KEGG   Pigmentiphaga sp. H8: EGT29_20110
Entry
EGT29_20110       CDS       T05719                                 

Definition
(GenBank) 2-hydroxychromene-2-carboxylate isomerase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
pig  Pigmentiphaga sp. H8
Pathway
pig00626  Naphthalene degradation
pig01100  Metabolic pathways
pig01120  Microbial metabolism in diverse environments
pig01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pig00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    EGT29_20110
Enzymes [BR:pig01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     EGT29_20110
SSDB
Motif
Pfam: DSBA Thioredoxin_4
Other DBs
NCBI-ProteinID: AZG09974
UniProt: A0A3G8GPQ6
Position
complement(4255827..4256429)
AA seq 200 aa
MKIEMYWDVGSTNTYFAIKLIKPLLARYGAELVLHPFNLGYVFRSNNYELMKEPKAKLRN
RKRDLMRWAEKYGLPFQMPREFPIKSSRALRGSLAMRRHGKELEFVERVMERYWEHGDAS
IAEYAGLRPIAQALGVDPDAFERLSASDEIAEELARSTNEGVAREVFGVPMIIVGDELFW
GKDRMEFVEDELRRRQARAA
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaagatcgagatgtactgggacgtgggcagcaccaatacctatttcgccatcaagctg
atcaagccattgctggcgcgctacggcgccgaactggtgctgcacccgttcaacctgggc
tacgtgttccgcagcaacaactacgaactgatgaaggaacccaaggcgaagctgcgcaac
cgcaagcgcgacctgatgcgctgggccgagaagtacggcctgccgttccagatgccgcgc
gagttcccgatcaaatccagccgtgccttgcgcggatcgctggccatgcgccgccacggc
aaggaactggaattcgtcgagcgggtcatggagcgctactgggagcacggcgacgccagc
atcgccgagtatgccggcctgcgtcccatcgcccaggcgctgggggtggatccggacgcg
ttcgagcgcctgagcgcctcggacgagattgccgaggaactggcccgcagcaccaacgag
ggcgtcgcgcgcgaggtgttcggcgtgccgatgatcatcgtcggcgacgagctgttctgg
ggcaaggaccggatggagttcgtcgaggacgagctgcggcgccggcaggcccgcgcggcc
tag

DBGET integrated database retrieval system