KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM503280
Entry
Phum_PHUM503280   CDS       T01223                                 

Definition
(RefSeq) hypothetical protein
  KO
K03094  S-phase kinase-associated protein 1
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04120  Ubiquitin mediated proteolysis
phu04141  Protein processing in endoplasmic reticulum
phu04310  Wnt signaling pathway
phu04341  Hedgehog signaling pathway - fly
phu04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:phu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Phum_PHUM503280
   04120 Ubiquitin mediated proteolysis
    Phum_PHUM503280
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Phum_PHUM503280
   04341 Hedgehog signaling pathway - fly
    Phum_PHUM503280
   04350 TGF-beta signaling pathway
    Phum_PHUM503280
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:phu04121]
    Phum_PHUM503280
   03036 Chromosome and associated proteins [BR:phu03036]
    Phum_PHUM503280
Ubiquitin system [BR:phu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     Phum_PHUM503280
   Cul7 complex
     Phum_PHUM503280
Chromosome and associated proteins [BR:phu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     Phum_PHUM503280
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     Phum_PHUM503280
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 8231584
NCBI-ProteinID: XP_002430890
VectorBase: PHUM503280
UniProt: E0VXP6
AA seq 157 aa
MPNIKLQSSDGEVFEVDVEVAKCSGTIKTMLEDLGMEDDDEEVVPLPNVNSVIQWATYHK
DDPPPPEDEEIKEKRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDITCKTVANM
IKGKTPEEVRKTFNIKNDFTAAEEEQVRKENEWCEEK
NT seq 474 nt   +upstreamnt  +downstreamnt
atgcctaatattaaactccaaagctctgatggagaagtttttgaggttgatgtcgaagta
gccaaatgtagtggtacaattaaaactatgttggaagatctcggaatggaagatgacgat
gaagaagttgtccctcttccaaatgttaattctgttatacaatgggctacttatcacaag
gatgatccaccaccaccagaagatgaagaaattaaagaaaagagaactgatgacatatct
tcttgggatgctgattttttaaaagttgaccaaggaacacttttcgaattaatattggct
gctaattacctggatataaaaggattgttagacataacatgcaaaacggtggcgaatatg
ataaaaggtaaaacaccagaagaagtacgtaaaacatttaatataaaaaatgattttaca
gcagcagaagaagaacaagttcgaaaagagaatgaatggtgcgaagaaaaataa

DBGET integrated database retrieval system