KEGG   Pleurocapsa sp. PCC 7327: Ple7327_2513
Entry
Ple7327_2513      CDS       T02367                                 
Name
(GenBank) homoaconitate hydratase family protein/3-isopropylmalate dehydratase, large subunit
  KO
K17749  3-benzylmalate isomerase [EC:4.2.1.-]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
plp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
plp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ple7327_2513
Enzymes [BR:plp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-
     Ple7327_2513
SSDB
Motif
Pfam: Aconitase Aconitase_C AcnX
Other DBs
NCBI-ProteinID: AFY77804
UniProt: K9T743
Position
2711284..2713002
AA seq 572 aa
MVNISEKILILGDDINTDDIIPAKRGTNADPAHLARYAFEHLIGEGKLLEYDIIEAGHNF
GCGSSREFAPIAIKVAGIKKVRARSFAEIFYRNSINIGLSLEIIGDSQQNPVVDAIARAG
GLITFNQKRLRGEVSVPKSLTPARSMTMAEKMLARASGNAFVQPGEVIFAKVDLAMSHDA
IAGPVAQLFYQHFGENAKVWNANKVVLVADHFIQINDIRKDEGATKMHQQMVQFAREQGC
HLLDVVSPGEAAGICHVLLPEKGFIRPGMVIAGTDSHSCTYGAFGCFSTGVGTTDMANLF
ATGDMWIRVPGTLLFELSGTLPKQIGAKDIMLFILGQIGCNGATGKAIEFRGSIIEQLPI
DERMTLANMAIECGAICGLIASDEVTLKYVQSRTQEEFEVITSDRDAEYEEIYRFDLSSL
EPQIACPQKPDRVVSIGELGEVPITRAFIGSCTGGKLFDLAQAAEVLKGRRVDPRVSLFV
VPASGEVRQKAQELGYLDILEQAGAQVLKSGCGACINAGIGVLGKEETGIYATNRNFKGR
SGDPTARNYLASPRVVAISAVKGKISDRIEDK
NT seq 1719 nt   +upstreamnt  +downstreamnt
gtggtgaatatctcagagaaaattttaatactcggtgatgatattaacaccgatgatatt
atcccagccaaacgcggcaccaatgccgatcccgcccatttagcacgctatgccttcgaa
catctaataggagaagggaagctgctagaatacgatatcatcgaggcaggacataacttt
ggctgcggttctagtcgagaatttgctccaattgctatcaaagtagcaggaattaaaaaa
gttcgcgctcgttcttttgcagaaattttctatcgcaatagtatcaatatcggtctatca
ttagaaattatcggggatagccaacagaatccagtcgtagatgcgatcgcgcgggcaggc
ggtttaattaccttcaaccaaaaacgtctgagaggtgaagtttctgtacccaaaagtctc
acgccagcgcgatcgatgacgatggcagaaaagatgcttgcccgtgcttcgggcaatgct
ttcgtccaacctggcgaggttatttttgccaaagtcgatttggcaatgtcccacgatgcc
attgcagggccagtcgctcaacttttctaccagcattttggagagaatgcgaaagtctgg
aatgcaaataaagttgttttagttgccgatcatttcattcaaattaacgacatcaggaaa
gatgaaggcgcaacgaagatgcatcaacaaatggtgcaatttgcacgagagcaaggttgc
catctattagacgtggtttctccaggcgaagcggcaggtatttgccacgttctcctacca
gaaaaaggcttcatccgtccagggatggttattgcagggacggattctcatagttgcacc
tatggggcatttggttgcttttctactggggtaggaacgactgacatggcgaatctcttt
gcaactggggatatgtggattcgcgttccaggaacgttgctgtttgaattatcgggaacg
cttcccaaacagatcggcgctaaagatattatgctctttatcctgggtcaaatcggctgc
aatggggcaactggaaaggcgatcgaatttcggggcagtattatcgagcaattgccaatc
gacgaacgcatgactctggcaaatatggcgatcgagtgcggggcgatatgcggtttaatt
gcttccgatgaagtgacgcttaagtacgtgcaaagtcgcacgcaagaggaatttgaagta
ataaccagcgatcgcgatgcagaatacgaagaaatttatcgattcgatctcagtagtcta
gaaccgcaaattgcctgtccgcaaaaacccgatcgcgtggtcagtattggggaattgggt
gaagttcctattacgcgggcgtttatcggttcctgcacgggaggaaaactcttcgatctg
gcccaagctgctgaagtgcttaaagggcgcagagttgaccctagagtaagtctgtttgtc
gttcccgcttctggagaggttcgtcaaaaagctcaggaattgggctacttagatatctta
gaacaagcaggcgcacaggttctcaaatctggctgcggtgcttgcatcaatgccggaatt
ggagttttaggcaaagaagagacggggatttatgccaccaatcgtaactttaagggacgc
agtggcgatccgacggctagaaattatcttgcctctccgcgcgtggttgcgatttcagca
gtaaaggggaaaattagcgatcgcatcgaggataaatga

DBGET integrated database retrieval system