KEGG   Paenibacillus lycopersici: GXP70_23190
Entry
GXP70_23190       CDS       T07013                                 

Definition
(GenBank) NAD(P)-dependent oxidoreductase
  KO
K24311  UDP-4-keto-6-deoxy-GlcNAc-4-reductase [EC:1.1.1.-]
Organism
plyc  Paenibacillus lycopersici
Pathway
plyc00541  O-Antigen nucleotide sugar biosynthesis
plyc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plyc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    GXP70_23190
Enzymes [BR:plyc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     GXP70_23190
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind adh_short Polysacc_synt_2 3Beta_HSD NAD_binding_10 NmrA
Other DBs
NCBI-ProteinID: QHT62597
UniProt: A0A6C0G160
Position
complement(5287214..5288332)
AA seq 372 aa
MSRPRLLVTGAGGFCGEHACRHFAARGWHVTAAVRRLPAAGAAAEAWIGGVDAVLAGDLS
SRSETEALVERAAPDYVLHLAGANAVGASWSDPAAVLQSNVMGTVHLLEGVRRLGKPCRV
LVAGSMLRFPLAASAGTTGAAGGAGAVEAGAGAAGQAGTHGAPGGAGAAEAGAAGQAGML
GACDGAGVAEAGAAGPQPQHPYSLSKTMQVLVAQSWASLFGMEIIVAEPSNLIGPGRSGG
LCGLLARYAAGAERAAADGAPAPAPFRFSSRSEQRDLLDVRDAIAAYEALLLAGESGRVY
PVASGIMRTLEEIADAFGALALHPLRWEFGDSDAASPAPADISAALALGWSPRHALRESL
QDALNAARHANP
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgagccggccgcgcctgctcgtcacaggcgcgggaggtttctgcggcgagcatgcctgc
cggcatttcgccgcgcgcggctggcacgtgacggccgcggttcgccggctcccggccgcg
ggcgcggcggcggaggcatggatcggtggcgtcgatgccgtcctagccggcgatctgtcc
tcgcggagcgagacggaagcgctggtggaacgcgcggcgccggattacgtgcttcatctc
gcgggcgccaacgccgtcggcgcgtcctggagcgatccggcggccgtgctgcaaagcaac
gtgatgggcaccgtccatctgctcgaaggcgtccggcggctcggcaagccgtgccgtgtg
ctggtcgccggctcgatgctgcggttcccgcttgccgcgtcggcggggacgaccggcgcg
gccggcggagcgggagcggttgaggcaggtgccggagcggccggtcaagcggggacgcac
ggagcgcccggcggagcgggagcagcagaggccggagcagctggtcaagcggggatgctt
ggcgcgtgcgacggagcgggagtagcagaggccggagctgccggcccgcagccgcagcat
ccgtacagcttgagcaagacgatgcaggtactcgtcgcgcagagctgggcgtcgctgttc
gggatggagatcatcgtcgcagagccgtccaatctgatcggtcccggcaggtcgggcggc
ttgtgcggcctgctcgcgcgttatgccgcgggcgccgaacgcgcggctgcggacggcgca
ccggcaccggcgccgttccgcttctcctcgcggagcgagcagcgcgacctactggacgtc
cgcgatgcgatcgccgcttacgaggcgctgctcctggccggcgaaagcggccgcgtctat
cccgtggcgtccggcattatgcggacgctggaggaaatcgccgacgctttcggcgcgctc
gcgctgcacccgttgcgctgggagttcggcgattcggacgcggcatcgccagcgcctgcg
gacattagcgccgcgcttgcgctcggttggtcgccgcgccatgcgctgcgagaatcgctg
caggatgcgctgaacgccgcgcgccatgcgaatccgtaa

DBGET integrated database retrieval system