaaatcgtatcacgatcaccgcgaaattca
agggaaatccacgaagtgaaaacactcacgggtttgaataggaaaaaatggcgtttaaaa
aatggtaaaaaatcgtgtttgaaacaccaatcgtccgaagaaaatgctttttcgataacg
actccattatcggataaaaacggttga

DBGET integrated database retrieval system