KEGG   Pseudomonas monteilii SB3078: X969_10930
Entry
X969_10930        CDS       T02972                                 

Name
(GenBank) benzene 1,2-dioxygenase
  KO
K03268  benzene/toluene/chlorobenzene dioxygenase subunit alpha [EC:1.14.12.3 1.14.12.11 1.14.12.26]
Organism
pmon  Pseudomonas monteilii SB3078
Pathway
pmon00361  Chlorocyclohexane and chlorobenzene degradation
pmon00362  Benzoate degradation
pmon00623  Toluene degradation
pmon00625  Chloroalkane and chloroalkene degradation
pmon01100  Metabolic pathways
pmon01120  Microbial metabolism in diverse environments
pmon01220  Degradation of aromatic compounds
Module
pmon_M00547  Benzene/toluene degradation, benzene => catechol / toluene => 3-methylcatechol
Brite
KEGG Orthology (KO) [BR:pmon00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    X969_10930
   00625 Chloroalkane and chloroalkene degradation
    X969_10930
   00361 Chlorocyclohexane and chlorobenzene degradation
    X969_10930
   00623 Toluene degradation
    X969_10930
Enzymes [BR:pmon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.3  benzene 1,2-dioxygenase
     X969_10930
    1.14.12.11  toluene dioxygenase
     X969_10930
    1.14.12.26  chlorobenzene dioxygenase
     X969_10930
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: AHC82458
Position
2322985..2324337
AA seq 450 aa
MNQTDTSPIRLRRSWNTSEIEALFDEHAGRIDPRIYTDEDLYQLELERVFARSWLLLGHE
TQIRKPGDYITTYMGEDPVVVVRQKDASIAVFLNQCRHRGMRICRADAGNAKAFTCSYHG
WAYDTAGNLVNVPYEAESFACLNKKEWSPLKARVETYKGLIFANWDENAVDLDTYLGEAK
FYMDHMLDRTEAGTEAIPGVQKWVIPCNWKFAAEQFCSDMYHAGTTSHLSGILAGLPEDL
EMADLAPPTVGKQYRASWGGHGSGFYVGDPNLMLAIMGPKVTSYWTEGPASEKAAERLGS
VERGSKLMVEHMTVFPTCSFLPGINTVRTWHPRGPNEVEVWAFTVVDADAPDDIKEEFRR
QTLRTFSAGGVFEQDDGENWVEIQHILRGHKARSRPFNAEMSMDQTVDNDPVYPGRISNN
VYSEEAARGLYAHWLRMMTSPDWDALKATR
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgaatcagaccgacacatcacctatcaggctgcgcaggagctggaacaccagcgagata
gaagcgctctttgacgagcatgccggacgtatcgatccgcgcatttataccgatgaggat
ctgtaccaactcgaactggagcgtgtcttcgcccggtcctggctgctgttggggcatgaa
acccagattcgcaagccgggcgattacatcacgacctacatgggtgaagaccctgtcgtg
gtcgtccggcagaaagacgccagcattgccgtgttcctgaaccagtgccgccaccgtggc
atgcgcatctgccgcgcggatgccggaaacgcgaaggcgttcacttgcagctaccacggg
tgggcttacgacaccgccggcaatcttgtcaatgtgccttacgaggccgaatccttcgcg
tgcctgaacaagaaggaatggagcccgctgaaggcccgggtagaaacctacaagggcctg
attttcgccaactgggatgagaacgctgtagacctcgacacgtatctgggcgaggcgaag
ttctacatggaccacatgctcgaccgcaccgaggccggcaccgaagcgatcccgggcgtg
cagaagtgggtcattccctgtaactggaaattcgccgcagagcagttttgcagcgacatg
taccatgccgggacgacctcgcatctgtctggcatcctggcaggcctgccagaagacctt
gaaatggccgaccttgctccgccgacagttggcaagcagtaccgtgcgtcatggggcgga
catggaagtggcttctatgtcggcgaccccaatctgatgcttgccatcatggggccaaag
gtcaccagctactggaccgaaggccccgcgtcggaaaaggcggccgaacgtctgggtagc
gtggagcgcggctcgaaactcatggtcgagcacatgaccgtcttccccacgtgttccttc
ctcccaggtatcaatacggtccggacatggcatccgcgcgggccgaacgaggtcgaggta
tgggcgtttacggtggtcgatgctgatgctcctgacgatatcaaggaagagttccggcgc
cagacgctgcgcaccttctctgccggtggcgtgttcgagcaggacgacggggagaactgg
gtcgagatccagcacatcctgcgaggccacaaggcgcggagccgccctttcaatgccgag
atgagcatggaccagaccgtcgacaacgacccggtttaccccgggcggatcagcaacaac
gtctacagcgaggaagctgcccgcgggctctatgcccattggctgcggatgatgacatcc
cccgactgggacgcgctgaaggcgacacgctga

DBGET integrated database retrieval system