KEGG   Pseudomonas lalkuanensis: FXN65_13830
Entry
FXN65_13830       CDS       T07120                                 
Name
(GenBank) aldehyde dehydrogenase family protein
  KO
K20199  4-hydroxybenzaldehyde dehydrogenase (NADP+) [EC:1.2.1.96]
Organism
plal  Pseudomonas lalkuanensis
Pathway
plal00623  Toluene degradation
plal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:plal00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    FXN65_13830
Enzymes [BR:plal01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.96  4-hydroxybenzaldehyde dehydrogenase (NADP+)
     FXN65_13830
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: QEY63090
UniProt: A0A5J6QKI8
Position
2980090..2981565
AA seq 491 aa
MSTSRPTYQNLELQMIAGQWRAGSSSRQLDVINPFDQELLARLTLANKDDLEHAFLKARE
AQASWSAKGPAERAEVLLNVVRIFDERRDEIIDWIIRESGSTRIKAEFEWGAARAITLES
ASLPNRVHGRIVESDVPGKESRVYRAPLGVVGVISPWNFPLHLTQRSIAPALALGNAVVV
KPASDTPVTGGLLLARIFEEAGLPAGVLSIVVGSGAEIGDAFVAHPVPALISFTGSTEVG
RNIGRIASGGQHLKQVALELGGNAPFVVLADADLEQAVRAAVVGKFLHQGQICMAINRII
VEEPLYEAFTRRFVERVKSLPYGDPSRPDTVVGPVINSRQLETLQAKVSKAKAEGAVTLV
EGLAEGNVLPPHVFGEVTPEMDIVREEIFGPLVGILRARDAEHALELANDTEYGLSSAVF
TASLERGVQFARRIRAGMTHINDIPVSDAPNAPFGGEKNSGIGRFNGDWAIDEFTTVHWI
TVQRTPRHYPF
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgagcacttctcgtcccacctatcagaacctcgaactccagatgatcgccggccaatgg
cgtgccggcagtagtagccgccagttggacgtcatcaaccccttcgaccaagaactgctg
gccaggctgaccttggcaaacaaggacgacctggagcatgcgtttctgaaggctcgtgaa
gcccaggcttcctggtcggcaaagggccccgcagagcgggccgaagtattgctcaacgtc
gtcaggatcttcgatgagcgccgcgacgaaatcatcgactggatcatccgggagtcaggc
agcacgcggatcaaggccgaattcgaatggggcgcggctcgggcgattaccctggagtca
gccagcctgccgaatcgcgtccatgggcgtatcgtcgagtccgatgtcccaggcaaagag
agccgcgtctatcgcgcgcctctgggtgtagttggtgtgatcagcccctggaactttccc
ctccatctgacccagcgatccattgcacccgccctcgcccttggcaatgcagtggtagtc
aaaccggcaagcgatacacctgtgacgggcggcctgctgctggcgaggatcttcgaagaa
gcggggcttccggctggcgtgctgagtatcgtggtaggttccggcgctgaaattggtgac
gccttcgtcgcgcatccggttccggctctcatttccttcacgggttccaccgaggtgggt
cggaatatcggacggatcgccagcggaggccagcacctgaagcaggttgcactggaactc
gggggcaacgcgccgttcgtggtactggccgatgcggatcttgaacaagccgtgcgcgcc
gcggtggttggcaagttccttcaccaggggcaaatctgcatggccatcaaccggatcatc
gttgaagagccgctttacgaggcgttcactaggcgtttcgtcgagcgcgtgaagtcgctg
ccatatggtgatccgagcagacccgacacggttgtcggccccgtcatcaactcccggcaa
ctggagacgttgcaagccaaggtcagcaaagccaaggccgaaggcgctgtcacattggta
gaaggactggccgagggcaacgttcttcccccccatgtgttcggggaggtaacccccgaa
atggacatcgtgcgcgaagagatctttggccccctggtcgggatacttcgtgccagggac
gctgaacacgccctggaactcgccaacgacaccgaatacggcctctccagtgccgttttc
acggcgagcctggagcgcggcgtgcagttcgctcgccgcatccgcgccggcatgacccat
atcaacgatattccggtcagcgatgcgccgaacgcacccttcggtggtgagaagaactcc
ggcatcggtcgtttcaatggcgattgggccatcgacgaattcacgacggttcactggatc
accgtacagcgcacacctcgacactatccgttctga

DBGET integrated database retrieval system