KEGG   Parvibaculum lavamentivorans: Plav_3649
Entry
Plav_3649         CDS       T00580                                 

Definition
(GenBank) DSBA oxidoreductase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00626  Naphthalene degradation
pla01100  Metabolic pathways
pla01120  Microbial metabolism in diverse environments
pla01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pla00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    Plav_3649
Enzymes [BR:pla01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     Plav_3649
SSDB
Motif
Pfam: DSBA Thioredoxin_4
Other DBs
NCBI-ProteinID: ABS65247
UniProt: A7HZB4
Position
complement(3904160..3904756)
AA seq 198 aa
MTRTVEFYFDYPSPYTYLAHEQMKSLGAPVVYRPMHILSVMKLVGNIPSPACPPKGRYAG
MDAARWAKRLGIPMATNAEFWTALLAGKLDGKLLTRGAMAAQELGLAGAYNDAIFNAVWK
TPRDIVTAEGRDAVLADAGIAGKGIWETAETPEFHERLETETKAAAERGVFGTPTFFVGD
EIFFGNDRLDFVREAAAA
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaccaggactgtcgagttttatttcgattatccgagcccctacacctatctcgcgcat
gagcagatgaaatcgcttggcgcgcccgtggtctaccgcccgatgcatattctgagcgtg
atgaagctcgttggaaacataccttcgcccgcctgcccaccgaagggacgctatgccggg
atggacgcggcgcgctgggcgaagcggctcggcattccgatggcgaccaatgcggaattc
tggacggcgcttctggcgggcaagctcgacgggaaactgctaacacgcggcgcgatggcg
gcgcaggagctcgggcttgccggggcctacaatgacgcgattttcaatgcggtctggaag
acgccgcgcgatatcgtgacggcggaaggacgcgacgccgtgctggccgatgccgggatc
gccggcaagggcatttgggaaacggcggagacgcccgaattccacgaacggctggaaacc
gaaacgaaggcggcggcggagcgaggcgtcttcggcacgccgaccttcttcgtcggcgat
gaaattttcttcggcaatgaccggctcgactttgtgcgcgaagccgcagccgcctga

DBGET integrated database retrieval system